UDG domain-containing protein

Overview
NameUDG domain-containing protein
Smed IDSMED30006813
Length (bp)2408
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of UDG domain-containing protein (SMED30006813) t-SNE clustered cells

Violin plots show distribution of expression levels for UDG domain-containing protein (SMED30006813) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of UDG domain-containing protein (SMED30006813) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for UDG domain-containing protein (SMED30006813) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of UDG domain-containing protein vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 174.866 bits (442), Expect = 3.079e-47
Identity = 84/181 (46.41%), Postives = 118/181 (65.19%), Query Frame = 1
Query:  157 ILHILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARML-DYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            +   LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW C+   GL    +   DD  +   Y IGFTN   R T G+ DLS KE ++G ++L+ KLQ++ P+I VFNGK  YE F      V+ K+   G QP+++  T ++ +VMPSSSARCAQ PRA DK+ ++  LKDLRD++K
Sbjct:  120 LTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK 300          
BLAST of UDG domain-containing protein vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 174.481 bits (441), Expect = 4.002e-47
Identity = 84/181 (46.41%), Postives = 118/181 (65.19%), Query Frame = 1
Query:  157 ILHILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARML-DYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            +   LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW C+   GL    +   DD  +   Y IGFTN   R T G+ DLS KE ++G ++L+ KLQ++ P+I VFNGK  YE F      V+ K+   G QP+++  T ++ +VMPSSSARCAQ PRA DK+ ++  LKDLRD++K
Sbjct:  116 LTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK 296          
BLAST of UDG domain-containing protein vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 149.443 bits (376), Expect = 8.091e-40
Identity = 73/156 (46.79%), Postives = 101/156 (64.74%), Query Frame = 1
Query:  232 SAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARM-LDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            +A  GH++ GPGNHFW C+   GL    +   DD  +   Y IGFTN   R T G+ DLS KE ++G ++L+ KLQ++ P+I VFNGK  YE F      V+ K+   G QP+++  T ++ +VMPSSSARCAQ PRA DK+ ++  LKDLRD++K
Sbjct:    2 AAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK 157          
BLAST of UDG domain-containing protein vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 118.627 bits (296), Expect = 4.093e-29
Identity = 62/141 (43.97%), Postives = 87/141 (61.70%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARML-DYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNS 570
            LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW  +SEV L        DD  +   Y IGFTN   R T G+ DLS KE ++G ++L+ KLQ++ P+I VFNGK  YE F      V+ K+   G QP+++  T +
Sbjct:  124 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFW--LSEVQL-----NHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTET 257          
BLAST of UDG domain-containing protein vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 81.6481 bits (200), Expect = 6.892e-18
Identity = 38/82 (46.34%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARML-DYSIGFTNACSRATKGAADLSK 411
            LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW C+   GL    +   DD  +   Y IGFTN   R T G+ DLS+
Sbjct:   28 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSR 109          
BLAST of UDG domain-containing protein vs. Ensembl Fly
Match: Thd1 (gene:FBgn0026869 transcript:FBtr0333706)

HSP 1 Score: 216.468 bits (550), Expect = 4.598e-58
Identity = 92/171 (53.80%), Postives = 132/171 (77.19%), Query Frame = 1
Query:  157 ILHILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRD 669
            I   +PD++ ++LD+V++G+NP L +A  GH++AGPGNHFW C+   GL  E ++  +D +++   IGFTN  +RATKG+ADL++KE+K+G ++LL KLQRF PK+ VFNGK  +E F   K F  G+QP+R++GT++ ++VMPSSSARCAQLPRAADK+PF++ALK  RD
Sbjct:  775 IKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGKKEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRD 945          
BLAST of UDG domain-containing protein vs. Ensembl Fly
Match: Thd1 (gene:FBgn0026869 transcript:FBtr0345197)

HSP 1 Score: 216.468 bits (550), Expect = 4.598e-58
Identity = 92/171 (53.80%), Postives = 132/171 (77.19%), Query Frame = 1
Query:  157 ILHILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRD 669
            I   +PD++ ++LD+V++G+NP L +A  GH++AGPGNHFW C+   GL  E ++  +D +++   IGFTN  +RATKG+ADL++KE+K+G ++LL KLQRF PK+ VFNGK  +E F   K F  G+QP+R++GT++ ++VMPSSSARCAQLPRAADK+PF++ALK  RD
Sbjct:  775 IKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGKKEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRD 945          
BLAST of UDG domain-containing protein vs. Ensembl Fly
Match: Thd1 (gene:FBgn0026869 transcript:FBtr0089106)

HSP 1 Score: 216.468 bits (550), Expect = 4.598e-58
Identity = 92/171 (53.80%), Postives = 132/171 (77.19%), Query Frame = 1
Query:  157 ILHILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRD 669
            I   +PD++ ++LD+V++G+NP L +A  GH++AGPGNHFW C+   GL  E ++  +D +++   IGFTN  +RATKG+ADL++KE+K+G ++LL KLQRF PK+ VFNGK  +E F   K F  G+QP+R++GT++ ++VMPSSSARCAQLPRAADK+PF++ALK  RD
Sbjct:  775 IKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGKKEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRD 945          
BLAST of UDG domain-containing protein vs. Ensembl Zebrafish
Match: tdg.1 (thymine DNA glycosylase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-050522-44])

HSP 1 Score: 172.94 bits (437), Expect = 1.829e-46
Identity = 83/177 (46.89%), Postives = 118/177 (66.67%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLD-YSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRH------KHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            LPD +  +LD V+IG+NP L +A IG +F GPGNHFW C+   G   + +   DD  + + Y IGFTN  +RAT G+ DLS KEL++G K+L+ K+++F P I VFNGK  YE F R       K    G QP+++  +++ +++MPSSSARCAQ PRA DK+ F+  L++LRD++K
Sbjct:  152 LPDILIPNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTEKLLNHMDDQSLPEKYGIGFTNMVARATPGSKDLSSKELREGGKILVEKIKQFKPLIAVFNGKCIYEMFCRELFGKKPKTLEFGLQPHKIPDSDTALYLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLK 328          
BLAST of UDG domain-containing protein vs. Ensembl Zebrafish
Match: tdg.1 (thymine DNA glycosylase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-050522-44])

HSP 1 Score: 172.94 bits (437), Expect = 1.829e-46
Identity = 83/177 (46.89%), Postives = 118/177 (66.67%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLD-YSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRH------KHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            LPD +  +LD V+IG+NP L +A IG +F GPGNHFW C+   G   + +   DD  + + Y IGFTN  +RAT G+ DLS KEL++G K+L+ K+++F P I VFNGK  YE F R       K    G QP+++  +++ +++MPSSSARCAQ PRA DK+ F+  L++LRD++K
Sbjct:  152 LPDILIPNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTEKLLNHMDDQSLPEKYGIGFTNMVARATPGSKDLSSKELREGGKILVEKIKQFKPLIAVFNGKCIYEMFCRELFGKKPKTLEFGLQPHKIPDSDTALYLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLK 328          
BLAST of UDG domain-containing protein vs. Ensembl Zebrafish
Match: tdg.2 (thymine DNA glycosylase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131121-30])

