26S proteasome non-ATPase regulatory subunit 8

Overview
Name26S proteasome non-ATPase regulatory subunit 8
Smed IDSMED30006808
Length (bp)894
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 26S proteasome non-ATPase regulatory subunit 8 (SMED30006808) t-SNE clustered cells

Violin plots show distribution of expression levels for 26S proteasome non-ATPase regulatory subunit 8 (SMED30006808) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 26S proteasome non-ATPase regulatory subunit 8 (SMED30006808) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 26S proteasome non-ATPase regulatory subunit 8 (SMED30006808) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006808

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30006808h1SMcG0020005 dd_Smed_v4_3245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30006808h1SMcG0020005 dd_Smed_v4_3245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Human
Match: PSMD8 (proteasome 26S subunit, non-ATPase 8 [Source:HGNC Symbol;Acc:HGNC:9566])

HSP 1 Score: 223.402 bits (568), Expect = 2.430e-71
Identity = 125/264 (47.35%), Postives = 181/264 (68.56%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEE-ELPYRKVAITMLEYAIELEKIV 856
            VLQ     Y+ L   W   + +L   GE L  LK  L  ++FLP+  +  +KQ+L++ARDILE+GA WSI  K+IP+FE Y++QLK YYFD+K +LP S+Y ++LL LNLL LL+Q+++AEFH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFF+  + +  +A++R W+   NN Y F  + +  E+  +P  ++A  ++EYA +LE IV
Sbjct:   24 VLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV 287          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Human
Match: PSMD8 (proteasome 26S subunit, non-ATPase 8 [Source:HGNC Symbol;Acc:HGNC:9566])

HSP 1 Score: 224.172 bits (570), Expect = 7.804e-71
Identity = 125/264 (47.35%), Postives = 181/264 (68.56%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEE-ELPYRKVAITMLEYAIELEKIV 856
            VLQ     Y+ L   W   + +L   GE L  LK  L  ++FLP+  +  +KQ+L++ARDILE+GA WSI  K+IP+FE Y++QLK YYFD+K +LP S+Y ++LL LNLL LL+Q+++AEFH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFF+  + +  +A++R W+   NN Y F  + +  E+  +P  ++A  ++EYA +LE IV
Sbjct:   87 VLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV 350          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Human
Match: PSMD8 (proteasome 26S subunit, non-ATPase 8 [Source:HGNC Symbol;Acc:HGNC:9566])

HSP 1 Score: 224.172 bits (570), Expect = 7.804e-71
Identity = 125/264 (47.35%), Postives = 181/264 (68.56%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEE-ELPYRKVAITMLEYAIELEKIV 856
            VLQ     Y+ L   W   + +L   GE L  LK  L  ++FLP+  +  +KQ+L++ARDILE+GA WSI  K+IP+FE Y++QLK YYFD+K +LP S+Y ++LL LNLL LL+Q+++AEFH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFF+  + +  +A++R W+   NN Y F  + +  E+  +P  ++A  ++EYA +LE IV
Sbjct:   87 VLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV 350          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Human
Match: PSMD8 (proteasome 26S subunit, non-ATPase 8 [Source:HGNC Symbol;Acc:HGNC:9566])

HSP 1 Score: 197.593 bits (501), Expect = 7.688e-62
Identity = 109/219 (49.77%), Postives = 155/219 (70.78%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQE 724
            VLQ     Y+ L   W   + +L   GE L  LK  L  ++FLP+  +  +KQ+L++ARDILE+GA WSI  K+IP+FE Y++QLK YYFD+K +LP S+Y ++LL LNLL LL+Q+++AEFH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFF+  + +  +A++
Sbjct:   24 VLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKK 242          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Human
Match: PSMD8 (proteasome 26S subunit, non-ATPase 8 [Source:HGNC Symbol;Acc:HGNC:9566])

HSP 1 Score: 128.642 bits (322), Expect = 5.750e-36
Identity = 73/138 (52.90%), Postives = 105/138 (76.09%), Query Frame = 2
Query:  314 LSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQE 724
            ++QLK YYFD+K +LP S+Y ++LL LNLL LL+Q+++AEFH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFF+  + +  +A++
Sbjct:    1 MAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKK 138          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Celegans
Match: rpn-12 (26S proteasome non-ATPase regulatory subunit 8 [Source:UniProtKB/Swiss-Prot;Acc:Q23449])

HSP 1 Score: 127.487 bits (319), Expect = 4.296e-35
Identity = 92/260 (35.38%), Postives = 144/260 (55.38%), Query Frame = 2
Query:   92 SYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLL-TPEEKNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYR----KVAITMLEYAIELEKIV 856
            +++ LL+ W     DL+A  + L  L         L +++ L  KQ  L ++D+ E+    +I   +   F++Y++Q+ H Y+    E  NS  K+ +  L+L+ LLA ++L++FH  L+ +   E+ +N YI  P+ +EQ LMEG YNKV L++ N+PSP ++ F+ I+L T R+EIA  IE   + L  K+   ML F + E ++ F QERKW  D    Y F  E   V +E P      +VA   L YA +LE+IV
Sbjct:    4 AHKNLLAVWAKEPKDLVAVEKALNEL------TKVLSASSDLNDKQSALASKDLYEISVLLAILKHDFETFDDYINQM-HTYYTMAPE--NSENKHLMTGLHLMFLLAANRLSDFHMLLEQIPQKEQTSNAYISTPVRIEQSLMEGAYNKVVLTEKNIPSPFYTIFIRIMLDTIRREIATSIEKSFKVLTAKDATVMLLFDNDEQMKKFGQERKWHLDGER-YVFEIE---VAQEKPVNLDTVRVATQTLFYAKQLEQIV 250          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Celegans
Match: rpn-12 (26S proteasome non-ATPase regulatory subunit 8 [Source:UniProtKB/Swiss-Prot;Acc:Q23449])

