tyrosinase

Overview
Nametyrosinase (AFC87780.1)
Smed IDSMED30006796
Uniprot Best hitTyrosinase OS=Gallus gallus OX=9031 GN=TYR PE=2 SV=1 (E=3.01652e-41)
Length (bp)1755
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tyrosinase (SMED30006796) t-SNE clustered cells

Violin plots show distribution of expression levels for tyrosinase (SMED30006796) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: LKwY7Inp

 

back to top

Expression Details

tyrosinase ( tyrosinase ) is expressed during Stage 7 and Stage 8 in the eye, visual system, pigment cup cell and optic cup

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30006796

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006796SMESG000065741.1 SmedASXL_008433SmedAsxl_ww_GCZZ01PMID:27034770whole organismasexual adultRNA-sequencing evidence
pigment cup cellSMED30006796SMESG000065741.1 SMED30006796smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
pigment cup cellSMED30006796SMESG000065741.1 SMED30006796smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
headSMED30006796SMESG000065741.1 dd_Smed_v6_34399_0_1dd_Smed_v6PMID:28171748whole organismasexual adultRNA-sequencing evidence
headSMED30006796SMESG000065741.1 OX_Smed_1.0.01148ox_Smed_v2PMID:24238224whole organismasexual adultRNA-sequencing evidence
pigment cup cellSMED30006796SMESG000065741.1 tyrosinasesmed_ncbi_20200123PMID:21852957whole organismasexual adultfluorescence in situ hybridization evidence
pigment cup cellSMED30006796SMESG000065741.1 tyrosinasesmed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
pigment cup cellSMED30006796SMESG000065741.1 tyrosinasesmed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
pigment cup cellSMED30006796SMESG000065741.1 AFC87780.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
pigment cup cellSMED30006796SMESG000065741.1 AFC87780.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
Homology
BLAST of tyrosinase vs. Ensembl Human
Match: DCT (dopachrome tautomerase [Source:HGNC Symbol;Acc:HGNC:2709])

HSP 1 Score: 153.295 bits (386), Expect = 1.319e-39
Identity = 107/336 (31.85%), Postives = 160/336 (47.62%), Query Frame = 2
Query:   53 LPLSDCLIPRICSRNVTLSNSTCCP---IYNDFVCGGP-FRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFE-DLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            LP +    PR+C    +L N  CCP     +  VCG    RG C              ++  +   DDR  WP +FF   C C  N+ G  C  CK GW G NCE   P  IRQNI ++   +   FL  L+++K ++  D++IT         P N    Q  N S+YD  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL  E DL R I  E     +F LPYW++ T +  C++CT+ L G    +D      NS F  W+ +C    +D++    +C+ + E      +      +LP   +I +  S+ ++D+ P
Sbjct:   18 LPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQ---DDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGP-NGTQPQFANCSVYDFFVWLHYYSVRDTLLGP-----GRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNE-----SFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVC-DSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPP 338          

HSP 2 Score: 55.0694 bits (131), Expect = 2.539e-7
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLR-NRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     ++ NDP+F++ H+F D IF+ W+ R N  +    +   PIG +    +VPF P + N  LF ++++ GY+Y
Sbjct:  375 FLNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAWPQELAPIGHNRMYNMVPFFPPVTNEELFLTSDQLGYSY 455          
BLAST of tyrosinase vs. Ensembl Human
Match: DCT (dopachrome tautomerase [Source:HGNC Symbol;Acc:HGNC:2709])

HSP 1 Score: 153.295 bits (386), Expect = 1.992e-39
Identity = 107/336 (31.85%), Postives = 160/336 (47.62%), Query Frame = 2
Query:   53 LPLSDCLIPRICSRNVTLSNSTCCP---IYNDFVCGGP-FRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFE-DLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            LP +    PR+C    +L N  CCP     +  VCG    RG C              ++  +   DDR  WP +FF   C C  N+ G  C  CK GW G NCE   P  IRQNI ++   +   FL  L+++K ++  D++IT         P N    Q  N S+YD  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL  E DL R I  E     +F LPYW++ T +  C++CT+ L G    +D      NS F  W+ +C    +D++    +C+ + E      +      +LP   +I +  S+ ++D+ P
Sbjct:   18 LPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQ---DDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGP-NGTQPQFANCSVYDFFVWLHYYSVRDTLLGP-----GRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNE-----SFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVC-DSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPP 338          
BLAST of tyrosinase vs. Ensembl Human
Match: TYRP1 (tyrosinase related protein 1 [Source:HGNC Symbol;Acc:HGNC:12450])

HSP 1 Score: 140.198 bits (352), Expect = 5.965e-35
Identity = 97/354 (27.40%), Postives = 165/354 (46.61%), Query Frame = 2
Query:   20 VITIGIVFASFLPL--SDCLIPRICSRNVTLSNSTCCPIYNDFV------CGGP-FRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDC--HICDPSQEEPFLWRKYSST----VDRLPNQNEIDELFSINQYDSEP 1024
            ++++G +F   L    +    PR C+    L +  CCP  +         CG    RG CE   +  +   HS         DDR  WP RFF   C C  N+ G  C  C+ GW+G  C+      +R+N+L++   +   F+  L+++K       +  +  +      + +  Q  N SIY+  V+ H+Y+ + T      ES      ++DF+H+GPAF TWHR++LL  E  ++ +  E     +F+LPYW++ T +  C+ICT+DL+G     D      NS F +W+ +C     D+D    +C+ +++ P       +     V RLP   ++ +   +  +D+ P
Sbjct:    6 LLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEA--VTADSRPHSPQYPHD-GRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRV-LIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESF----GEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEP----SFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVC-DSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPP 346          

HSP 2 Score: 61.2326 bits (147), Expect = 3.045e-9
Identity = 35/84 (41.67%), Postives = 51/84 (60.71%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRR--STYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSA-NEFGYAYD 1409
            F+NGT      SPNDP+F+L HTF D +F+ WL R     ST+P +++ PIG +    +VPF P + N  +F +A +  GY Y+
Sbjct:  383 FLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENA-PIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYE 465          
BLAST of tyrosinase vs. Ensembl Human
Match: TYR (tyrosinase [Source:HGNC Symbol;Acc:HGNC:12442])

HSP 1 Score: 135.961 bits (341), Expect = 1.700e-33
Identity = 105/349 (30.09%), Postives = 175/349 (50.14%), Query Frame = 2
Query:   14 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYND--FVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRK--IRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDI-PTE-DQESNSTFF-KWKPICPQKPNDFDCH--ICDPSQEEPFLWRKYS---STVDRLPNQNEIDELFSINQYDS 1018
            ML+  +  +  SF   S    PR C  +  L    CCP ++     CG    RGSC+  +L           TG    DDR +WPS F+   C C  N+ G  C  CK G+ G NC   + R+  +R+NI ++ + +   F + L ++K+ + +D++I   +   +    N       + +IYD  V++H+Y S   M   L  S   +D  +DFAH+ PAF  WHR +LL +E  ++ +  ++    NFT+PYWDW +   C+ICT++ +G   PT  +  S ++FF  W+ +C  +  +++ H  +C+ + E P      +   S   RLP+  +++   S+ QY+S
Sbjct:    1 MLLAVLYCLLWSF-QTSAGHFPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILLSNAPLGPQFPFTGV---DDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNC---TERRLLVRRNIFDLSAPEKDKFFAYLTLAKHTISSDYVIPIGT---YGQMKNGSTPMFNDINIYDLFVWMHYYVS---MDALLGGSEIWRD--IDFAHEAPAFLPWHRLFLLRWEQEIQKLTGDE----NFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVC-SRLEEYNSHQSLCNGTPEGPLRRNPGNHDKSRTPRLPSSADVEFCLSLTQYES 329          