HSP 1 Score: 167.162 bits (422), Expect = 1.028e-44
Identity = 84/177 (47.46%), Postives = 111/177 (62.71%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLD-YSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            LPD I  +LDM++IG+NP L SA  G ++  PGNHFW C+   GL  E +    D  + + Y IGFTN   R T G+ DLS KE+++G   LL KLQ + P I VFNGK  YE F      V+ K+   G QP ++  T +V ++MPSSS RCAQ PRA DK+ F+  LK+LRD++K
Sbjct:  133 LPDVITHNLDMLIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTNEQLNHMHDQTLPEHYGIGFTNMVERTTPGSKDLSNKEIREGGHQLLEKLQTYRPLIAVFNGKCIYEIFCKEIFGVKAKNLEFGLQPYKVPETETVCYLMPSSSPRCAQFPRAQDKVHFYIKLKELRDQLK 309          
BLAST of UDG domain-containing protein vs. Ensembl Zebrafish
Match: tdg.2 (thymine DNA glycosylase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131121-30])

HSP 1 Score: 167.162 bits (422), Expect = 1.056e-44
Identity = 84/177 (47.46%), Postives = 111/177 (62.71%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLD-YSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            LPD I  +LDM++IG+NP L SA  G ++  PGNHFW C+   GL  E +    D  + + Y IGFTN   R T G+ DLS KE+++G   LL KLQ + P I VFNGK  YE F      V+ K+   G QP ++  T +V ++MPSSS RCAQ PRA DK+ F+  LK+LRD++K
Sbjct:  132 LPDVITHNLDMLIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTNEQLNHMHDQTLPEHYGIGFTNMVERTTPGSKDLSNKEIREGGHQLLEKLQTYRPLIAVFNGKCIYEIFCKEIFGVKAKNLEFGLQPYKVPETETVCYLMPSSSPRCAQFPRAQDKVHFYIKLKELRDQLK 308          
BLAST of UDG domain-containing protein vs. Ensembl Zebrafish
Match: tdg.2 (thymine DNA glycosylase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131121-30])

HSP 1 Score: 81.6481 bits (200), Expect = 4.307e-17
Identity = 38/81 (46.91%), Postives = 49/81 (60.49%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLD-YSIGFTNACSRATKGAADLS 408
            LPD I  +LDM++IG+NP L SA  G ++  PGNHFW C+   GL  E +    D  + + Y IGFTN   R T G+ DLS
Sbjct:  132 LPDVITHNLDMLIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTNEQLNHMHDQTLPEHYGIGFTNMVERTTPGSKDLS 212          
BLAST of UDG domain-containing protein vs. Ensembl Xenopus
Match: tdg (thymine DNA glycosylase [Source:NCBI gene;Acc:448432])

HSP 1 Score: 174.481 bits (441), Expect = 8.103e-47
Identity = 84/177 (47.46%), Postives = 117/177 (66.10%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLD-YSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW C+   GL    +   DD  + + Y IGFTN   R T G+ DLS KE ++G ++LL KLQ++ P++  FNGK  YE F      V+ K F  G QP+R+  T++V +VMPSSSARCAQ PRA DK+  +  LK+LR+++K
Sbjct:  159 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFLSGLSDMQLNHLDDHSLPEKYGIGFTNMVERTTPGSKDLSSKEFREGGRILLEKLQKYKPRVAAFNGKCIYEIFSKEIFGVKIKKFEFGIQPHRVPETDTVCYVMPSSSARCAQFPRAQDKVHHYIKLKELRNQLK 335          
BLAST of UDG domain-containing protein vs. Ensembl Xenopus
Match: tdg (thymine DNA glycosylase [Source:NCBI gene;Acc:448432])

HSP 1 Score: 174.481 bits (441), Expect = 1.216e-46
Identity = 84/177 (47.46%), Postives = 117/177 (66.10%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLD-YSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW C+   GL    +   DD  + + Y IGFTN   R T G+ DLS KE ++G ++LL KLQ++ P++  FNGK  YE F      V+ K F  G QP+R+  T++V +VMPSSSARCAQ PRA DK+  +  LK+LR+++K
Sbjct:  172 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFLSGLSDMQLNHLDDHSLPEKYGIGFTNMVERTTPGSKDLSSKEFREGGRILLEKLQKYKPRVAAFNGKCIYEIFSKEIFGVKIKKFEFGIQPHRVPETDTVCYVMPSSSARCAQFPRAQDKVHHYIKLKELRNQLK 348          
BLAST of UDG domain-containing protein vs. Ensembl Xenopus
Match: tdg (thymine DNA glycosylase [Source:NCBI gene;Acc:448432])