HSP 1 Score: 127.487 bits (319), Expect = 4.296e-35
Identity = 92/260 (35.38%), Postives = 144/260 (55.38%), Query Frame = 2
Query:   92 SYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLL-TPEEKNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYR----KVAITMLEYAIELEKIV 856
            +++ LL+ W     DL+A  + L  L         L +++ L  KQ  L ++D+ E+    +I   +   F++Y++Q+ H Y+    E  NS  K+ +  L+L+ LLA ++L++FH  L+ +   E+ +N YI  P+ +EQ LMEG YNKV L++ N+PSP ++ F+ I+L T R+EIA  IE   + L  K+   ML F + E ++ F QERKW  D    Y F  E   V +E P      +VA   L YA +LE+IV
Sbjct:    4 AHKNLLAVWAKEPKDLVAVEKALNEL------TKVLSASSDLNDKQSALASKDLYEISVLLAILKHDFETFDDYINQM-HTYYTMAPE--NSENKHLMTGLHLMFLLAANRLSDFHMLLEQIPQKEQTSNAYISTPVRIEQSLMEGAYNKVVLTEKNIPSPFYTIFIRIMLDTIRREIATSIEKSFKVLTAKDATVMLLFDNDEQMKKFGQERKWHLDGER-YVFEIE---VAQEKPVNLDTVRVATQTLFYAKQLEQIV 250          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Fly
Match: Rpn12 (gene:FBgn0028693 transcript:FBtr0075308)

HSP 1 Score: 154.836 bits (390), Expect = 2.667e-45
Identity = 95/257 (36.96%), Postives = 162/257 (63.04%), Query Frame = 2
Query:   95 YQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLA--SKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYRKVAITMLEYAIELEKIV 856
            Y+ L + W     + +  G++L+ LK  L  ++FLP+  + A  SK++L++AR +LEV    S+ +K++ AFE Y++QLK YY+D+   +  S  KY+LL LNLL LL+ +++++FH EL+LL+ +  ++N +I+  +++EQY+MEG YNK+F +K  VP   +S+FMD+LL T R EI  CIE  ++ +  K+  + L     ++++ F  +R+W  +++  Y F       +E LP  ++A  +L YA +LE IV
Sbjct:    8 YKELTAEWSKRPPNTVKCGQLLDQLKVALVKMAFLPTDGNDAQSSKKQLILARSVLEVAVEHSVLSKDLLAFERYMAQLKCYYYDYAKIIGESESKYKLLGLNLLYLLSGNRVSDFHTELELLSVDVIQHNQFIRPILALEQYIMEGRYNKIFQAKSTVPVEVYSYFMDLLLETVRDEIGACIEKSYDKISAKDAAKRLNLRVPDEIKAFGAKRQWKLEASGDYSFTDRSVKPKELLPSEELAEQVLSYARDLEMIV 264          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Fly
Match: Rpn12R (gene:FBgn0036465 transcript:FBtr0075669)

HSP 1 Score: 126.331 bits (316), Expect = 2.212e-34
Identity = 90/258 (34.88%), Postives = 149/258 (57.75%), Query Frame = 2
Query:   95 YQGLLSAWKSPACDLIAAGEILESLKYKLTTISF--LPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLL-TPEEKNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESL-PVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYRKVAITMLEYAIELEKIV 856
            Y  L + W   A +L     +L+  K +L   +F  + +A+S   K +L+ +R++LE+    SI  K+  AFE Y++QL  YY+D+   L +S + Y+ + LNLL +LA ++LA+FH EL+ L T    ++ +I+  +++E Y MEG YNK+  +K ++PS  +S FMDIL++T R+EIA+C+E  +  + P    +R+      ++L   A +R+W  D    Y +        E++P + +A   L YA ELEKIV
Sbjct:    5 YTELKNEWSKHAPNLTHCSRLLDGFKLELVRSNFGTIQTASSSKQKDQLIKSREMLEIAVEHSITIKDYAAFERYMAQLNTYYYDYDKYLESSKHMYKFMGLNLLYMLATNRLADFHIELERLPTALLLHDSFIQPVLALENYYMEGRYNKILQAKKSMPSEIYSNFMDILVNTAREEIASCMEKSYLKMAPKLAAQRLGLRPGSKELFELATKRQWCLDEEGNYDYAGLHTRPMEKVPAKDIATHNLTYAQELEKIV 262          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Zebrafish
Match: psmd8 (proteasome 26S subunit, non-ATPase 8 [Source:ZFIN;Acc:ZDB-GENE-040625-136])

HSP 1 Score: 216.468 bits (550), Expect = 3.737e-69
Identity = 122/267 (45.69%), Postives = 183/267 (68.54%), Query Frame = 2
Query:   62 MTQVLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEE-ELPYRKVAITMLEYAIELEKIV 856
            M  VL++    Y+ L + W     +L   GE+L  LK  L  ++FLP+  +  +KQ+L++ARD+LE+GA WSI  K+IP+FE Y++QLK YYFD+K ELP S+Y+++LL LNLL LL+Q++++EFH EL+ L+ ++ + NVYI+HP+S+EQYLMEG YNKVFL+K N+P+  ++FF+D LL T R EIA CIE  +E +   E  R+LFFS  + +  +A++R W    +  Y F  + +  EE  +P  ++A  ++EYA +LE IV
Sbjct:    1 MASVLKETAGLYETLKAEWNKKNPNLNKCGELLSKLKISLLELNFLPTTGTKLTKQQLILARDVLEIGALWSILKKDIPSFERYMAQLKCYYFDYKDELPESAYRHQLLGLNLLFLLSQNRVSEFHTELERLSAKDIQTNVYIRHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDTLLDTIRDEIAGCIEKAYEQIQFNEATRVLFFSSPKKMTDYAKKRNWTQSPDGYYSFSTQHQKTEEVTIPSTELAKQVIEYARQLEMIV 267          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Xenopus
Match: lrrc14b (leucine rich repeat containing 14B [Source:Xenbase;Acc:XB-GENE-6033244])