HSP 2 Score: 81.2629 bits (199), Expect = 1.508e-15
Identity = 38/82 (46.34%), Postives = 55/82 (67.07%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            ++NGT      S NDP+FLLHH F+D IFE WL R+R  +  YP +++ PIG + + ++VPF+PL RN + F S+ + GY Y
Sbjct:  369 YMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLQEVYP-EANAPIGHNRESYMVPFIPLYRNGDFFISSKDLGYDY 449          
BLAST of tyrosinase vs. Ensembl Human
Match: DCT (dopachrome tautomerase [Source:HGNC Symbol;Acc:HGNC:2709])

HSP 1 Score: 73.1738 bits (178), Expect = 6.896e-14
Identity = 45/138 (32.61%), Postives = 74/138 (53.62%), Query Frame = 2
Query:  632 LDFAHKGPAFFTWHRHYLLMFE-DLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            +DF+H+GPAF TWHR++LL  E DL R I  E     +F LPYW++ T +  C++CT+ L G    +D      NS F  W+ +C    +D++    +C+ + E      +      +LP   +I +  S+ ++D+ P
Sbjct:   17 IDFSHQGPAFVTWHRYHLLCLERDLQRLIGNE-----SFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVC-DSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPP 148          
BLAST of tyrosinase vs. Ensembl Zebrafish
Match: tyr (tyrosinase [Source:ZFIN;Acc:ZDB-GENE-991026-3])

HSP 1 Score: 159.073 bits (401), Expect = 1.015e-41
Identity = 103/335 (30.75%), Postives = 160/335 (47.76%), Query Frame = 2
Query:   77 PRICSRNVTLSNSTCCPIY--NDFVCG-GPFRGSCEVSILFQNHTEHSDVITGKLEN---------DDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLA-DFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDCH--ICDPSQEEPFLWRKYSS---TVDRLPNQNEIDELFSINQYDS 1018
            PR+C+    L +  CCP++  +  VCG    RG C+            DV+   L N         DDR  WP  F+   C C  NY G  C +CK G+ G NC       +R+NI  + + +   F+S LN++K  ++ D++I   +   +    N       N S+YD  V++H+Y SR      L+    +    +DFAH+  AF  WHR YLL +E  +R +     G +NFT+PYWDW +   C +CT++L+G   + ++     +S F  WK IC Q P  ++    +CD S E P L          V RLP   +++ +  +  Y++
Sbjct:   22 PRVCTSPEVLQSKRCCPVWPGDGSVCGVQSGRGFCQ------------DVLVSDLPNGPQYPHSGVDDRERWPLVFYNQTCQCAGNYMGFDCGECKFGFFGANC-AERRESVRRNIFQLSTTERQRFISYLNLAKTTISPDYMIVTGT---YAQMNNGSTPMFANISVYDLFVWMHYYVSRDA----LLGGPGNVWADIDFAHESAAFLPWHRVYLLFWEHEIRKLT----GDFNFTIPYWDWRDAQDCQVCTDELMGARSSLNRSLISPSSVFSSWKVICSQ-PESYNLREALCDGSPEGPLLRNPGDHDRIRVPRLPTSADVESVLRLTDYET 331          

HSP 2 Score: 75.485 bits (184), Expect = 6.291e-14
Identity = 37/82 (45.12%), Postives = 52/82 (63.41%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NG+      S NDP+F++HH F+D IFE WL R++  R+ YP  ++ PIG +   F+VPF+PL RN + F S    GY Y
Sbjct:  371 FMNGSMSSVQGSANDPIFIIHHAFIDSIFEQWLRRHQPPRTHYP-TANAPIGHNDGYFMVPFIPLYRNGDYFLSTKALGYEY 451          
BLAST of tyrosinase vs. Ensembl Zebrafish
Match: tyrp1a (tyrosinase-related protein 1a [Source:ZFIN;Acc:ZDB-GENE-070718-2])

HSP 1 Score: 153.68 bits (387), Expect = 7.052e-40
Identity = 109/336 (32.44%), Postives = 161/336 (47.92%), Query Frame = 2
Query:   77 PRICSRNVTLSNSTCCPIYN---DFVCGGPF-RGSC-EVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFE----DLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDC--HICDPSQEEPFLWRKYSST----VDRLPNQNEIDELFSINQYDSEP 1024
            PR+C     L ++ CCP  N   D  CG    RG C +VS   + H       TG+   DDR +WP RFF   C C  NY G  C +CK    GE C+   P  +R+N+L + +    +F+S L+ +K     D +I     +    P N  + Q  N SIY+  V+ H+Y    ++SK  +       + +DF+H+GP F TWHR++LL  E    D+LR  +        F LP+WD+ T    C+ICT+DL+G     D     SNS F  W+ IC +   D+D    IC+ ++  P       +     V RLP   ++     I+ +D+ P
Sbjct:   23 PRVCVTAEGLRSAQCCPSPNGLGDDPCGASLGRGQCVDVSADTRAHGPQYP-YTGR---DDRESWPRRFFTRACRCNGNYSGFDCGRCKHAHTGEECQQRVP-VVRRNVLTLSAEQKRVFVSALDQAKRTTHPDIVIATRHYSEIFGPDN--STQFQNISIYNLFVWTHYY----SVSKTFLGDGEPSFSAVDFSHEGPGFLTWHRYHLLQLERDMQDMLRDPS--------FALPFWDFSTGGSECDICTDDLMGARSRFDSTAISSNSIFSSWRVIC-ESVEDYDTLGTICNSTESSPIRRNPAGNVARPMVQRLPEAQDVAACLEIDAFDTPP 338          

HSP 2 Score: 69.707 bits (169), Expect = 4.414e-12
Identity = 39/84 (46.43%), Postives = 55/84 (65.48%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRR--STYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTS-ANEFGYAYD 1409
            F+NGT      SPNDP+FLL HTF D IF+ WL R+    S+YP +++ PIG + +  +VPF P +RN  +F S A+  GY+Y+
Sbjct:  375 FLNGTGGQTHLSPNDPIFLLLHTFTDAIFDEWLRRHTADVSSYPLENA-PIGHNREFNMVPFWPPVRNAEMFVSAADSLGYSYE 457          
BLAST of tyrosinase vs. Ensembl Zebrafish
Match: dct (dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-000508-1])