HSP 1 Score: 173.711 bits (439), Expect = 2.580e-46
Identity = 84/177 (47.46%), Postives = 117/177 (66.10%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLD-YSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW C+   GL    +   DD  + + Y IGFTN   R T G+ DLS KE ++G ++LL KLQ++ P++  FNGK  YE F      V+ K F  G QP+R+  T++V +VMPSSSARCAQ PRA DK+  +  LK+LR+++K
Sbjct:  159 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFLSGLSDMQLNHLDDHSLPEKYGIGFTNMVERTTPGSKDLSSKEFREGGRILLEKLQKYKPRVAAFNGKCIYEIFSKEIFGVKIKKFEFGIQPHRVPETDTVCYVMPSSSARCAQFPRAQDKVHHYIKLKELRNQLK 335          
BLAST of UDG domain-containing protein vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 176.407 bits (446), Expect = 4.843e-48
Identity = 102/260 (39.23%), Postives = 146/260 (56.15%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARML-DYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKXXXXXXXXXXRLVPLEEVNGNIFPDHVDLELTRLYDAGKSNYSTDRAEKKRKANALNGGNHSTNRSNTEDNSRNSQNLTSQTG 927
            LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW C+   GL    +   DD  +   Y IGFTN   R T G+ DLS KE ++G ++L+ KLQ++ P+I VFNGK  YE F      V+ K+   G QP+++  T ++ +VMPSSSARCAQ PRA DK+ ++  LKDLRD++K          R   ++EV         DL+L +  DA K     ++ +   +  A  GG +  N  N E     S  LT+ + 
Sbjct:  111 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK-------GIERNADVQEVQYTF-----DLQLAQ-EDAKKMAVKEEKYDPGYE--AAYGGAYGENPCNGEPCGIASNGLTAHSA 355          
BLAST of UDG domain-containing protein vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 176.792 bits (447), Expect = 6.411e-48
Identity = 102/260 (39.23%), Postives = 146/260 (56.15%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARML-DYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKXXXXXXXXXXRLVPLEEVNGNIFPDHVDLELTRLYDAGKSNYSTDRAEKKRKANALNGGNHSTNRSNTEDNSRNSQNLTSQTG 927
            LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW C+   GL    +   DD  +   Y IGFTN   R T G+ DLS KE ++G ++L+ KLQ++ P+I VFNGK  YE F      V+ K+   G QP+++  T ++ +VMPSSSARCAQ PRA DK+ ++  LKDLRD++K          R   ++EV         DL+L +  DA K     ++ +   +  A  GG +  N  N E     S  LT+ + 
Sbjct:  135 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK-------GIERNADVQEVQYTF-----DLQLAQ-EDAKKMAVKEEKYDPGYE--AAYGGAYGENPCNGEPCGIASNGLTAHSA 379          
BLAST of UDG domain-containing protein vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 123.25 bits (308), Expect = 1.910e-31
Identity = 61/141 (43.26%), Postives = 87/141 (61.70%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARML-DYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNS 570
            LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW C+   GL    +   DD  +   Y IGFTN   R T G+ DLS KE ++G ++L+ KLQ++ P+I VFNGK  YE F      V+ K+   G QP+++  T +
Sbjct:   27 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTET 167          
BLAST of UDG domain-containing protein vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 91.2781 bits (225), Expect = 1.584e-20
Identity = 43/86 (50.00%), Postives = 60/86 (69.77%), Query Frame = 1
Query:  439 LLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            L+ KLQ++ P+I VFNGK  YE F      V+ K+   G QP+++  T ++ +VMPSSSARCAQ PRA DK+ ++  LKDLRD++K
Sbjct:    2 LVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK 87          
BLAST of UDG domain-containing protein vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 81.2629 bits (199), Expect = 5.064e-18
Identity = 38/82 (46.34%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARML-DYSIGFTNACSRATKGAADLSK 411
            LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW C+   GL    +   DD  +   Y IGFTN   R T G+ DLS+
Sbjct:   28 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSR 109          
BLAST of UDG domain-containing protein vs. UniProt/SwissProt
Match: sp|P56581|TDG_MOUSE (G/T mismatch-specific thymine DNA glycosylase OS=Mus musculus OX=10090 GN=Tdg PE=1 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 4.484e-47
Identity = 102/260 (39.23%), Postives = 146/260 (56.15%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARML-DYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKXXXXXXXXXXRLVPLEEVNGNIFPDHVDLELTRLYDAGKSNYSTDRAEKKRKANALNGGNHSTNRSNTEDNSRNSQNLTSQTG 927
            LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW C+   GL    +   DD  +   Y IGFTN   R T G+ DLS KE ++G ++L+ KLQ++ P+I VFNGK  YE F      V+ K+   G QP+++  T ++ +VMPSSSARCAQ PRA DK+ ++  LKDLRD++K          R   ++EV         DL+L +  DA K     ++ +   +  A  GG +  N  N E     S  LT+ + 
Sbjct:  135 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK-------GIERNADVQEVQYTF-----DLQLAQ-EDAKKMAVKEEKYDPGYE--AAYGGAYGENPCNGEPCGIASNGLTAHSA 379          
BLAST of UDG domain-containing protein vs. UniProt/SwissProt
Match: sp|Q13569|TDG_HUMAN (G/T mismatch-specific thymine DNA glycosylase OS=Homo sapiens OX=9606 GN=TDG PE=1 SV=2)