HSP 1 Score: 220.705 bits (561), Expect = 2.568e-70
Identity = 125/275 (45.45%), Postives = 188/275 (68.36%), Query Frame = 2
Query:   38 IIVIF*I*MTQVLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEE-ELPYRKVAITMLEYAIELEKIV 856
            IIV   +   + L+ +   Y+ L + W     +L   G++L  LK  L   +FLP+ +   +KQ+L++ARDILE+GA WSI  K+IP+FE Y++QLK YYFD+K ELP S+YK++LL LNLL LL+Q+++A+FH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA+CIE  +  +   E  R+LFF+  + +  +A++R W+   NN + F  + ++ EE  +P  ++A  ++EYA +LE IV
Sbjct:   15 IIVRMALSGAEGLRQLAAMYEQLKAEWAKKNPNLSKCGDVLGKLKLALLEQNFLPTTDVKLTKQQLILARDILEIGAQWSILKKDIPSFERYMAQLKCYYFDYKDELPESAYKHQLLGLNLLFLLSQNRVADFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIADCIEKAYGKILFNEATRILFFNTPKKMTEYAKKRGWVLGPNNNFSFSSQQQNPEEVTIPSTELAKQVIEYARQLEMIV 289          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Xenopus
Match: lrrc14b (leucine rich repeat containing 14B [Source:Xenbase;Acc:XB-GENE-6033244])

HSP 1 Score: 219.935 bits (559), Expect = 8.394e-70
Identity = 122/263 (46.39%), Postives = 183/263 (69.58%), Query Frame = 2
Query:   74 LQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEE-ELPYRKVAITMLEYAIELEKIV 856
            L+ +   Y+ L + W     +L   G++L  LK  L   +FLP+ +   +KQ+L++ARDILE+GA WSI  K+IP+FE Y++QLK YYFD+K ELP S+YK++LL LNLL LL+Q+++A+FH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA+CIE  +  +   E  R+LFF+  + +  +A++R W+   NN + F  + ++ EE  +P  ++A  ++EYA +LE IV
Sbjct:   48 LRQLAAMYEQLKAEWAKKNPNLSKCGDVLGKLKLALLEQNFLPTTDVKLTKQQLILARDILEIGAQWSILKKDIPSFERYMAQLKCYYFDYKDELPESAYKHQLLGLNLLFLLSQNRVADFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIADCIEKAYGKILFNEATRILFFNTPKKMTEYAKKRGWVLGPNNNFSFSSQQQNPEEVTIPSTELAKQVIEYARQLEMIV 310          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Xenopus
Match: lrrc14b (leucine rich repeat containing 14B [Source:Xenbase;Acc:XB-GENE-6033244])

HSP 1 Score: 139.043 bits (349), Expect = 6.793e-40
Identity = 83/176 (47.16%), Postives = 125/176 (71.02%), Query Frame = 2
Query:  335 YFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEE-ELPYRKVAITMLEYAIELEKIV 856
            YF  + ELP S+YK++LL LNLL LL+Q+++A+FH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA+CIE  +  +   E  R+LFF+  + +  +A++R W+   NN + F  + ++ EE  +P  ++A  ++EYA +LE IV
Sbjct:   11 YFLCRDELPESAYKHQLLGLNLLFLLSQNRVADFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIADCIEKAYGKILFNEATRILFFNTPKKMTEYAKKRGWVLGPNNNFSFSSQQQNPEEVTIPSTELAKQVIEYARQLEMIV 186          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Mouse
Match: Psmd8 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 [Source:MGI Symbol;Acc:MGI:1888669])

HSP 1 Score: 223.402 bits (568), Expect = 1.412e-71
Identity = 125/264 (47.35%), Postives = 180/264 (68.18%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEE-LPYRKVAITMLEYAIELEKIV 856
            +LQ     Y+ L   W     +L   GE L  LK  L  ++FLP+  +  +KQ+L++ARDILE+GA WSI  K+IP+FE Y++QLK YYFD+K +LP S+Y ++LL LNLL LL+Q+++AEFH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFFS  + +  +A++R W+   NN Y F  + +  E+  +P  ++A  ++EYA +LE IV
Sbjct:   26 ILQAAAGMYEQLKDEWNRKNPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILCKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDSTIPSTELAKQVIEYARQLEMIV 289          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Mouse
Match: Psmd8 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 [Source:MGI Symbol;Acc:MGI:1888669])

HSP 1 Score: 223.787 bits (569), Expect = 6.434e-71
Identity = 125/264 (47.35%), Postives = 180/264 (68.18%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEE-LPYRKVAITMLEYAIELEKIV 856
            +LQ     Y+ L   W     +L   GE L  LK  L  ++FLP+  +  +KQ+L++ARDILE+GA WSI  K+IP+FE Y++QLK YYFD+K +LP S+Y ++LL LNLL LL+Q+++AEFH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFFS  + +  +A++R W+   NN Y F  + +  E+  +P  ++A  ++EYA +LE IV
Sbjct:   90 ILQAAAGMYEQLKDEWNRKNPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILCKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDSTIPSTELAKQVIEYARQLEMIV 353          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Mouse
Match: Psmd8 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 [Source:MGI Symbol;Acc:MGI:1888669])

HSP 1 Score: 223.787 bits (569), Expect = 6.434e-71
Identity = 125/264 (47.35%), Postives = 180/264 (68.18%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEE-LPYRKVAITMLEYAIELEKIV 856
            +LQ     Y+ L   W     +L   GE L  LK  L  ++FLP+  +  +KQ+L++ARDILE+GA WSI  K+IP+FE Y++QLK YYFD+K +LP S+Y ++LL LNLL LL+Q+++AEFH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFFS  + +  +A++R W+   NN Y F  + +  E+  +P  ++A  ++EYA +LE IV
Sbjct:   90 ILQAAAGMYEQLKDEWNRKNPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILCKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDSTIPSTELAKQVIEYARQLEMIV 353          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Mouse
Match: Psmd8 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 [Source:MGI Symbol;Acc:MGI:1888669])