HSP 1 Score: 142.124 bits (357), Expect = 7.120e-36
Identity = 107/353 (30.31%), Postives = 166/353 (47.03%), Query Frame = 2
Query:    8 LVMLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYND---FVCGG-PFRGSCEVSILFQNHTEHSDVITG--KLEN-DDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQES---NSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
             V+++   G ++     LS+   PR+C     + +  CCP        VCG    RG+C        H + S    G   L N DDR  WP++FF   C C  N+ G  C +CK GW G NC+      +R++I ++   ++  FL+ L++SK  +  D++I          P N    Q  N SIYD  V+ H+Y+ R T+              +DF+HKGPAF TWHR++LL  E  L+ +     G  NF +PYW++ T Q  C++CT+ LLG     D       S F +W  +C    ++++    +C+ + E         ST   LP  N++    ++  +DS P
Sbjct:    4 FVLMLCCFGCMY-----LSEAQFPRVCCTVEGIVSKECCPALGSDPANVCGLLAGRGNCS-----DVHVD-SKPWGGPYSLRNVDDRERWPTKFFNRTCRCFGNFAGYNCGECKFGWTGLNCDQRKAPVLRKDIHSLSPEELQEFLNALDLSKTTVHPDYMIATQHWLGLLGP-NGTEPQFSNISIYDFFVWQHYYSVRDTLLGP-----GRPFKAIDFSHKGPAFITWHRYHLLSLERELQKLT----GNENFAVPYWNFATGQSECDVCTDSLLGGRDPSDPSRISPRSRFARWGVVC-DSLDEYNRLVTLCNGTNEGSLRRGAAMSTNVTLPTMNDVRSCLNLRDFDSPP 334          

HSP 2 Score: 59.6918 bits (143), Expect = 6.097e-9
Identity = 30/81 (37.04%), Postives = 50/81 (61.73%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRS-TYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     ++ NDP+FL+ H F D IF+ W+ R R + T+P + + PIG +    +VPF P + N  ++ ++ + GY+Y
Sbjct:  371 FLNGTSALSHSAANDPIFLVLHAFTDAIFDEWMRRFRENETFPDEMA-PIGHNRHYNMVPFFPPVTNEEIYIASEQLGYSY 450          
BLAST of tyrosinase vs. Ensembl Zebrafish
Match: tyrp1b (tyrosinase-related protein 1b [Source:ZFIN;Acc:ZDB-GENE-040718-249])

HSP 1 Score: 139.428 bits (350), Expect = 6.605e-35
Identity = 96/330 (29.09%), Postives = 154/330 (46.67%), Query Frame = 2
Query:   77 PRICSRNVTLSNSTCCP----IYNDFVCGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWT-NQITCNICTNDLLG---DIPTEDQESNSTFFKWKPICPQKPNDFDC--HICDPSQEEPFLWRKYSST----VDRLPNQNEIDELFSINQYDSEP 1024
            PR C     L + TCCP    + ND       RG C VSI                  DDR  WP RFF   C C  N+ G  C +C+ G  G NC+      +R+NI+ M + +   F++ L+ +K  +   L+  +         +  ++Q+ N +IY+  V+ H+Y    ++SK  M         +DF+H+GP F TWHR++LL  E  ++ +     G  +F LPYW++      C+ICT+DL+G      T    SNS F +W+ IC +   +++    IC+ ++  P       +     V RLP   ++ +   +N +D+ P
Sbjct:   20 PRQCMTPEGLRSGTCCPSPTGLANDECGSISGRGQC-VSITADRRPHGPQYPHDG--RDDRERWPLRFFNRTCQCNGNFTGFNCGRCRHGLTGPNCD-QRITVVRRNIMQMSADEKRAFVNALDQAKRTVHPDLVICTRRFQEILSPDGASVQVENITIYNYFVWTHYY----SVSKTYMGPGQQSFGGVDFSHEGPGFVTWHRYHLLQLERDMQDM----LGDPSFALPYWNFAIGGSECDICTDDLIGARSSFDTNGISSNSVFSQWRVIC-ESVEEYETLGTICNNTESSPIRRNPAGNVARPMVQRLPEPQDVIDCLELNTFDTPP 336          

HSP 2 Score: 67.781 bits (164), Expect = 1.858e-11
Identity = 38/85 (44.71%), Postives = 52/85 (61.18%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRS---TYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSA-NEFGYAYD 1409
            F+NGT      SPNDP+F+L HTF D IF+ WL R+  +    YP + + PIG + +  +VPF P IRN  +F SA +  GY Y+
Sbjct:  373 FLNGTGGQTHLSPNDPIFVLLHTFTDAIFDEWLQRHTAAGTLAYP-EENAPIGHNREFNMVPFWPPIRNAEMFVSAPDNLGYTYE 456          
BLAST of tyrosinase vs. Ensembl Zebrafish
Match: dct (dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-000508-1])

HSP 1 Score: 114.39 bits (285), Expect = 6.439e-27
Identity = 77/250 (30.80%), Postives = 123/250 (49.20%), Query Frame = 2
Query:  296 NYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQES---NSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            N+ G  C +CK GW G NC+      +R++I ++   ++  FL+ L++SK  +  D++I          P N    Q  N SIYD  V+ H+Y+ R T+              +DF+HKGPAF TWHR++LL  E  L+ +     G  NF +PYW++ T Q  C++CT+ LLG     D       S F +W  +C    ++++    +C+ + E         ST   LP  N++    ++  +DS P
Sbjct:    2 NFAGYNCGECKFGWTGLNCDQRKAPVLRKDIHSLSPEELQEFLNALDLSKTTVHPDYMIATQHWLGLLGP-NGTEPQFSNISIYDFFVWQHYYSVRDTLL-----GPGRPFKAIDFSHKGPAFITWHRYHLLSLERELQKLT----GNENFAVPYWNFATGQSECDVCTDSLLGGRDPSDPSRISPRSRFARWGVVC-DSLDEYNRLVTLCNGTNEGSLRRGAAMSTNVTLPTMNDVRSCLNLRDFDSPP 240          

HSP 2 Score: 59.6918 bits (143), Expect = 4.950e-9
Identity = 30/81 (37.04%), Postives = 50/81 (61.73%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRS-TYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     ++ NDP+FL+ H F D IF+ W+ R R + T+P + + PIG +    +VPF P + N  ++ ++ + GY+Y
Sbjct:  277 FLNGTSALSHSAANDPIFLVLHAFTDAIFDEWMRRFRENETFPDEMA-PIGHNRHYNMVPFFPPVTNEEIYIASEQLGYSY 356          
BLAST of tyrosinase vs. Ensembl Xenopus
Match: tyr (tyrosinase [Source:NCBI gene;Acc:100125152])