HSP 1 Score: 174.866 bits (442), Expect = 1.479e-46
Identity = 84/181 (46.41%), Postives = 118/181 (65.19%), Query Frame = 1
Query:  157 ILHILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARML-DYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            +   LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW C+   GL    +   DD  +   Y IGFTN   R T G+ DLS KE ++G ++L+ KLQ++ P+I VFNGK  YE F      V+ K+   G QP+++  T ++ +VMPSSSARCAQ PRA DK+ ++  LKDLRD++K
Sbjct:  120 LTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK 300          
BLAST of UDG domain-containing protein vs. UniProt/SwissProt
Match: sp|O59825|TDG_SCHPO (G/U mismatch-specific uracil DNA glycosylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=thp1 PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.555e-23
Identity = 60/164 (36.59%), Postives = 93/164 (56.71%), Query Frame = 1
Query:  151 DP-ILHILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVP--EPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVF-NGKGTYETFVRH-------KHFGMGKQPNRLEGTNSVVFVMPSSSARCA 609
            DP +L  +PDYI E+   +++GLNP +TS+  GH FA P N FW  +++  L+      T  +D  +  + +G TN C+R +   ADL K+E++DG ++L  K++R+ P++ +F +GKG +E   +        K F  G QP +    N  VFV  SSS R A
Sbjct:  135 DPALLQGVPDYICENPYAIIVGLNPGITSSLKGHAFASPSNRFWKMLNKSKLLEGNAEFTYLNDKDLPAHGLGITNLCARPSSSGADLRKEEMQDGARILYEKVKRYRPQVGLFISGKGIWEEMYKMLTGKKLPKTFVFGWQPEKFGDAN--VFVGISSSGRAA 296          
BLAST of UDG domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6D9D7|MUG_PECAS (G/U mismatch-specific DNA glycosylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=mug PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.820e-17
Identity = 47/165 (28.48%), Postives = 74/165 (44.85%), Query Frame = 1
Query:  166 ILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKD 660
            ++ D +  +L +V  G+NP L++A  G++FA P N FW  I + G     +T  ++  +LD   G T    R T  A +L + EL  G   ++ K+ R+ P+ +   GK  +      K    G+Q  R+  T   V   PS   R       A       AL+D
Sbjct:    1 MITDILAMNLQVVFCGINPGLSTAHHGYHFANPNNRFWKVIHQAGFTERLLTPAEEQHLLDTGCGITMLVERPTVEATELGRDELLQGGNAIVEKMTRYQPRALAVLGKQAFSQAFGIKKVSWGRQERRIGETQVWVLPNPSGLNRATLESLVASYQELHQALQD 165          
BLAST of UDG domain-containing protein vs. UniProt/SwissProt
Match: sp|C6DKG5|MUG_PECCP (G/U mismatch-specific DNA glycosylase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=mug PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.256e-16
Identity = 47/165 (28.48%), Postives = 74/165 (44.85%), Query Frame = 1
Query:  166 ILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKD 660
            ++ D +  +L +V  G+NP L++A  G++FA P N FW  I  VG     +T  ++  +LD   G T    R T  A +L + EL  G   ++ K++R+ P+ +   GK  +      K    G+Q   +  T   V   PS   R       A       AL+D
Sbjct:    1 MITDILAMNLQVVFCGINPGLSTAHHGYHFANPSNRFWKVIHHVGFTERLLTPAEEQHLLDTGCGITMLVERPTVEATELGRDELLQGGNAIVEKMERYQPRALAVLGKQAFSQAFGIKKVSWGRQSLNIGETQVWVLPNPSGLNRATLESLVASYQELHQALQD 165          
BLAST of UDG domain-containing protein vs. TrEMBL
Match: A0A1S8WRA8 (Uracil-DNA glycosylase family protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_07237 PE=4 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 1.987e-79
Identity = 123/227 (54.19%), Postives = 167/227 (73.57%), Query Frame = 1
Query:  166 ILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKXXXXXXXXXXRLVPLEEVNGNIFPDHVDLELTRLYDAGKSNYSTDRAEKKRKANAL 846
            +LPD++KE LD+V++G+NPSL SA +GH++AGPGNHFW+CIS+ GLVPE VTCYDD RMLDY IGFTN C+R TKGAA+L++KE+K G  ++L K++++ PKI VFNGKG YE +V HK+F MG+QP  L+GT++ +FVMPSSSARCAQLPRA DK+PFF AL+ LRD I+            +P  EV   +F D+ +  +T+         S  +AE++RK + +
Sbjct:   92 VLPDHLKEGLDIVIVGINPSLASASVGHHYAGPGNHFWTCISQAGLVPEMVTCYDDERMLDYGIGFTNVCTRPTKGAAELTRKEMKAGAAIMLEKMRKYRPKIAVFNGKGIYEAYVGHKNFSMGRQPTTLDGTDTTIFVMPSSSARCAQLPRAEDKLPFFVALRKLRDYIRGDLSE-------LPDSEV---VFADYTEFRVTQ-----PDPKSLRKAERRRKPSLM 303          
BLAST of UDG domain-containing protein vs. TrEMBL
Match: A0A3R7CLJ3 (G/T mismatch-specific thymine DNA glycosylase (Fragment) OS=Clonorchis sinensis OX=79923 GN=TDG PE=4 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 2.890e-79
Identity = 118/204 (57.84%), Postives = 157/204 (76.96%), Query Frame = 1
Query:  166 ILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKXXXXXXXXXXRLVPLEEVNGNIFPDHVDLELTR 777
            +LPD++KE LD+V++G+NPSL SA +GH++AGPGNHFW+CIS+ GLVPE VTCYDD RMLDY IGFTN C+R TKGAA+L++KE+K G  ++L K++++ PKI VFNGKG YE +V HK+F MG+QP  L+GT++ +FVMPSSSARCAQLPRA DK+PFF AL+ LRD I+            +P  EV   +F D+ +  +T+
Sbjct:   53 VLPDHLKEGLDIVIVGINPSLASASVGHHYAGPGNHFWTCISQAGLVPEMVTCYDDERMLDYGIGFTNVCTRPTKGAAELTRKEMKAGAAIMLEKMRKYRPKIAVFNGKGIYEAYVGHKNFSMGRQPTTLDGTDTTIFVMPSSSARCAQLPRAEDKLPFFVALRKLRDYIRGDLSE-------LPDSEV---VFADYTEFRVTQ 246          
BLAST of UDG domain-containing protein vs. TrEMBL
Match: A0A074ZXA2 (UDG domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_11500 PE=4 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 2.363e-78
Identity = 118/204 (57.84%), Postives = 157/204 (76.96%), Query Frame = 1
Query:  166 ILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKXXXXXXXXXXRLVPLEEVNGNIFPDHVDLELTR 777
            +LPD++KE LD+V++G+NPSL SA +GH++AGPGNHFW+CIS+ GLVPE VTCYDD RMLDY IGFTN C+R TKGAA+L++KE+K G  ++L K++++ PKI VFNGKG YE +V HK+F MG+QP  L+GT++ +FVMPSSSARCAQLPRA DK+PFF AL+ LRD I+            +P  EV   +F D+ +  +T+
Sbjct:   71 VLPDHLKEGLDIVIVGINPSLASASVGHHYAGPGNHFWTCISQAGLVPEMVTCYDDERMLDYGIGFTNVCTRPTKGAAELTRKEMKAGAAIMLEKMRKYRPKIAVFNGKGIYEAYVGHKNFSMGRQPTTLDGTDTTIFVMPSSSARCAQLPRAEDKLPFFVALRKLRDYIRGDLSE-------LPDSEV---VFADYTEFRVTQ 264          
BLAST of UDG domain-containing protein vs. TrEMBL
Match: A0A183PSR6 (UDG domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS17402 PE=4 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 4.731e-77
Identity = 114/203 (56.16%), Postives = 156/203 (76.85%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKXXXXXXXXXXRLVPLEEVNGNIFPDHVDLELTR 777
            LPD++KE LD+V++G+NPSL SA +GH++AGPGNHFW+C+S+ GLVP  V+CYDD++MLDY IGFTN C+R TKGAA+L++KE+K G  ++L K++++ PKI VFNGKG YE +V HK+F MG+QP  L+GT+ V+FVMPSSSARCAQLPRA DK+PFF AL+ LRD ++            +P  EV   +F D+ +  +T+
Sbjct:   25 LPDHLKEGLDIVIVGINPSLASAHVGHHYAGPGNHFWTCLSQAGLVPMAVSCYDDSKMLDYGIGFTNVCTRPTKGAAELTRKEMKAGAAIMLEKMRKYKPKIAVFNGKGIYEAYVGHKNFCMGRQPTTLDGTDIVIFVMPSSSARCAQLPRAEDKLPFFLALRKLRDYVRGDLAE-------LPDSEV---VFADYTEFRVTQ 217          
BLAST of UDG domain-containing protein vs. TrEMBL
Match: A0A1I8H260 (UDG domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 6.230e-77
Identity = 114/169 (67.46%), Postives = 145/169 (85.80%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKI 675
            LP+Y+ E LDM+VIG+NPS+TSA +GH++AGPGNHFWSC+SE GL+PEP+TC+DD RML + +G TN C+R TKGAA+L++KE+K+G++ LL KL+R+ PKI VFNGKG YE FV +K+F MGKQP RL GT+ VVFVMPSSSARCAQLPRAADK+PF+ AL+ LRD +
Sbjct:  131 LPEYLAEGLDMIVIGINPSITSAFVGHHYAGPGNHFWSCVSESGLIPEPMTCHDDDRMLQFGVGLTNVCTRPTKGAAELTRKEMKEGVESLLVKLKRYKPKIAVFNGKGIYEAFVGNKNFYMGKQPERLPGTDIVVFVMPSSSARCAQLPRAADKLPFYLALRKLRDHV 299          
BLAST of UDG domain-containing protein vs. Ensembl Cavefish
Match: tdg.2 (G/T mismatch-specific thymine DNA glycosylase-like [Source:NCBI gene;Acc:103045467])