HSP 1 Score: 197.978 bits (502), Expect = 4.460e-62
Identity = 110/227 (48.46%), Postives = 156/227 (68.72%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSN 748
            +LQ     Y+ L   W     +L   GE L  LK  L  ++FLP+  +  +KQ+L++ARDILE+GA WSI  K+IP+FE Y++QLK YYFD+K +LP S+Y ++LL LNLL LL+Q+++AEFH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFFS  + +  +A++   + D  
Sbjct:   26 ILQAAAGMYEQLKDEWNRKNPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILCKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPKKMTDYAKKVAGVWDKG 252          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. UniProt/SwissProt
Match: sp|Q5RE15|PSMD8_PONAB (26S proteasome non-ATPase regulatory subunit 8 (Fragment) OS=Pongo abelii OX=9601 GN=PSMD8 PE=2 SV=2)

HSP 1 Score: 223.402 bits (568), Expect = 1.268e-70
Identity = 125/264 (47.35%), Postives = 181/264 (68.56%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEE-ELPYRKVAITMLEYAIELEKIV 856
            VLQ     Y+ L   W   + +L   GE L  LK  L  ++FLP+  +  +KQ+L++ARDILE+GA WSI  K+IP+FE Y++QLK YYFD+K +LP S+Y ++LL LNLL LL+Q+++AEFH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFF+  + +  +A++R W+   NN Y F  + +  E+  +P  ++A  ++EYA +LE IV
Sbjct:   26 VLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYAFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV 289          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. UniProt/SwissProt
Match: sp|P48556|PSMD8_HUMAN (26S proteasome non-ATPase regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMD8 PE=1 SV=2)

HSP 1 Score: 224.172 bits (570), Expect = 3.748e-70
Identity = 125/264 (47.35%), Postives = 181/264 (68.56%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEE-ELPYRKVAITMLEYAIELEKIV 856
            VLQ     Y+ L   W   + +L   GE L  LK  L  ++FLP+  +  +KQ+L++ARDILE+GA WSI  K+IP+FE Y++QLK YYFD+K +LP S+Y ++LL LNLL LL+Q+++AEFH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFF+  + +  +A++R W+   NN Y F  + +  E+  +P  ++A  ++EYA +LE IV
Sbjct:   87 VLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV 350          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. UniProt/SwissProt
Match: sp|Q9CX56|PSMD8_MOUSE (26S proteasome non-ATPase regulatory subunit 8 OS=Mus musculus OX=10090 GN=Psmd8 PE=1 SV=2)

HSP 1 Score: 223.787 bits (569), Expect = 4.501e-70
Identity = 125/264 (47.35%), Postives = 180/264 (68.18%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEE-LPYRKVAITMLEYAIELEKIV 856
            +LQ     Y+ L   W     +L   GE L  LK  L  ++FLP+  +  +KQ+L++ARDILE+GA WSI  K+IP+FE Y++QLK YYFD+K +LP S+Y ++LL LNLL LL+Q+++AEFH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFFS  + +  +A++R W+   NN Y F  + +  E+  +P  ++A  ++EYA +LE IV
Sbjct:   90 ILQAAAGMYEQLKDEWNRKNPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILCKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDSTIPSTELAKQVIEYARQLEMIV 353          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. UniProt/SwissProt
Match: sp|Q3SYT7|PSMD8_BOVIN (26S proteasome non-ATPase regulatory subunit 8 OS=Bos taurus OX=9913 GN=PSMD8 PE=2 SV=3)