HSP 1 Score: 166.007 bits (419), Expect = 4.932e-44
Identity = 109/340 (32.06%), Postives = 180/340 (52.94%), Query Frame = 2
Query:   50 FLPLSDCLIPRICSRNVTLSNSTCCPIY--NDFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRK--IRQNILNMRSYDVFIFLSILNISKYQLA-DFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDI--PTEDQESNSTFFK-WKPICPQKPNDFDCH--ICDPSQEEPFLWRKYS----STVDRLPNQNEIDELFSINQYDSEP 1024
            FL +     PR CS   +L +  CCP++  +   CG    RG C+  +L  + T      TG    DDR NWP+ F+   C C  N+ G  C  CK G++G NC   + R+  IR+ I  M S +   F++ LN++K+  + D++I   +   +    N  N    + ++YD  V++H+YASR      + E    +D  +DFAH+ PAF  WHR++LL +E  ++ +  ++    NFT+P+WDW +   C+ICT++LLG +   T +  S ++FF  W+ +C  +P +++    +C+ + E P L+R       S   RLP   E++   S+  Y++EP
Sbjct:   16 FLHVCRGQFPRACSTAESLLSKECCPVWSGDGSSCGQLSGRGVCQDVVLTSSATGPQFPFTGV---DDRENWPTVFYNRTCQCLGNFMGYNCADCKFGFRGPNC---TERRTMIRKEIFRMSSAEKSKFVAYLNLAKHTTSRDYVIVTGT---YAQMNNGSNPMFADINVYDLFVWMHYYASRDVF---IGEDALWRD--IDFAHEAPAFVPWHRYFLLHWEHEIQKLTGDE----NFTIPFWDWRDAQGCDICTDELLGGVHPTTTNLLSPASFFASWQIVC-SRPEEYNAQRILCNGTGEGP-LFRNPGGHDRSRTPRLPTTAEVELCLSLTNYETEP 335          

HSP 2 Score: 74.3294 bits (181), Expect = 2.372e-13
Identity = 36/83 (43.37%), Postives = 52/83 (62.65%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRST--YPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYD 1409
            F+NG+      S NDP+F+LHH F+D IFE WL R+  S   YP +++ PIG +   ++VPF+PL  N   F ++ + GY YD
Sbjct:  373 FLNGSMSSVQGSANDPVFVLHHAFVDSIFEQWLRRHGASVDIYP-EANAPIGHNRGYYMVPFIPLYTNGEFFAASRDLGYDYD 454          
BLAST of tyrosinase vs. Ensembl Xenopus
Match: dct (dopachrome tautomerase [Source:NCBI gene;Acc:549915])

HSP 1 Score: 153.295 bits (386), Expect = 1.045e-39
Identity = 104/351 (29.63%), Postives = 169/351 (48.15%), Query Frame = 2
Query:    5 SLVMLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYN---DFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLEN-DDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            ++++L   +  V A F        PR C     L++  CCP      + VCG    RG C   ++  +    S   T  L N DDR  WP +FF  +C C  N+ G  C +CK GW G  CE   P  +R+NI ++ + +   FL  L+ +K  +    +  +   L     N    Q+ N SIY+  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL+ E  L+ +     G  +F LPYW++ T +  C++CT++L G    +D     + S F +W  +C    ND++    +C+ + E             RLP+  ++ +  S+N++D+ P
Sbjct:    3 AVLLLACCLQAVRAQF--------PRSCVTVEALTSKRCCPALGSDLNNVCGSLEGRGQCTPVVV--DERPWSGPYT--LRNVDDRERWPLKFFNSICRCTGNFAGFNCGECKFGWTGPTCEQRKPPVVRKNIHSLTAQERTQFLDALDQAKNTIHPDYVIATQHWLSILGPNGTEPQVANTSIYNYFVWLHYYSVRDTLLGP-----GRPFTAIDFSHQGPAFVTWHRYHLLLLERDLQRMT----GNESFALPYWNFATGRNECDVCTDELFGAPRLDDPNLISAGSRFSRWGIVC-NSLNDYNRLVTLCNGTNEGFLQRNPLGGAEGRLPSMEDVQKCLSLNEFDNPP 331          

HSP 2 Score: 59.3066 bits (142), Expect = 1.274e-8
Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRS--TYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     +S NDP+F++ H+F D IF+ W+ R + S   +P +   PIG +    +VPF P + N  LF  A + GY Y
Sbjct:  368 FLNGTSAQSHSSANDPIFVVLHSFTDAIFDEWMKRFQPSDVAWP-QELAPIGHNRMYNMVPFFPPVTNEELFLPAEQLGYVY 448          
BLAST of tyrosinase vs. Ensembl Xenopus
Match: dct (dopachrome tautomerase [Source:NCBI gene;Acc:549915])

HSP 1 Score: 153.295 bits (386), Expect = 1.080e-39
Identity = 104/351 (29.63%), Postives = 169/351 (48.15%), Query Frame = 2
Query:    5 SLVMLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYN---DFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLEN-DDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            ++++L   +  V A F        PR C     L++  CCP      + VCG    RG C   ++  +    S   T  L N DDR  WP +FF  +C C  N+ G  C +CK GW G  CE   P  +R+NI ++ + +   FL  L+ +K  +    +  +   L     N    Q+ N SIY+  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL+ E  L+ +     G  +F LPYW++ T +  C++CT++L G    +D     + S F +W  +C    ND++    +C+ + E             RLP+  ++ +  S+N++D+ P
Sbjct:    8 AVLLLACCLQAVRAQF--------PRSCVTVEALTSKRCCPALGSDLNNVCGSLEGRGQCTPVVV--DERPWSGPYT--LRNVDDRERWPLKFFNSICRCTGNFAGFNCGECKFGWTGPTCEQRKPPVVRKNIHSLTAQERTQFLDALDQAKNTIHPDYVIATQHWLSILGPNGTEPQVANTSIYNYFVWLHYYSVRDTLLGP-----GRPFTAIDFSHQGPAFVTWHRYHLLLLERDLQRMT----GNESFALPYWNFATGRNECDVCTDELFGAPRLDDPNLISAGSRFSRWGIVC-NSLNDYNRLVTLCNGTNEGFLQRNPLGGAEGRLPSMEDVQKCLSLNEFDNPP 336          