HSP 1 Score: 174.866 bits (442), Expect = 1.623e-47
Identity = 86/177 (48.59%), Postives = 114/177 (64.41%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLD-YSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            LPD I  DLD+++IG+NP L SA  G ++  PGNHFW C+   GL  E +    D  + D + IGFTN   R T G+ DLS KE+++G K LL KLQ + P+I  FNGKG YE F      V+ K+   G QP ++ GT +V ++MPSSS RCAQ PRA DK+ F+  LK+LRD++K
Sbjct:  135 LPDIITYDLDILIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTEEQLNYMHDQTLPDRHGIGFTNMVERTTPGSKDLSNKEIREGGKQLLEKLQMYRPRIAAFNGKGIYEIFCKEIFGVKAKNLEFGLQPYKVPGTETVCYLMPSSSPRCAQFPRAQDKVHFYIRLKELRDQMK 311          
BLAST of UDG domain-containing protein vs. Ensembl Cavefish
Match: tdg.1 (G/T mismatch-specific thymine DNA glycosylase [Source:NCBI gene;Acc:103043944])

HSP 1 Score: 170.629 bits (431), Expect = 1.194e-45
Identity = 82/177 (46.33%), Postives = 116/177 (65.54%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLD-YSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRH------KHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            LPD +  +LD V+IG+NP L +A IG +F GPGNHFW C+   G   + +    D  + + Y IGFTN  +RAT G+ DLS KEL++G K+L+ K+++F P I VFNGK  YE F R       K    G QP+++  + + +++MPSSSARCAQ PRA DK+ F+  L++LRD++K
Sbjct:  156 LPDILTPNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTDQLLNHMHDQTLPEKYGIGFTNMVARATPGSKDLSSKELREGGKILVEKIKQFKPLIAVFNGKCIYEMFCREIFGKKPKTLEFGLQPHKIPDSETALYLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLK 332          
BLAST of UDG domain-containing protein vs. Ensembl Sea Lamprey
Match: tdg.2 (thymine DNA glycosylase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131121-30])

HSP 1 Score: 179.874 bits (455), Expect = 1.038e-49
Identity = 86/181 (47.51%), Postives = 120/181 (66.30%), Query Frame = 1
Query:  157 ILHILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLD-YSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRH------KHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            +L  LPD +  +LD+V+IG+NP L +A  GH++ GPGNHFW C+   GL  + +   DD  + + Y IGFTN   R T G+ DL  KE+++G K+LL KLQ+F P I VFNGK  +E F +       K+F  G+QPN++  T+ +V+VMPSSSARCAQ PRA DK+ F+  +K+LR+  K
Sbjct:  169 LLKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFLSGLTDQLLNHLDDKSLPEKYGIGFTNMVERTTPGSKDLKSKEIREGGKILLQKLQKFKPTIAVFNGKCIFEIFFKEVFGEKIKNFQFGEQPNKIPETDIIVYVMPSSSARCAQFPRAQDKVHFYIKMKELRNSTK 349          
BLAST of UDG domain-containing protein vs. Ensembl Nematostella
Match: EDO42559 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S194])

HSP 1 Score: 188.348 bits (477), Expect = 1.573e-54
Identity = 89/176 (50.57%), Postives = 121/176 (68.75%), Query Frame = 1
Query:  151 DPILHILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            D +  +LPD + E+LD++ IG+NP LTSA  GH++AGP NHFW C+ + GLVPE +T  DD +   Y IG TN   R T+G++DLS+KE+KDG+  L+ K++R  P +  FNGKG YE F + K   +G+Q   + GTN VV+VMPSSS R    PRA+DK+ FF+ LK LRD+ K
Sbjct:   50 DVMKLLLPDRVAENLDILFIGINPGLTSAYKGHHYAGPNNHFWPCLYDSGLVPEKLTFRDDEKCPAYGIGLTNIVERTTRGSSDLSRKEIKDGVDALIVKVKRLKPLVACFNGKGIYEIFSKSK-CEIGRQTKCIPGTNVVVYVMPSSSGRTMTYPRASDKLKFFTELKSLRDEAK 224          
BLAST of UDG domain-containing protein vs. Ensembl Medaka
Match: tdg.2 (G/T mismatch-specific thymine DNA glycosylase [Source:NCBI gene;Acc:101162834])

HSP 1 Score: 176.407 bits (446), Expect = 3.761e-47
Identity = 85/177 (48.02%), Postives = 115/177 (64.97%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLD-YSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETF------VRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIK 678
            LPD I  +LD+++IG+NP L SA  GH++  PGNHFW C+   GL  E +    D  + + YSIGFTN   R T G+ DLS KE+++G + LL KLQ++ P I  FNGKG YE F      V+ K+   G QP ++  T +V ++MPSSS RCAQ PRA DK+ F+  LK+LRD++K
Sbjct:  276 LPDVITYNLDILIIGINPGLLSAFKGHHYPNPGNHFWKCLFLSGLTEEQLNYMHDQNLPEKYSIGFTNMVERTTPGSKDLSSKEIREGGRQLLEKLQKYKPLIAAFNGKGIYEIFCKEIFGVKAKNLEFGLQPYKIPETETVCYLMPSSSPRCAQFPRAQDKVHFYIKLKELRDQMK 452          
BLAST of UDG domain-containing protein vs. Ensembl Medaka
Match: tdg.1 (thymine DNA glycosylase [Source:NCBI gene;Acc:101155844])

HSP 1 Score: 172.555 bits (436), Expect = 3.122e-46
Identity = 102/275 (37.09%), Postives = 147/275 (53.45%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARM-LDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRH------KHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKXXXXXXXXXXRLVPLEEVNGNIFPDHVDLELTR-----------LYDAGKSN-YSTDRAEKKRKANALNG-GNHSTNRSNTEDNSRNSQNLTSQTGIG 933
            LPD +  +LD V+IG+NP L +A IG +F GPGNHFW C+   G   + +    D  + + Y +GFTN  +RAT G+ DLS KEL++G K+L+ KL+++ P I VFNGK  YE F R       +    G QP+++   +  +F+MPSSSARCAQ PRA DK+ F+  L++LRD++K          R   +EEV+ +      DL+L +            YD G  + Y     EK  +     G  N   + S+ E+     +  TS T  G
Sbjct:  167 LPDLLDHNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTEDQLNHMHDTTLPVKYKMGFTNMVARATPGSKDLSSKELREGGKILVEKLKKYKPLIAVFNGKCIYEMFCRELFGKKPQKLEFGLQPHKIPDCDVALFLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLK-------GVRRNTEIEEVDYSF-----DLQLAKEDAKRLAIKEEQYDPGYEDAYGGAYVEKTAEEGQAEGQSNGHCSFSSAENKEGAQEAATSHTAEG 429          
BLAST of UDG domain-containing protein vs. Ensembl Medaka
Match: tdg.1 (thymine DNA glycosylase [Source:NCBI gene;Acc:101155844])