HSP 1 Score: 219.935 bits (559), Expect = 2.298e-69
Identity = 123/264 (46.59%), Postives = 180/264 (68.18%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEE-ELPYRKVAITMLEYAIELEKIV 856
            +LQ     Y+ L   W   + +L   GE L  LK  L  ++FLP+  +  +KQ+L++ARDI E+GA WSI  K+IP+FE Y++QLK YYFD+K +LP S+Y ++LL LNLL LL+Q+++AEFH EL+ L  ++ + NVYIKHP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFF+  + +  +A++R W+   NN Y F  + +  E+  +P  ++A  ++EYA +LE IV
Sbjct:   24 ILQAAAGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDIQEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGINNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV 287          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. UniProt/SwissProt
Match: sp|P02889|PSMD8_DICDI (Probable 26S proteasome non-ATPase regulatory subunit 8 OS=Dictyostelium discoideum OX=44689 GN=psmD8-1 PE=2 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 2.062e-35
Identity = 79/211 (37.44%), Postives = 138/211 (65.40%), Query Frame = 2
Query:  224 KQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEEKNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYRKVAITMLEYAIELEKIV 856
            K++L++AR+ILE+ + +SI+ K+I +FE   +QLK YY+D+K  +  S+ +Y+++ LNL+RLLA+ K +EFH E++L+     +N +IK P+ +E+ + EG YNK+  S+  VPS  +  F+DIL  + +++IANC E   ++L +K+ E++L F+D    + + +ER W    + I + + + + V  E+P  ++    L YA ELE+IV
Sbjct:   55 KKDLVLAREILELISLYSIKIKDIDSFERTFNQLKTYYYDYKSIIAPSTLEYQIIGLNLMRLLAKHKTSEFHSEIELIEFNNLDNSFIKFPLLVEKSITEGSYNKIIQSRSGVPSEYYQVFLDILADSIKEDIANCSEKSFKTLSLKDAEKVLLFNDNNQFQQYIKERNWKVQGDVIQFGNNDNQTV--EIPSLQLIHQTLHYAKELERIV 263          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. TrEMBL
Match: A0A1S3HD68 (26S proteasome non-ATPase regulatory subunit 8 OS=Lingula unguis OX=7574 GN=LOC106154232 PE=4 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 1.232e-81
Identity = 134/263 (50.95%), Postives = 187/263 (71.10%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYRKVAITMLEYAIELEKIV 856
             L+++V +YQ L   W     DL   G +L  LK  LT + FLP+ ++ A+KQELL+ARDILE+GA W+I  ++IP FE Y++QLK YY D+K +LP+S+YKY+LL LNLL LL+Q++LAEFH EL+LL  ++ + N+YIKHPISMEQYLMEG YNK+FL+K NVP+  +++FMDILL+T R EIA+C+E  ++ +   E  RMLFF  +  ++ +A ER W+  S N +YF KE K  +E++P   +    +EYA ELE IV
Sbjct:    3 ALKEVVSTYQQLTQEWNKKPSDLDKCGTLLGKLKVALTGLMFLPTQDTAATKQELLVARDILEIGAQWAIAKRDIPTFERYMAQLKCYYLDYKNDLPDSAYKYQLLGLNLLCLLSQNRLAEFHTELELLPVKDLQTNIYIKHPISMEQYLMEGSYNKIFLAKGNVPAESYNYFMDILLNTIRGEIASCMEKAYDKIAFSEAARMLFFDSQRPMKQYASERGWVVGSENYFYFQKEEKKGDEDIPALNLVQQTIEYARELEMIV 265          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. TrEMBL
Match: A0A267H797 (PCI domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026115g1 PE=4 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 3.657e-81
Identity = 137/266 (51.50%), Postives = 189/266 (71.05%), Query Frame = 2
Query:   62 MTQVLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEEKNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKW-ICDSNNIYYFHKEFKDVEEELPYRKVAITMLEYAIELEKIV 856
            M+  +  + KSY+ L   W+  +CDL   GEIL++LK  L + SFLP + S AS+QELLIAR+ LE+GA  +I ++N+  FE YLSQLK YYFD+K +LP S Y++ELL LNLL LL + +LA+FH EL+ L+ ++ ++VYI+HP+SMEQYLMEG YNKVFLSK NVPS R++ FM+ILL+TTR EIA C+EA +E +  +E +RMLFF   E +  + Q R W + +    + F ++  D ++  P  +VA TML+YA ELEKIV
Sbjct:    4 MSGSIATVAKSYELLRKEWERNSCDLNRCGEILKTLKISLLSNSFLPESQSGASQQELLIARNTLEIGALHAISSENVATFERYLSQLKCYYFDYKGQLPQSPYEHELLGLNLLYLLCESRLADFHSELERLSEQQMDSVYIRHPVSMEQYLMEGSYNKVFLSKSNVPSERYNLFMNILLNTTRDEIAKCMEASYERIEQREAQRMLFFESLEAMERYRQGRGWQLAEQTREFVFQQDQSDAQKRFPSERVANTMLQYAAELEKIV 269          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. TrEMBL
Match: T1JGC0 (PCI domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 1.930e-80
Identity = 137/262 (52.29%), Postives = 190/262 (72.52%), Query Frame = 2
Query:   74 LQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYRKVAITMLEYAIELEKIV 856
            L+++V SYQ L   W      L   GE+L+ LK  LT ++FLP++NS+A+KQELL+ARDILE+GA WSI  K+IP+FE Y++QLK YY D+K +LP S+YKY+LL LNLL LL+Q+++AEFH EL+LL P+E + ++YI+HP+SMEQYLMEG YNK+FL K +VP+  ++FF+DILL T R EIA CIE  +E L V E  RMLFF + + ++ +A +R W    NN  Y+H E K  ++ +P  ++A   +EYA ELE I+
Sbjct:    4 LKEVVVSYQQLSQEWNKKPPQLDRCGELLDKLKVGLTKLTFLPTSNSVATKQELLVARDILEIGAQWSIAIKDIPSFERYMAQLKCYYLDYKDDLPESAYKYQLLGLNLLCLLSQNRVAEFHTELELLPPKEIQTSIYIRHPVSMEQYLMEGSYNKIFLGKGSVPAASYNFFIDILLDTIRDEIAGCIEKAYEKLAVIEAARMLFFQNPKAVKDYAVKRGWNMGKNNYIYYHLETKKCDDTIPSFELATQAIEYARELEMII 265          

HSP 2 Score: 77.0258 bits (188), Expect = 2.909e-12
Identity = 36/86 (41.86%), Postives = 53/86 (61.63%), Query Frame = 2
Query:  539 VFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEEL 796
            +FL K +VP+  ++FF+DILL T R EIA CIE  +E L V E  RMLFF + + ++ +A +R W    N   Y+H E K  ++ +
Sbjct:  265 IFLGKGSVPAASYNFFIDILLDTIRDEIAGCIEKAYEKLAVIEAARMLFFQNPKAVKDYAVKRGWNMGKNKYIYYHLETKKSDDTI 350          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. TrEMBL
Match: A0A0B7AZ06 (PCI domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF151241 PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 1.722e-79
Identity = 139/266 (52.26%), Postives = 188/266 (70.68%), Query Frame = 2
Query:   62 MTQVLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYRKVAITMLEYAIELEKIV 856
            M   L++IV  YQ L   W S   +L  +GE+L  LK  LT ++FLP   S  SKQELLIARDILE+GA W+I  K+IPAFE Y++QLK YY D+K  LP S++KY+LL LNLL LL+Q++LAEFH EL+ L  +E ++N+YIKHP+SMEQYLMEG YNKVFL++ NVP+  ++FF+DILL+T R EIA CIE  +  +   E  RMLFF  ++ ++ +A +RKW    +N+Y+F +E KD +  +P + +A   +EYA ELE IV
Sbjct:    4 MAANLKEIVGIYQNLKRVWDSKPPNLEKSGELLSKLKLALTNVAFLPITESSVSKQELLIARDILEIGAQWAIAKKDIPAFERYMAQLKCYYMDYKDNLPESTFKYQLLGLNLLCLLSQNRLAEFHTELERLPVKEIQSNIYIKHPVSMEQYLMEGSYNKVFLARGNVPADNYNFFIDILLNTIRDEIAGCIEKAYHHINPSEAARMLFFESQKPMKDYATQRKWNLQKDNLYHFIQEAKDADHTIPAKLLAEQTIEYARELEMIV 269          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. TrEMBL
Match: D2A2W4 (26S proteasome non-ATPase regulatory subunit 8-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC007891 PE=4 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 9.016e-79
Identity = 132/262 (50.38%), Postives = 189/262 (72.14%), Query Frame = 2
Query:   74 LQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYRKVAITMLEYAIELEKIV 856
            + D+   Y+ L S W +P  +L    ++L  LK +LT + FLP++N+ ASKQELL+ARD+LE+G  WSI + NIPAFE Y++QLK YYFD+K +LP SS+KY+LL LNLL LL+Q+++AEFH EL+LL  E  +N+VYI+HP+S+EQYLMEG YNK+FL+K NVP+  ++FFMDILL T R EIA C+E  +E + +K+  RML+ +++E  + F + +KW    +N ++F  E K + E +P  ++A   +EYA ELE IV
Sbjct:    4 INDVTTLYKQLKSEWNNPKPNLAKVEQLLSELKLELTHLMFLPTSNASASKQELLLARDVLEIGVQWSIASSNIPAFERYMAQLKCYYFDYKDQLPESSFKYQLLGLNLLFLLSQNRVAEFHTELELLPAEHIQNDVYIRHPLSIEQYLMEGSYNKIFLAKGNVPAKNYNFFMDILLDTIRGEIAVCVEKAYEKISLKDAARMLYLANEEAAKTFGKNKKWKLGRDNFFHFAPEVKKITEPIPSCELAEQAIEYAKELEMIV 265          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Cavefish
Match: psmd8 (proteasome 26S subunit, non-ATPase 8 [Source:NCBI gene;Acc:103037772])