HSP 2 Score: 59.3066 bits (142), Expect = 1.307e-8
Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRS--TYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     +S NDP+F++ H+F D IF+ W+ R + S   +P +   PIG +    +VPF P + N  LF  A + GY Y
Sbjct:  373 FLNGTSAQSHSSANDPIFVVLHSFTDAIFDEWMKRFQPSDVAWP-QELAPIGHNRMYNMVPFFPPVTNEELFLPAEQLGYVY 453          
BLAST of tyrosinase vs. Ensembl Xenopus
Match: ENSXETT00000011816.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV462047.1:21:1533:-1 gene:ENSXETG00000005616.1 transcript:ENSXETT00000011816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 8.160e-39
Identity = 95/320 (29.69%), Postives = 152/320 (47.50%), Query Frame = 2
Query:   59 LSDCLIPRICSRNVTLSNSTCCPIYNDFV-CG-GPFRGSCEVSILFQNHTEHSDVITGK--LENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRK--IRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ-ESNSTFFKWKPICP--QKPNDFDCHICDPSQEEPFLWRKYSSTV-DRLPNQNEID 988
            L     PR+C+ +  L    CCP + D   CG    RG C   + F      S +  G+  L NDDR +WP  ++   C C  NY G  C  CK G+ GE CE    RK  +R+ I  +   D   F S L ++K   +   +  ++ + H    + D  + V+ASIYD   ++H+++ +  M    +      D+  +FAH+GP F  WHR  L+  E  ++ +  ++    +F  PY+DW  +  C+ICTND +GD   +   +  S F  W+ IC     P+ + C +    Q E  L +  +  V  RLP+  +++
Sbjct:    4 LCKAQFPRVCTTDGALQTKNCCPRWTDGTPCGFRSGRGRCRNGVAF------SSLAAGQVPLYNDDRWDWPRYYYDSTCECYGNYGGFDCGDCKHGYFGERCER---RKTLVRREIRELSLVDRRRFFSYLALAKTTKSKDYVVLTTGDRH----HRDTFRFVDASIYDVFAWMHYFSMKPIMVNSTL------DDSKNFAHQGPVFPGWHRMALMFLEREIQRMTGDE----DFAFPYYDWRGEQNCSICTNDFMGDNDVQGNLDPYSHFSNWRGICSGYDYPDAY-CPVIQEHQMETILRKPGTDPVAARLPSVPDVE 299          
BLAST of tyrosinase vs. Ensembl Xenopus
Match: ENSXETT00000000812.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460737.1:129601:132967:1 gene:ENSXETG00000006077.1 transcript:ENSXETT00000000812.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.828 bits (377), Expect = 1.265e-38
Identity = 95/345 (27.54%), Postives = 161/345 (46.67%), Query Frame = 2
Query:   17 LVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYNDF-VCGG-PFRGSCEVSILFQNHTEHSDVITGKLE--NDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ-ESNSTFFKWKPICP--QKPNDFDCHICDPSQEEPFLWRKYSS--TVDRLPNQNEIDELFSINQYDSEP 1024
            +++ + I+ A          PR+C+         CCP + D   CG    RG C   + F      S    G+L   NDDRL+WP  ++   C C  NY G  C  CK G+ G+ C+    R +R+ I  +   +   F   L ++K   +   +  ++ + H    + D  + V+ASIY+   ++H+Y+ +  M    +      D + ++AH+GPAF  WHR  L+ FE  ++ +  ++    +F LPY+DW  +  C+ICTND +GD   +   +  S F+ W+ IC     P+ +     D  QE   L RK  +    + LP+  +++       +D+ P
Sbjct:    1 VMLGLWIILALSFSGVQSQFPRVCTTKEAFQTKVCCPTWTDGSACGSRSGRGQCRNWVAF------SSFAKGQLPIYNDDRLDWPRHYYDSTCECFGNYGGFNCGYCKYGYTGKKCDQKKTR-VRKEIRQLSFTERKRFFGYLALAKTTFSKDYVVLTTGDRH----HRDTYRFVDASIYEVFSWIHYYSIKPIMVNSTL------DPRRNYAHRGPAFPGWHRLGLMFFEREVQHMTGDE----DFALPYYDWRGEQNCSICTNDYMGDNDVQGYLDPYSHFYNWRSICSGYNYPDAYCPGATDGYQER--LHRKPGADPLANTLPSFQDVENTLKWRDFDTPP 322          
BLAST of tyrosinase vs. Ensembl Mouse
Match: Tyr (tyrosinase [Source:MGI Symbol;Acc:MGI:98880])

HSP 1 Score: 151.754 bits (382), Expect = 4.252e-39
Identity = 103/331 (31.12%), Postives = 167/331 (50.45%), Query Frame = 2
Query:   59 LSDCLIPRICSRNVTLSNSTCCPIY--NDFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQE--SNSTFF-KWKPICPQKPNDFDCH--ICDPSQEEPFLWRKYS---STVDRLPNQNEIDELFSINQYDS 1018
            +SD   PR C+ +  L    CCP +  +   CG    RGSC+  +L    +       G    DDR +WPS F+   C C  N+ G  C  CK G+ G NC       IR+NI ++   +   F S L ++K+ ++   +  + +    +  N       + +IYD  V++H+Y SR T+   L  S   +D  +DFAH+ P F  WHR +LL++E  +R +  ++    NFT+PYWDW +   C+ICT++ LG    E+    S ++FF  W+ IC  +  +++ H  +CD + E P L    +   +   RLP+  +++   S+ QY+S
Sbjct:   15 ISDGHFPRACASSKNLLAKECCPPWMGDGSPCGQLSGRGSCQDILLSSAPSGPQFPFKGV---DDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFGGPNC-TEKRVLIRRNIFDLSVSEKNKFFSYLTLAKHTISSVYVIPTGTYGQMN--NGSTPMFNDINIYDLFVWMHYYVSRDTL---LGGSEIWRD--IDFAHEAPGFLPWHRLFLLLWEQEIRELTGDE----NFTVPYWDWRDAENCDICTDEYLGGRHPENPNLLSPASFFSSWQIIC-SRSEEYNSHQVLCDGTPEGPLLRNPGNHDKAKTPRLPSSADVEFCLSLTQYES 329          

HSP 2 Score: 81.6481 bits (200), Expect = 8.703e-16
Identity = 39/82 (47.56%), Postives = 54/82 (65.85%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRR--STYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT      S NDP+FLLHH F+D IFE WL R+R     YP +++ PIG + D ++VPF+PL RN + F ++ + GY Y
Sbjct:  369 FMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLLEVYP-EANAPIGHNRDSYMVPFIPLYRNGDFFITSKDLGYDY 449          
BLAST of tyrosinase vs. Ensembl Mouse
Match: Dct (dopachrome tautomerase [Source:MGI Symbol;Acc:MGI:102563])

HSP 1 Score: 148.673 bits (374), Expect = 3.748e-38
Identity = 100/328 (30.49%), Postives = 155/328 (47.26%), Query Frame = 2
Query:   74 IPRICSRNVTLSNSTCCPIYN---DFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDCHI--CDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
             PR+C     + N  CCP        +CG    RG C      Q  T            DDR  WP +FF   C C  N+ G  C  CK GW G +C    P  +R+NI ++ + +   FL  L+++K  +  D++IT         P N    Q+ N S+YD  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL  E  L+ +     G  +F LPYW++ T +  C++CT++LLG    +D      NS F  W+ +C    +D++  +  C+ + E      K     ++LP    + +  S+ ++DS P
Sbjct:   25 FPRVCMTLDGVLNKECCPPLGPEATNICGFLEGRGQCAE---VQTDTRPWSGPYILRNQDDREQWPRKFFNRTCKCTGNFAGYNCGGCKFGWTGPDCNRKKPAILRRNIHSLTAQEREQFLGALDLAKKSIHPDYVITTQHWLGLLGP-NGTQPQIANCSVYDFFVWLHYYSVRDTLLGP-----GRPYKAIDFSHQGPAFVTWHRYHLLWLERELQRLT----GNESFALPYWNFATGKNECDVCTDELLGAARQDDPTLISRNSRFSTWEIVC-DSLDDYNRRVTLCNGTYEGLLRRNKVGRNNEKLPTLKNVQDCLSLQKFDSPP 338          