HSP 1 Score: 173.326 bits (438), Expect = 1.673e-45
Identity = 102/275 (37.09%), Postives = 147/275 (53.45%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARM-LDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRH------KHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKXXXXXXXXXXRLVPLEEVNGNIFPDHVDLELTR-----------LYDAGKSN-YSTDRAEKKRKANALNG-GNHSTNRSNTEDNSRNSQNLTSQTGIG 933
            LPD +  +LD V+IG+NP L +A IG +F GPGNHFW C+   G   + +    D  + + Y +GFTN  +RAT G+ DLS KEL++G K+L+ KL+++ P I VFNGK  YE F R       +    G QP+++   +  +F+MPSSSARCAQ PRA DK+ F+  L++LRD++K          R   +EEV+ +      DL+L +            YD G  + Y     EK  +     G  N   + S+ E+     +  TS T  G
Sbjct:  167 LPDLLDHNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTEDQLNHMHDTTLPVKYKMGFTNMVARATPGSKDLSSKELREGGKILVEKLKKYKPLIAVFNGKCIYEMFCRELFGKKPQKLEFGLQPHKIPDCDVALFLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLK-------GVRRNTEIEEVDYSF-----DLQLAKEDAKRLAIKEEQYDPGYEDAYGGAYVEKTAEEGQAEGQSNGHCSFSSAENKEGAQEAATSHTAEG 429          
BLAST of UDG domain-containing protein vs. Planmine SMEST
Match: SMESG000064938.1 (SMESG000064938.1)

HSP 1 Score: 1076.23 bits (2782), Expect = 0.000e+0
Identity = 624/625 (99.84%), Postives = 625/625 (100.00%), Query Frame = 1
Query:  151 DPILHILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKXXXXXXXXXXRLVPLEEVNGNIFPDHVDLELTRLYDAGKSNYSTDRAEKKRKANALNGGNHSTNRSNTEDNSRNSQNLTSQTGIGLQTNYFDCRSSDKQKPAHSPRIKEERLPNIPNHNFFMSGQTLAPNNNQWVPGAFYNSSFXXXXXXXXXXXXXXXXXXCRFPIAPIFKPNILPTSLPPSLSNVRNYXXXXXXXXXXXXDERTENSFDTSSFSSENMQLHNSTDSSEKNDCLKRNSKEEFDSQPQQSSTNFVXXXXXXXXXXXXXXCEFDRPIESRSVQPISTCSWQNVDNNNHSTDPISCNAQNAFWEQNNNIIVSSYFSARRQLPQELPMGSIFSNFQGXXXXXXXXXXXXQYQTXXXXXXXXXXXXXXNGATNXXXXXXXXXXXDQVTSSLCSVKVTPDSTSLANRKRYCFDISDADNLPNKLMIPDDNNSTNGHDQVTYTDL 2025
            DPILHILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKSWSGGLSSGGRLVPLEEVNGNIFPDHVDLELTRLYDAGKSNYSTDRAEKKRKANALNGGNHSTNRSNTEDNSRNSQ+LTSQTGIGLQTNYFDCRSSDKQKPAHSPRIKEERLPNIPNHNFFMSGQTLAPNNNQWVPGAFYNSSFSYQPYIIDSSQYSSSQQPCRFPIAPIFKPNILPTSLPPSLSNVRNYSTASNHNSLSSSDERTENSFDTSSFSSENMQLHNSTDSSEKNDCLKRNSKEEFDSQPQQSSTNFVSLLMSDSLSLPDSPCEFDRPIESRSVQPISTCSWQNVDNNNHSTDPISCNAQNAFWEQNNNIIVSSYFSARRQLPQELPMGSIFSNFQGNNANFNDINSDNQYQTSFSISSFYSSPHSINGATNSISSIQSPLSSDQVTSSLCSVKVTPDSTSLANRKRYCFDISDADNLPNKLMIPDDNNSTNGHDQVTYTDL
Sbjct:   10 DPILHILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKSWSGGLSSGGRLVPLEEVNGNIFPDHVDLELTRLYDAGKSNYSTDRAEKKRKANALNGGNHSTNRSNTEDNSRNSQSLTSQTGIGLQTNYFDCRSSDKQKPAHSPRIKEERLPNIPNHNFFMSGQTLAPNNNQWVPGAFYNSSFSYQPYIIDSSQYSSSQQPCRFPIAPIFKPNILPTSLPPSLSNVRNYSTASNHNSLSSSDERTENSFDTSSFSSENMQLHNSTDSSEKNDCLKRNSKEEFDSQPQQSSTNFVSLLMSDSLSLPDSPCEFDRPIESRSVQPISTCSWQNVDNNNHSTDPISCNAQNAFWEQNNNIIVSSYFSARRQLPQELPMGSIFSNFQGNNANFNDINSDNQYQTSFSISSFYSSPHSINGATNSISSIQSPLSSDQVTSSLCSVKVTPDSTSLANRKRYCFDISDADNLPNKLMIPDDNNSTNGHDQVTYTDL 634          
BLAST of UDG domain-containing protein vs. Planmine SMEST
Match: SMESG000067021.1 (SMESG000067021.1)

HSP 1 Score: 268.855 bits (686), Expect = 9.438e-78
Identity = 113/169 (66.86%), Postives = 144/169 (85.21%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKI 675
            LPDY+KE+LD++V+G+NPS+TSA +GH++AG GNHFW+CI+E GLVPE VTCYDD RM+DY IGFTN CSR TKGAA++S+KE+K G  ++L K++++ PKI VFNGKG YE F+ HK+F MGKQP  L+GT+ +VFVMPSSSARCAQLPRA DK+PFF AL+ LRD +
Sbjct:  105 LPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHV 273          
BLAST of UDG domain-containing protein vs. Planmine SMEST
Match: SMESG000067021.1 (SMESG000067021.1)

HSP 1 Score: 268.47 bits (685), Expect = 1.189e-77
Identity = 113/169 (66.86%), Postives = 144/169 (85.21%), Query Frame = 1
Query:  169 LPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNHFWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKI 675
            LPDY+KE+LD++V+G+NPS+TSA +GH++AG GNHFW+CI+E GLVPE VTCYDD RM+DY IGFTN CSR TKGAA++S+KE+K G  ++L K++++ PKI VFNGKG YE F+ HK+F MGKQP  L+GT+ +VFVMPSSSARCAQLPRA DK+PFF AL+ LRD +
Sbjct:  105 LPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHV 273          
BLAST of UDG domain-containing protein vs. Planmine SMEST
Match: SMESG000029306.1 (SMESG000029306.1)

HSP 1 Score: 181.415 bits (459), Expect = 3.630e-51
Identity = 99/237 (41.77%), Postives = 139/237 (58.65%), Query Frame = 1
Query:  301 LVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKXXXXXXXXXXRLVPLEEVNGNIFPDHVDLELTRLYDAGKSNYSTDRAEKKRKANALNGGNHSTNRSNTEDNSRNSQNLTSQTGIGLQTNYFDCRSSDKQKPAHSPRIKEER 1011
            +V  PVTC DD +MLDY IGF + C+R  KG  +LS+KE+K G  L++ K++++ PKIVVFNG G YE F+ +K+F MG QPN++EGT+SV+FVMPSSSARCAQLPRA DKIPFF +LK LRD ++            +P  E    +F ++ +  +T+         S  +AE++RK  A     H+  + N  +NS  + N                  S  +KP  +  IK+ER
Sbjct:    1 MVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGD----------LPQLEEKDVVFENYTEFRVTQ-----PDPRSLLKAERRRKRKAELNAEHAL-QDNVGENSTTTTN----------------EESKSKKPMENEIIKDER 205          
BLAST of UDG domain-containing protein vs. Planmine SMEST
Match: SMESG000029306.1 (SMESG000029306.1)