HSP 1 Score: 226.483 bits (576), Expect = 3.768e-73
Identity = 124/267 (46.44%), Postives = 184/267 (68.91%), Query Frame = 2
Query:   62 MTQVLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEE-ELPYRKVAITMLEYAIELEKIV 856
            M  VL++    Y+ L + W   + +L   GEIL  LK  L  ++FLP+  +  +KQ+L++ARD+LE+GA WSI  K+IP+FE Y++QLK YYFD+K ELP S+Y ++LL LNLL LL+Q++++EFH EL+ L+ ++ + NVYI+HP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFFS  + +  +A++R W    +  Y F  + +  EE  +P  ++A  ++EYA +LE IV
Sbjct:    1 MAAVLRETAGLYETLKTEWNKKSPNLNKCGEILTKLKISLLELNFLPTTGTKLTKQQLILARDVLEIGALWSILKKDIPSFERYMAQLKCYYFDYKDELPESAYMHQLLGLNLLFLLSQNRVSEFHTELERLSAKDIQTNVYIRHPVSLEQYLMEGSYNKVFLAKGNIPAESYNFFIDILLDTIRDEIAGCIEKAYEQIQFNEATRVLFFSSPKKMTEYAKKRGWTQSPDGYYSFSSQQQRTEEVTIPSTELAQQVIEYARQLEMIV 267          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Sea Lamprey
Match: psmd8 (proteasome 26S subunit, non-ATPase 8 [Source:ZFIN;Acc:ZDB-GENE-040625-136])

HSP 1 Score: 204.912 bits (520), Expect = 1.967e-65
Identity = 116/231 (50.22%), Postives = 163/231 (70.56%), Query Frame = 2
Query:   74 LQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYF 763
            LQ+ + +   L   W   A  L A GE+L  LK  L  ++FLP   +  SKQ+L++ARDILE+GA WS++ K+IP+FE Y++QLK YYFD+K ELP S+YK++LL LNLL LL+Q+++AEFH EL+ L   E + NVYIKHP+S+EQYLMEG YNKVFL+K NVP+  ++FF+DILL T R EIA CIE  +E +  KE  R+LFF+ ++ +  ++ +R W   +++   F
Sbjct:   23 LQEALSARDLLALEWGKKAPSLDACGELLAKLKLALLDLNFLPVGGTKPSKQQLILARDILEIGAQWSVQKKDIPSFERYIAQLKCYYFDYKSELPESAYKWQLLGLNLLCLLSQNRVAEFHTELERLPARELQGNVYIKHPVSLEQYLMEGSYNKVFLAKGNVPAESYTFFIDILLDTIRDEIAGCIEKAYERISFKEAARVLFFNAQKQMTEYSTKRGWKLGADSYVLF 253          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Yeast
Match: RPN12 (Subunit of the 19S regulatory particle of the 26S proteasome lid; synthetically lethal with RPT1, which is an ATPase component of the 19S regulatory particle; physically interacts with Nob1p and Rpn3p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001948])

HSP 1 Score: 106.686 bits (265), Expect = 1.092e-27
Identity = 81/222 (36.49%), Postives = 127/222 (57.21%), Query Frame = 2
Query:  227 QELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEEKN---NVYIKHPISMEQYLMEGWYNKVF--LSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFH--KEFKDVEEELPYRKVAIT-----MLEYAIELEKIV 856
             +L+I + ILEVGA  SI+T N  +FENY +QLK YYF   ++L  S  K +L++L LL LL+Q+   +FH EL  L    KN   +  + +PI ++++LMEG Y K +  L   +     F  F DIL    R EIA   E  ++ LP+  ++ +LFF+++++   FA ER W   ++ +Y+ +  KE  D E+E+ + +   T      ++YAI +E IV
Sbjct:   53 NDLMITKRILEVGALASIQTFNFDSFENYFNQLKPYYFSNNHKLSESDKKSKLISLYLLNLLSQNNTTKFHSELQYLDKHIKNLEDDSLLSYPIKLDRWLMEGSYQKAWDLLQSGSQNISEFDSFTDILKSAIRDEIAKNTELSYDFLPLSNIKALLFFNNEKETEKFALERNWPIVNSKVYFNNQSKEKADYEDEMMHEEDQKTNIIEKAMDYAISIENIV 274          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Nematostella
Match: EDO36429 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIL7])