HSP 2 Score: 60.8474 bits (146), Expect = 2.921e-9
Identity = 34/82 (41.46%), Postives = 49/82 (59.76%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRST--YPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     ++ NDP+F++ H+F D IF+ WL RN  ST  +P +   PIG +    +VPF P + N  LF +A + GY Y
Sbjct:  375 FLNGTNALPHSAANDPVFVVLHSFTDAIFDEWLKRNNPSTDAWP-QELAPIGHNRMYNMVPFFPPVTNEELFLTAEQLGYNY 455          
BLAST of tyrosinase vs. Ensembl Mouse
Match: Tyrp1 (tyrosinase-related protein 1 [Source:MGI Symbol;Acc:MGI:98881])

HSP 1 Score: 135.191 bits (339), Expect = 2.417e-33
Identity = 97/340 (28.53%), Postives = 161/340 (47.35%), Query Frame = 2
Query:   74 IPRICSRNVTLSNSTCCPIYNDFVCGGPF---------RGSCEVSIL-FQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENC--EVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDC--HICDPSQEEPFLWRKYSS----TVDRLPNQNEIDELFSINQYDSEP 1024
             PR C+    L    CCP  +     GP          RG C   I   + H+ H     GK   DDR  WP RFF   C C  N+ G  C  C+ GW+G  C  ++++   +R+N+L++   +   F+  L+++K      F+I          P + +  Q  N S+Y+  V+ H+Y+ + T      ES  D    +DF+H+GPAF TWHR++LL  E  ++ +  E     +F+LPYW++ T +  C++CT+DL+G     D      NS F +W+ +C +   ++D    +C+ ++  P       +     V RLP   ++ +   +  +D+ P
Sbjct:   26 FPRECANIEALRRGVCCP--DLLPSSGPGTDPCGSSSGRGRCVAVIADSRPHSRHYP-HDGK---DDREAWPLRFFNRTCQCNDNFSGHNCGTCRPGWRGAACNQKILT---VRRNLLDLSPEEKSHFVRALDMAKRTTHPQFVIATRRLEDILGP-DGNTPQFENISVYNYFVWTHYYSVKKTFLGTGQESFGD----VDFSHEGPAFLTWHRYHLLQLERDMQEMLQEP----SFSLPYWNFATGKNVCDVCTDDLMGSRSNFDSTLISPNSVFSQWRVVC-ESLEEYDTLGTLCNSTEGGPIRRNPAGNVGRPAVQRLPEPQDVTQCLEVRVFDTPP 346          

HSP 2 Score: 63.1586 bits (152), Expect = 4.930e-10
Identity = 37/91 (40.66%), Postives = 54/91 (59.34%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRR--STYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSA-NEFGYAYDNNIVGNK 1430
            F+NGT      SPNDP+F+L HTF D +F+ WL R     ST+P +++ PIG +    +VPF P + N  +F +A +  GYAY+    G +
Sbjct:  383 FLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENA-PIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYAYEVQWPGQE 472          
BLAST of tyrosinase vs. Ensembl Mouse
Match: Tyrp1 (tyrosinase-related protein 1 [Source:MGI Symbol;Acc:MGI:98881])

HSP 1 Score: 135.191 bits (339), Expect = 2.417e-33
Identity = 97/340 (28.53%), Postives = 161/340 (47.35%), Query Frame = 2
Query:   74 IPRICSRNVTLSNSTCCPIYNDFVCGGPF---------RGSCEVSIL-FQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENC--EVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDC--HICDPSQEEPFLWRKYSS----TVDRLPNQNEIDELFSINQYDSEP 1024
             PR C+    L    CCP  +     GP          RG C   I   + H+ H     GK   DDR  WP RFF   C C  N+ G  C  C+ GW+G  C  ++++   +R+N+L++   +   F+  L+++K      F+I          P + +  Q  N S+Y+  V+ H+Y+ + T      ES  D    +DF+H+GPAF TWHR++LL  E  ++ +  E     +F+LPYW++ T +  C++CT+DL+G     D      NS F +W+ +C +   ++D    +C+ ++  P       +     V RLP   ++ +   +  +D+ P
Sbjct:   26 FPRECANIEALRRGVCCP--DLLPSSGPGTDPCGSSSGRGRCVAVIADSRPHSRHYP-HDGK---DDREAWPLRFFNRTCQCNDNFSGHNCGTCRPGWRGAACNQKILT---VRRNLLDLSPEEKSHFVRALDMAKRTTHPQFVIATRRLEDILGP-DGNTPQFENISVYNYFVWTHYYSVKKTFLGTGQESFGD----VDFSHEGPAFLTWHRYHLLQLERDMQEMLQEP----SFSLPYWNFATGKNVCDVCTDDLMGSRSNFDSTLISPNSVFSQWRVVC-ESLEEYDTLGTLCNSTEGGPIRRNPAGNVGRPAVQRLPEPQDVTQCLEVRVFDTPP 346          

HSP 2 Score: 63.1586 bits (152), Expect = 4.930e-10
Identity = 37/91 (40.66%), Postives = 54/91 (59.34%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRR--STYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSA-NEFGYAYDNNIVGNK 1430
            F+NGT      SPNDP+F+L HTF D +F+ WL R     ST+P +++ PIG +    +VPF P + N  +F +A +  GYAY+    G +
Sbjct:  383 FLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENA-PIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYAYEVQWPGQE 472          
BLAST of tyrosinase vs. Ensembl Mouse
Match: Tyrp1 (tyrosinase-related protein 1 [Source:MGI Symbol;Acc:MGI:98881])

HSP 1 Score: 96.6709 bits (239), Expect = 3.135e-22
Identity = 68/218 (31.19%), Postives = 103/218 (47.25%), Query Frame = 2
Query:   74 IPRICSRNVTLSNSTCCPIYNDFVCGGPF---------RGSCEVSIL-FQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENC--EVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLL 688
             PR C+    L    CCP  +     GP          RG C   I   + H+ H     GK   DDR  WP RFF   C C  N+ G  C  C+ GW+G  C  ++++   +R+N+L++   +   F+  L+++K      F+I          P + +  Q  N S+Y+  V+ H+Y+ + T      ES  D    +DF+H+GPAF TWHR++LL
Sbjct:   26 FPRECANIEALRRGVCCP--DLLPSSGPGTDPCGSSSGRGRCVAVIADSRPHSRHYP-HDGK---DDREAWPLRFFNRTCQCNDNFSGHNCGTCRPGWRGAACNQKILT---VRRNLLDLSPEEKSHFVRALDMAKRTTHPQFVIATRRLEDILGP-DGNTPQFENISVYNYFVWTHYYSVKKTFLGTGQESFGD----VDFSHEGPAFLTWHRYHLL 229          
BLAST of tyrosinase vs. UniProt
Match: sp|P55024|TYRO_CHICK (Tyrosinase OS=Gallus gallus OX=9031 GN=TYR PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 3.017e-41
Identity = 110/346 (31.79%), Postives = 178/346 (51.45%), Query Frame = 2
Query:   14 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYND--FVCG-GPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISK-YQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDI-PTE-DQESNSTFF-KWKPICPQKPN-DFDCHICDPSQEEPFLWRKYS---STVDRLPNQNEIDELFSINQYDS 1018
            M +  +G++     P S    PR+C+   +L    CCP ++     CG    RG+C+  +L Q         +G    DDR +WPS F+   C C+ N+ G  C +CK G+ G+NC     R  R+NI  +   +   FL+ LN++K     D++I   ++  +    N  N    N ++YD  V++H+YASR T+   L  S   +D  +DFAH+ P F  WHR +LL++E  ++ I  ++    NFT+PYWDW +   C ICT++ +G   PT  +  S ++FF  W+ IC Q    +    +C+ + E P L    +   S   RLP+ +E++   ++ QY+S
Sbjct:    1 MFLFAMGLLLVILQP-STGQFPRVCANTQSLLRKECCPPWDGDGTPCGERSNRGTCQRILLSQAPLGPQFPFSGV---DDREDWPSVFYNRTCRCRGNFMGFNCGECKFGFSGQNCTERRLR-TRRNIFQLTISEKDKFLAYLNLAKNIPSKDYVI---ATGTYAQMNNGSNPMFRNINVYDLFVWMHYYASRDTL---LGGSNVWRD--IDFAHEAPGFLPWHRAFLLLWEREIQKITGDE----NFTIPYWDWRDAEDCVICTDEYMGGQHPTNPNLLSPASFFSSWQVICTQSEEYNSQQALCNATSEGPILRNPGNNDKSRTPRLPSSSEVEFCLTLTQYES 329          