HSP 1 Score: 181.415 bits (459), Expect = 4.903e-51
Identity = 99/237 (41.77%), Postives = 139/237 (58.65%), Query Frame = 1
Query:  301 LVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELKDGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSVVFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKXXXXXXXXXXRLVPLEEVNGNIFPDHVDLELTRLYDAGKSNYSTDRAEKKRKANALNGGNHSTNRSNTEDNSRNSQNLTSQTGIGLQTNYFDCRSSDKQKPAHSPRIKEER 1011
            +V  PVTC DD +MLDY IGF + C+R  KG  +LS+KE+K G  L++ K++++ PKIVVFNG G YE F+ +K+F MG QPN++EGT+SV+FVMPSSSARCAQLPRA DKIPFF +LK LRD ++            +P  E    +F ++ +  +T+         S  +AE++RK  A     H+  + N  +NS  + N                  S  +KP  +  IK+ER
Sbjct:    1 MVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGD----------LPQLEEKDVVFENYTEFRVTQ-----PDPRSLLKAERRRKRKAELNAEHAL-QDNVGENSTTTTN----------------EESKSKKPMENEIIKDER 205          
The following BLAST results are available for this feature:
BLAST of UDG domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TDG3.079e-4746.41thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
TDG4.002e-4746.41thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
TDG8.091e-4046.79thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
TDG4.093e-2943.97thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
TDG6.892e-1846.34thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of UDG domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDG domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Thd14.598e-5853.80gene:FBgn0026869 transcript:FBtr0333706[more]
Thd14.598e-5853.80gene:FBgn0026869 transcript:FBtr0345197[more]
Thd14.598e-5853.80gene:FBgn0026869 transcript:FBtr0089106[more]
back to top
BLAST of UDG domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdg.11.829e-4646.89thymine DNA glycosylase, tandem duplicate 1 [Sourc... [more]
tdg.11.829e-4646.89thymine DNA glycosylase, tandem duplicate 1 [Sourc... [more]
tdg.21.028e-4447.46thymine DNA glycosylase, tandem duplicate 2 [Sourc... [more]
tdg.21.056e-4447.46thymine DNA glycosylase, tandem duplicate 2 [Sourc... [more]
tdg.24.307e-1746.91thymine DNA glycosylase, tandem duplicate 2 [Sourc... [more]
back to top
BLAST of UDG domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tdg8.103e-4747.46thymine DNA glycosylase [Source:NCBI gene;Acc:4484... [more]
tdg1.216e-4647.46thymine DNA glycosylase [Source:NCBI gene;Acc:4484... [more]
tdg2.580e-4647.46thymine DNA glycosylase [Source:NCBI gene;Acc:4484... [more]
back to top
BLAST of UDG domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tdg4.843e-4839.23thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
Tdg6.411e-4839.23thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
Tdg1.910e-3143.26thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
Tdg1.584e-2050.00thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
Tdg5.064e-1846.34thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of UDG domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P56581|TDG_MOUSE4.484e-4739.23G/T mismatch-specific thymine DNA glycosylase OS=M... [more]
sp|Q13569|TDG_HUMAN1.479e-4646.41G/T mismatch-specific thymine DNA glycosylase OS=H... [more]
sp|O59825|TDG_SCHPO2.555e-2336.59G/U mismatch-specific uracil DNA glycosylase OS=Sc... [more]
sp|Q6D9D7|MUG_PECAS2.820e-1728.48G/U mismatch-specific DNA glycosylase OS=Pectobact... [more]
sp|C6DKG5|MUG_PECCP1.256e-1628.48G/U mismatch-specific DNA glycosylase OS=Pectobact... [more]
back to top
BLAST of UDG domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8WRA81.987e-7954.19Uracil-DNA glycosylase family protein (Fragment) O... [more]
A0A3R7CLJ32.890e-7957.84G/T mismatch-specific thymine DNA glycosylase (Fra... [more]
A0A074ZXA22.363e-7857.84UDG domain-containing protein OS=Opisthorchis vive... [more]
A0A183PSR64.731e-7756.16UDG domain-containing protein OS=Schistosoma matth... [more]
A0A1I8H2606.230e-7767.46UDG domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of UDG domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tdg.21.623e-4748.59G/T mismatch-specific thymine DNA glycosylase-like... [more]
tdg.11.194e-4546.33G/T mismatch-specific thymine DNA glycosylase [Sou... [more]
back to top
BLAST of UDG domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tdg.21.038e-4947.51thymine DNA glycosylase, tandem duplicate 2 [Sourc... [more]
back to top
BLAST of UDG domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDG domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO425591.573e-5450.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UDG domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tdg.23.761e-4748.02G/T mismatch-specific thymine DNA glycosylase [Sou... [more]
tdg.13.122e-4637.09thymine DNA glycosylase [Source:NCBI gene;Acc:1011... [more]
tdg.11.673e-4537.09thymine DNA glycosylase [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of UDG domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064938.10.000e+099.84SMESG000064938.1[more]
SMESG000067021.19.438e-7866.86SMESG000067021.1[more]
SMESG000067021.11.189e-7766.86SMESG000067021.1[more]
SMESG000029306.13.630e-5141.77SMESG000029306.1[more]
SMESG000029306.14.903e-5141.77SMESG000029306.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006813 ID=SMED30006813|Name=UDG domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2408bp
TATAAAATCACCGTGATTTTTAAAAATCTCGATTTATTTATACATACATC
GATTACATCCCAATAAACTAATTTATCCAAAATATTATGATCAAGTATAG
CTGATATACTGAAAATTTAAATAATGAATAACAACAATAGTTCTTCAAAT
GATCCAATTCTCCATATTTTACCAGATTATATTAAGGAAGATTTAGATAT
GGTAGTGATTGGACTGAATCCGAGTTTAACTTCAGCTCAGATTGGCCACT
ATTTTGCTGGTCCAGGAAATCATTTTTGGTCATGCATAAGTGAAGTAGGT
TTAGTTCCAGAGCCGGTTACCTGCTACGATGATGCGAGAATGTTGGATTA
TAGTATTGGATTTACAAATGCATGTTCTCGAGCAACGAAAGGAGCGGCAG
ATTTAAGCAAGAAAGAACTGAAAGATGGAATGAAATTACTTTTAGCAAAA
TTACAAAGATTTTGTCCGAAAATTGTCGTTTTCAATGGGAAAGGAACGTA
TGAAACCTTCGTACGGCATAAACATTTTGGAATGGGCAAACAACCTAATC
GGTTGGAAGGAACTAACTCGGTCGTCTTTGTAATGCCTTCGTCAAGTGCA
CGATGCGCTCAACTTCCAAGAGCGGCCGATAAAATCCCGTTCTTTTCAGC
TTTAAAAGATCTGAGAGATAAAATTAAAAGTTGGAGTGGAGGTTTGAGTT
CAGGAGGTCGTTTGGTGCCTCTTGAAGAAGTAAATGGAAACATATTTCCA
GATCATGTGGATCTGGAGTTAACTCGGCTATATGATGCTGGAAAATCGAA
TTATAGCACAGACAGGGCGGAAAAAAAGCGAAAAGCTAATGCTTTAAACG
GAGGAAATCATTCTACTAACAGATCTAATACAGAAGATAATTCAAGGAAT
TCCCAAAATTTGACATCTCAAACCGGTATAGGTTTACAGACAAATTATTT
TGATTGCCGCTCATCAGATAAACAAAAACCAGCACATTCACCTAGAATCA
AAGAAGAACGTCTTCCTAACATTCCGAATCATAATTTCTTCATGTCAGGC
CAAACTCTAGCCCCTAATAATAATCAGTGGGTACCTGGAGCGTTTTATAA
TTCTTCATTTTCTTATCAGCCATATATAATTGATTCTTCTCAGTATTCGT
CTTCCCAACAACCATGTAGATTTCCTATCGCTCCTATCTTTAAACCAAAT
ATACTTCCAACCAGTCTTCCTCCTTCGTTATCAAACGTAAGAAATTATTC
TACAGCTTCCAATCACAATTCCCTTTCAAGCTCCGATGAGCGAACAGAAA
ACTCTTTTGACACAAGCTCATTTAGCTCAGAAAATATGCAGTTACACAAT
TCAACAGATTCGTCTGAAAAAAACGACTGTTTGAAGCGCAATTCCAAAGA
AGAATTTGATTCTCAGCCTCAACAATCCAGCACAAATTTTGTTTCTCTTT
TAATGTCGGATTCATTATCCTTACCAGATTCTCCCTGTGAATTTGACAGA
CCTATTGAATCTCGCTCCGTTCAACCGATATCAACATGTTCCTGGCAAAA
TGTAGATAATAATAATCACTCAACTGATCCAATCTCATGTAATGCACAAA
ACGCGTTCTGGGAACAGAACAATAACATTATAGTTAGTTCATATTTTTCT
GCTAGAAGACAACTACCTCAAGAACTTCCTATGGGTTCGATATTTTCGAA
TTTTCAAGGCAACAATGCCAATTTTAACGATATCAACAGTGACAACCAAT
ATCAGACTTCATTTTCGATCTCTAGTTTTTATTCATCCCCGCATTCCATT
AATGGAGCCACAAACAGCATCAGTTCAATTCAAAGTCCTCTGTCTTCCGA
TCAAGTGACTTCTTCGTTATGCTCAGTTAAAGTTACTCCTGATTCTACAT
CTTTGGCCAATCGCAAGCGCTATTGTTTCGACATTTCTGATGCTGATAAT
CTTCCAAATAAATTGATGATTCCGGATGATAACAATAGTACTAATGGACA
CGATCAAGTCACTTATACCGATCTCTAGTCTCGCCGTGTTTAGATTTTGT
AACTTTTAGTTGCGCAATTTGTTGTTTCGTAAGCTTTTGGTCCACCGGCA
AAAACAAACGTTTATTTCAGGTTTCGTCTCAAGCATTTATATAATGAATA
AATTATTAGATATTTACTGTATTTTTAGTTGGCTTAAAGAAATGGTAGCG
ATTTTGACGATGTTTTCTATATATTCATTTACTAATATCAACTGGATGTA
CCTAATGCCATTCTTCCATAAACTTTTTATTGCAGAGATTAATGAGATTT
TGTGTTGATTTTTACCATATTGTTTGCATGTATTTAAACGGCAAATTTTT
TAATTTAATTTATGTGAATTTTTCTTGACATGATGTCGCCGACTATTTTC
AAAGATAT
back to top