HSP 1 Score: 224.172 bits (570), Expect = 1.259e-72
Identity = 124/263 (47.15%), Postives = 179/263 (68.06%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYRKVAITMLEYAIELEKIV 856
             L+++V  YQ L+  W     DL   G++L  +K  L   SFLP++N+  S+QELL+ARD+LE+G  WSI  ++IP+FE Y++ LK YY D++  L +S+Y Y+LL LNLL LLAQ++LAEFH EL+LL  +E ++NVYIKH +S+EQYLMEG YNKVFL++ NVP+  + FFM+ILL T R EIA C+E  ++ + + E  RML+F  ++ +++FA +R W  + N   +     KD  + +   K+   MLEYA ELE+IV
Sbjct:    5 CLKEVVSMYQTLIKEWNKKPADLEKCGKLLSGMKMSLIKFSFLPTSNNKPSQQELLLARDVLEIGVQWSILKEDIPSFERYMAMLKPYYLDYRGILEDSAYTYQLLGLNLLSLLAQNRLAEFHTELELLPAKELQHNVYIKHSVSLEQYLMEGSYNKVFLARGNVPAENYHFFMNILLGTLRDEIATCMEKSYQKVSIPETTRMLYFEGEKSMKVFADKRGWKTEGNFYVFEDLSKKDATQGITSYKITQHMLEYAKELERIV 267          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Medaka
Match: psmd8 (proteasome 26S subunit, non-ATPase 8 [Source:NCBI gene;Acc:101168061])

HSP 1 Score: 220.705 bits (561), Expect = 6.646e-71
Identity = 122/264 (46.21%), Postives = 181/264 (68.56%), Query Frame = 2
Query:   71 VLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEE-KNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEE-ELPYRKVAITMLEYAIELEKIV 856
             L++    Y+ L S W     +L   GE+L  LK  L  ++FLP++    +KQ+L++ARD+LE+GA WSI  K+IP+FE Y++QLK YYFD+K ELP+++Y ++LL LNLL LL+Q++L+EFH EL+ L+  + + NVYI+HP+S+EQYLMEG YNKVFL+K N+P+  ++FF+DILL T R EIA CIE  +E +   E  R+LFF+  + +  FA++R W    +  Y F  + +  EE  +P  ++A  ++EYA +LE IV
Sbjct:    2 ALKETAALYEMLKSEWNKKNPNLNKCGELLSKLKITLLELNFLPTSGPALTKQQLILARDVLEIGALWSILKKDIPSFERYMAQLKCYYFDYKEELPDAAYMHQLLGLNLLFLLSQNRLSEFHTELERLSGRDIQTNVYIRHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEQIQFTEATRVLFFNSPKKMTEFAKKRGWTQTPDGCYSFTTQQQRTEEVTIPSTELAQQVIEYARQLEMIV 265          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Planmine SMEST
Match: SMESG000035221.1 (SMESG000035221.1)

HSP 1 Score: 506.138 bits (1302), Expect = 0.000e+0
Identity = 265/265 (100.00%), Postives = 265/265 (100.00%), Query Frame = 2
Query:   62 MTQVLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYEXXXXXXXXXXXXXXXXEFHRELDLLTPEEKNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYRKVAITMLEYAIELEKIV 856
            MTQVLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYELLALNLLRLLAQDKLAEFHRELDLLTPEEKNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYRKVAITMLEYAIELEKIV
Sbjct:    1 MTQVLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSANSLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELPNSSYKYELLALNLLRLLAQDKLAEFHRELDLLTPEEKNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYRKVAITMLEYAIELEKIV 265          
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Planmine SMEST
Match: SMESG000039427.1 (SMESG000039427.1)