HSP 2 Score: 79.7221 bits (195), Expect = 2.358e-14
Identity = 37/83 (44.58%), Postives = 54/83 (65.06%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRR--STYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYD 1409
            ++NG+      S NDP+F+LHH F+D IFE WL R+R     YP  ++ PIG + ++++VPF+PL RN   F S+ E GY Y+
Sbjct:  369 YMNGSMSQVQGSANDPIFILHHAFVDSIFERWLRRHRPMLEVYPA-ANAPIGHNRENYMVPFIPLYRNGEFFISSRELGYDYE 450          
BLAST of tyrosinase vs. UniProt
Match: sp|Q4R1H1|TYRP2_PIG (L-dopachrome tautomerase OS=Sus scrofa OX=9823 GN=DCT PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 3.594e-41
Identity = 105/345 (30.43%), Postives = 165/345 (47.83%), Query Frame = 2
Query:   23 ITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYN---DFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISK-YQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDCHI--CDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            + +G + ++  P +    PR+C    +L    CCP        VCG    RG C      Q  T            DDR  WP +FF   C C  N+ G  C  CK GW G NC+   P  +RQNI ++ + +   FL  L+++K     D++IT         P N    Q+ N SIYD  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL  E  L+ +     G  +F +PYW++ T +  C++CT+ LLG    +D      NS F  W+ +C    +D++  +  C+ + E      +     ++LP+  +I++  S+ Q+D+ P
Sbjct:    8 LLLGCLGSALGPGAQAQFPRVCMTVGSLQAKECCPPLGAEPSNVCGSLEGRGRCAE---VQADTRPWSGPYVLRNQDDRERWPRKFFDRTCRCTGNFAGYNCGDCKFGWTGPNCDQKKPLVVRQNIHSLTAQEREQFLGALDLAKNTPHPDYVITTQHWLGLLGP-NGTQPQIANCSIYDLFVWLHYYSVRDTLLGP-----GRPYKAIDFSHQGPAFVTWHRYHLLWLERALQRLT----GNESFAVPYWNFATGRNECDVCTDQLLGAARPDDPTLISQNSRFSSWEIVC-DSLDDYNRRVTLCNGTYEGLLRRNQVGRNSEKLPSLKDIEDCLSLKQFDNPP 338          

HSP 2 Score: 55.4546 bits (132), Expect = 9.317e-7
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLR--NRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     ++ NDP+F++ H+F D IF+ W+ R       +P +   PIG +    +VPF P + N  LF +A++ GY+Y
Sbjct:  375 FLNGTSALPHSAANDPVFVVLHSFTDAIFDEWMKRFSPPVDAWP-QELAPIGHNRMYNMVPFFPPVTNEELFLTADQLGYSY 455          
BLAST of tyrosinase vs. UniProt
Match: sp|Q08410|TYRO_COTJA (Tyrosinase (Fragment) OS=Coturnix japonica OX=93934 GN=TYR PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.225e-39
Identity = 92/270 (34.07%), Postives = 144/270 (53.33%), Query Frame = 2
Query:   14 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIY--NDFVCG-GPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISK-YQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLG 811
            ML+ T+G++ A   P S    PR+C+   +L    CCP +  +   CG    RG+C+  +L Q         +G    DDR +WPS F+   C C+ N+ G  C +CK G+ G+NC     R  R+NI  +   +   FL+ LN++K     D++I   ++  +    N  N    N ++YD  V++H+YASR T+   L  S   +D  +DFAH+ P F  WHR +LL++E  ++ I  ++    NFT+PYWDW +   C ICT++ +G
Sbjct:    1 MLLFTMGLLLAILQP-STGQFPRVCANTQSLLRKECCPPWEGDGSPCGERSNRGTCQRILLSQAPLGPQFPFSGV---DDREDWPSVFYNRTCRCRGNFMGFNCGECKFGFSGQNCTERRLR-TRRNIFQLTIREKDKFLAYLNLAKNIPSKDYVI---ATGTYAQMNNGSNPMFRNINVYDLFVWMHYYASRDTL---LGGSNVWRD--IDFAHEAPGFLPWHRAFLLLWEREIQKITGDE----NFTIPYWDWRDAEDCVICTDEYMG 253          
BLAST of tyrosinase vs. UniProt
Match: sp|O93505|TYRP2_CHICK (L-dopachrome tautomerase OS=Gallus gallus OX=9031 GN=DCT PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 2.839e-39
Identity = 105/335 (31.34%), Postives = 166/335 (49.55%), Query Frame = 2
Query:   53 LPLSDCLIPRICSRNVTLSNSTCCPIYN---DFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            LP ++   PR+C     + +  CCP        VCG    RG C+     Q  T+           DDR  WP +FF   C C  N+ G  C  CK GW G +C V  P  +R+NI ++   +   FL +L+ +K  +  D++I          P  E+  Q+ N SIY+  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL+ E  L+ +     G  +F LPYWD+ T + TC++CT+ L G    +D      NS F +W+ +C    +D++    +C+ S +E  L R+   + ++LP   ++    S +++DS P
Sbjct:   20 LPRAEAQFPRVCMTVEAIRSKRCCPALGPDPGNVCGVLQGRGWCQG---VQVDTQPWSGPYTLRNVDDRERWPLKFFNQSCWCTGNFAGYNCGDCKFGWTGPDCSVRKPPVVRKNIHSLTVEEREQFLDVLDRAKTTIHPDYVIATQHWMSLLGPSGEEP-QIANCSIYNYFVWLHYYSVRDTLLGP-----GRPFTAIDFSHQGPAFVTWHRYHLLLLERDLQRL----MGNESFALPYWDFATGRNTCDVCTDQLFGAPRPDDPGLISLNSRFSRWQIVC-NSLDDYNRLVTLCNGS-DEGLLQRRPRDSGEQLPTAEDVRRCLSRHEFDSPP 339          