protein sequence of SMED30006813-orf-1

>SMED30006813-orf-1 ID=SMED30006813-orf-1|Name=SMED30006813-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=635bp
MNNNNSSSNDPILHILPDYIKEDLDMVVIGLNPSLTSAQIGHYFAGPGNH
FWSCISEVGLVPEPVTCYDDARMLDYSIGFTNACSRATKGAADLSKKELK
DGMKLLLAKLQRFCPKIVVFNGKGTYETFVRHKHFGMGKQPNRLEGTNSV
VFVMPSSSARCAQLPRAADKIPFFSALKDLRDKIKSWSGGLSSGGRLVPL
EEVNGNIFPDHVDLELTRLYDAGKSNYSTDRAEKKRKANALNGGNHSTNR
SNTEDNSRNSQNLTSQTGIGLQTNYFDCRSSDKQKPAHSPRIKEERLPNI
PNHNFFMSGQTLAPNNNQWVPGAFYNSSFSYQPYIIDSSQYSSSQQPCRF
PIAPIFKPNILPTSLPPSLSNVRNYSTASNHNSLSSSDERTENSFDTSSF
SSENMQLHNSTDSSEKNDCLKRNSKEEFDSQPQQSSTNFVSLLMSDSLSL
PDSPCEFDRPIESRSVQPISTCSWQNVDNNNHSTDPISCNAQNAFWEQNN
NIIVSSYFSARRQLPQELPMGSIFSNFQGNNANFNDINSDNQYQTSFSIS
SFYSSPHSINGATNSISSIQSPLSSDQVTSSLCSVKVTPDSTSLANRKRY
CFDISDADNLPNKLMIPDDNNSTNGHDQVTYTDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036895Uracil-DNA_glycosylase-like_sf
IPR015637MUG/TDG
IPR005122Uracil-DNA_glycosylase-like
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
Vocabulary: molecular function
TermDefinition
GO:0019104DNA N-glycosylase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005122Uracil-DNA glycosylase-likePFAMPF03167UDGcoord: 17..163
e-value: 1.2E-17
score: 64.4
IPR036895Uracil-DNA glycosylase-like domain superfamilyGENE3DG3DSA:3.40.470.10coord: 1..190
e-value: 3.7E-67
score: 227.9
IPR036895Uracil-DNA glycosylase-like domain superfamilySUPERFAMILYSSF52141Uracil-DNA glycosylase-likecoord: 16..180
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 227..266
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 241..266
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 380..418
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 380..413
NoneNo IPR availablePANTHERPTHR12159:SF9G/T MISMATCH-SPECIFIC THYMINE DNA GLYCOSYLASEcoord: 6..192
IPR015637G/U mismatch-specific DNA glycosylasePANTHERPTHR12159G/T AND G/U MISMATCH-SPECIFIC DNA GLYCOSYLASEcoord: 6..192
IPR015637G/U mismatch-specific DNA glycosylaseCDDcd10028UDG_F2_MUGcoord: 16..179
e-value: 3.76988E-65
score: 209.3