HSP 1 Score: 199.904 bits (507), Expect = 2.290e-64
Identity = 100/142 (70.42%), Postives = 116/142 (81.69%), Query Frame = 2
Query:  431 EFHRELDLLTPEEKNNVYIKHPISMEQYLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPVKEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYRKVAITMLEYAIELEKIV 856
            EFH EL+LLTPEEK ++YI HPISMEQYLM GWYNKVF S+ ++PSPRFSFFMD LLHTTRKEIA+CIE+G+ESL  K++ERMLFFS KEDL  FA ERKWI D N+IY F KE K+ E  L  + +AITMLEYA +L KIV
Sbjct:   19 EFHMELELLTPEEKRSIYINHPISMEQYLMGGWYNKVFQSRTDIPSPRFSFFMDTLLHTTRKEIASCIESGYESLARKDLERMLFFSRKEDLLSFALERKWIFDHNDIYTFPKEVKEKERVLC-KMIAITMLEYAGDLGKIV 159          
The following BLAST results are available for this feature:
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSMD82.430e-7147.35proteasome 26S subunit, non-ATPase 8 [Source:HGNC ... [more]
PSMD87.804e-7147.35proteasome 26S subunit, non-ATPase 8 [Source:HGNC ... [more]
PSMD87.804e-7147.35proteasome 26S subunit, non-ATPase 8 [Source:HGNC ... [more]
PSMD87.688e-6249.77proteasome 26S subunit, non-ATPase 8 [Source:HGNC ... [more]
PSMD85.750e-3652.90proteasome 26S subunit, non-ATPase 8 [Source:HGNC ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpn-124.296e-3535.3826S proteasome non-ATPase regulatory subunit 8 [S... [more]
rpn-124.296e-3535.3826S proteasome non-ATPase regulatory subunit 8 [S... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rpn122.667e-4536.96gene:FBgn0028693 transcript:FBtr0075308[more]
Rpn12R2.212e-3434.88gene:FBgn0036465 transcript:FBtr0075669[more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
psmd83.737e-6945.69proteasome 26S subunit, non-ATPase 8 [Source:ZFIN;... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lrrc14b2.568e-7045.45leucine rich repeat containing 14B [Source:Xenbase... [more]
lrrc14b8.394e-7046.39leucine rich repeat containing 14B [Source:Xenbase... [more]
lrrc14b6.793e-4047.16leucine rich repeat containing 14B [Source:Xenbase... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Psmd81.412e-7147.35proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd86.434e-7147.35proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd86.434e-7147.35proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd84.460e-6248.46proteasome (prosome, macropain) 26S subunit, non-A... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RE15|PSMD8_PONAB1.268e-7047.3526S proteasome non-ATPase regulatory subunit 8 (Fr... [more]
sp|P48556|PSMD8_HUMAN3.748e-7047.3526S proteasome non-ATPase regulatory subunit 8 OS=... [more]
sp|Q9CX56|PSMD8_MOUSE4.501e-7047.3526S proteasome non-ATPase regulatory subunit 8 OS=... [more]
sp|Q3SYT7|PSMD8_BOVIN2.298e-6946.5926S proteasome non-ATPase regulatory subunit 8 OS=... [more]
sp|P02889|PSMD8_DICDI2.062e-3537.44Probable 26S proteasome non-ATPase regulatory subu... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HD681.232e-8150.9526S proteasome non-ATPase regulatory subunit 8 OS=... [more]
A0A267H7973.657e-8151.50PCI domain-containing protein OS=Macrostomum ligna... [more]
T1JGC01.930e-8052.29PCI domain-containing protein OS=Strigamia maritim... [more]
A0A0B7AZ061.722e-7952.26PCI domain-containing protein (Fragment) OS=Arion ... [more]
D2A2W49.016e-7950.3826S proteasome non-ATPase regulatory subunit 8-lik... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
psmd83.768e-7346.44proteasome 26S subunit, non-ATPase 8 [Source:NCBI ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
psmd81.967e-6550.22proteasome 26S subunit, non-ATPase 8 [Source:ZFIN;... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RPN121.092e-2736.49Subunit of the 19S regulatory particle of the 26S ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO364291.259e-7247.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
psmd86.646e-7146.21proteasome 26S subunit, non-ATPase 8 [Source:NCBI ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000035221.10.000e+0100.00SMESG000035221.1[more]
SMESG000039427.12.290e-6470.42SMESG000039427.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006808 ID=SMED30006808|Name=26S proteasome non-ATPase regulatory subunit 8|organism=Schmidtea mediterranea sexual|type=transcript|length=894bp
TTAAAACTTAAAATAATTAATATTTAAATACTTCTTAATAATAGTTATAT
TTTAAATATAAATGACGCAAGTTTTACAAGATATTGTTAAAAGTTATCAA
GGCTTATTAAGTGCTTGGAAAAGTCCGGCTTGTGATTTAATTGCTGCTGG
AGAAATTTTGGAGTCTCTTAAATATAAATTGACTACTATTAGCTTTCTAC
CGTCAGCAAATAGTTTAGCTTCTAAACAAGAATTACTTATTGCAAGAGAC
ATTTTAGAAGTCGGAGCCAATTGGTCCATTGAAACTAAAAATATTCCCGC
TTTCGAAAATTATCTCTCACAATTAAAACATTATTACTTTGATTTTAAAT
ACGAGCTTCCTAATAGCAGTTACAAATATGAATTATTGGCCCTGAATTTG
CTTCGACTATTGGCTCAAGATAAATTAGCTGAATTTCACAGGGAATTGGA
TTTATTAACTCCAGAGGAAAAAAACAATGTTTACATAAAACATCCAATTT
CAATGGAACAATATTTAATGGAAGGATGGTACAACAAGGTTTTCCTATCT
AAAATCAATGTTCCATCTCCAAGATTTTCTTTTTTCATGGATATTCTATT
GCATACAACTAGAAAAGAAATTGCTAATTGTATTGAAGCCGGTCATGAAT
CTTTACCAGTCAAAGAAGTAGAAAGAATGTTATTCTTTTCAGACAAAGAG
GATTTACGTTTGTTTGCCCAAGAACGAAAATGGATCTGTGACTCTAATAA
TATTTATTATTTCCATAAAGAATTTAAAGACGTAGAAGAAGAATTGCCAT
ATAGGAAAGTTGCCATCACCATGCTGGAATACGCAATTGAATTGGAGAAA
ATTGTTTAATAAAAATTTTGTTAATTGTTCAAAAAAAAGGATCG
back to top

protein sequence of SMED30006808-orf-1

>SMED30006808-orf-1 ID=SMED30006808-orf-1|Name=SMED30006808-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=266bp
MTQVLQDIVKSYQGLLSAWKSPACDLIAAGEILESLKYKLTTISFLPSAN
SLASKQELLIARDILEVGANWSIETKNIPAFENYLSQLKHYYFDFKYELP
NSSYKYELLALNLLRLLAQDKLAEFHRELDLLTPEEKNNVYIKHPISMEQ
YLMEGWYNKVFLSKINVPSPRFSFFMDILLHTTRKEIANCIEAGHESLPV
KEVERMLFFSDKEDLRLFAQERKWICDSNNIYYFHKEFKDVEEELPYRKV
AITMLEYAIELEKIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR00674626S_Psome_Rpn12
IPR000717PCI_dom
IPR033464CSN8_PSD8_EIF3K
Vocabulary: cellular component
TermDefinition
GO:0000502proteasome complex
GO:0005838proteasome regulatory particle
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.25.40.990coord: 5..237
e-value: 9.1E-73
score: 246.2
IPR033464CSN8/PSMD8/EIF3KPFAMPF10075CSN8_PSD8_EIF3Kcoord: 105..237
e-value: 5.8E-24
score: 84.7
IPR00674626S proteasome non-ATPase regulatory subunit Rpn12PANTHERPTHR1238726S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 8coord: 1..265
IPR000717Proteasome component (PCI) domainPROSITEPS50250PCIcoord: 79..247
score: 14.387