HSP 2 Score: 55.8398 bits (133), Expect = 7.454e-7
Identity = 31/89 (34.83%), Postives = 51/89 (57.30%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLR--NRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGN 1427
            F+NGT +    + NDP+F++ H+F D IF+ W+ R     + +P +   PIG +    +VPF P + N  LF +A + GY Y  ++ G+
Sbjct:  376 FLNGTRVLPHAAANDPIFVVLHSFTDAIFDEWMKRFHPPDNAWP-EELAPIGHNRLYNMVPFFPPVTNDQLFQTAEQLGYTYAIDLPGS 463          
BLAST of tyrosinase vs. UniProt
Match: sp|P40126|TYRP2_HUMAN (L-dopachrome tautomerase OS=Homo sapiens OX=9606 GN=DCT PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 6.334e-39
Identity = 107/336 (31.85%), Postives = 160/336 (47.62%), Query Frame = 2
Query:   53 LPLSDCLIPRICSRNVTLSNSTCCP---IYNDFVCGGP-FRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFE-DLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            LP +    PR+C    +L N  CCP     +  VCG    RG C              ++  +   DDR  WP +FF   C C  N+ G  C  CK GW G NCE   P  IRQNI ++   +   FL  L+++K ++  D++IT         P N    Q  N S+YD  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL  E DL R I  E     +F LPYW++ T +  C++CT+ L G    +D      NS F  W+ +C    +D++    +C+ + E      +      +LP   +I +  S+ ++D+ P
Sbjct:   18 LPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQ---DDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGP-NGTQPQFANCSVYDFFVWLHYYSVRDTLLGP-----GRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNE-----SFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVC-DSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPP 338          

HSP 2 Score: 55.0694 bits (131), Expect = 1.219e-6
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLR-NRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     ++ NDP+F++ H+F D IF+ W+ R N  +    +   PIG +    +VPF P + N  LF ++++ GY+Y
Sbjct:  375 FLNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAWPQELAPIGHNRMYNMVPFFPPVTNEELFLTSDQLGYSY 455          
BLAST of tyrosinase vs. TrEMBL
Match: gnl|BL_ORD_ID|20345973 (tr|H9B8J5|H9B8J5_SCHMD Tyrosinase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 499.975 bits (1286), Expect = 1.513e-170
Identity = 251/261 (96.17%), Postives = 256/261 (98.08%), Query Frame = 2
Query:  395 MRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQESNSTFFKWKPICPQKPNDFDCHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEPXXXXXXXXXXXXXXAEGYYRVHPNSDDMKMKDIGKGLPHQNIMMHNMFYQW 1177
            MRSYDVFIFLS+LNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGY+NFTLPYWDWTNQ TCNICTNDLLGDIPTEDQESNSTFFKWKPICPQKPNDFDCHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEPFNSS+FSRKSFRNFAEGYYRV  NSDDMKMKDIGKGLPHQNIMMHNM + +
Sbjct:    1 MRSYDVFIFLSVLNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYFNFTLPYWDWTNQTTCNICTNDLLGDIPTEDQESNSTFFKWKPICPQKPNDFDCHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEPFNSSTFSRKSFRNFAEGYYRVDQNSDDMKMKDIGKGLPHQNIMMHNMVHSF 261          

HSP 2 Score: 308.531 bits (789), Expect = 1.168e-95
Identity = 163/183 (89.07%), Postives = 168/183 (91.80%), Query Frame = 3
Query: 1110 K*KTLGRDSP---IKIS*CIICFINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLFTNHQLDFEKSSSEIYYILTXXXXXXXXXXXXGLYCFRPSQISHTAYEFIEDQEQEEKTNYFNNNEKMPLLK 1649
            K K +G+  P   I +   +  FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLF NHQLDFEKSSSEIYYILTAVAFVVLVA +VGLYCFRPSQISHTAYEFIEDQEQEEKTNYFNNNEKMPLLK
Sbjct:  239 KMKDIGKGLPHQNIMMHNMVHSFINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLFKNHQLDFEKSSSEIYYILTAVAFVVLVATIVGLYCFRPSQISHTAYEFIEDQEQEEKTNYFNNNEKMPLLK 421          
BLAST of tyrosinase vs. TrEMBL
Match: gnl|BL_ORD_ID|16448277 (tr|A0A183VMI2|A0A183VMI2_TRIRE Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS1688 PE=4 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 1.602e-60
Identity = 128/342 (37.43%), Postives = 177/342 (51.75%), Query Frame = 2
Query:  146 CGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQ-LADFLITNSSSNLHCDPVNEDNIQLVN-ASIYDTMVYLHFYASRSTMSKELMES--CTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLR---------SIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLG----DIPTEDQESNSTFFKWKPICPQKPNDFDCHICDPSQ---------------------EEPF----LWR-------KYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            CGGP RG C     F    + +  +  K   DDRL WP+RFF+  C+C+ N+ G AC +CK GW G +C    P +IR+N+L M + +   F   + ++K   + ++L+ N S + + DPV  +N+QL+   SIYD  V++H YASRS++  E      C   +++LDFAHKGPAF TWHR YLL +E+ L          S+  E  G   FTLPYWDWT+   C ICTNDL+G    +  T   + NS F +W   CPQ+    DCH+CDP +                       P     LWR         SS  +RLPNQN++        YD+ P
Sbjct:    6 CGGPGRGLCREISAFPEDLDLAQ-LDSKFLLDDRLAWPTRFFEAACACQGNFQGYACHRCKDGWTGVSCRTRKPLRIRRNVLQMTTTEQREFRDRIALAKLTPMTEWLVINISDSSNGDPVGSENLQLIQPPSIYDYFVFIHLYASRSSLVSEETNGPWCNPNEHRLDFAHKGPAFITWHRAYLLFWENELARLGRGNKNDSMGQEDDG-DGFTLPYWDWTSANGCPICTNDLIGAPDLNSTTGSLDPNSVFSQWITYCPQRSGINDCHVCDPGKLISLQLVLICTCKSILWSDNPNHPMAGGPLWRLRSDNGTSISSIFNRLPNQNDVLRTLETPDYDAWP 345          

HSP 2 Score: 62.003 bits (149), Expect = 2.605e-6
Identity = 25/39 (64.10%), Postives = 33/39 (84.62%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRS 1283
            ++NG+W D +TSPNDPLFLLHHTF+DK+FE+W  + R S
Sbjct:  417 YMNGSWFDVSTSPNDPLFLLHHTFVDKLFELWYRKYRPS 455          
BLAST of tyrosinase vs. TrEMBL
Match: gnl|BL_ORD_ID|18254018 (tr|A0A1I8GS15|A0A1I8GS15_9PLAT UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 6.045e-55
Identity = 119/333 (35.74%), Postives = 175/333 (52.55%), Query Frame = 2
Query:  146 CGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELME-------------SCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDI---PTEDQESNSTFF-----KWKPICPQKPNDFDCHICDP----------SQEEPFLWRKYSSTVDRLPNQN-----EIDE----LFSINQYDSEP 1024
            CGGP RG+C   +         D    +L NDDRL+WP RFF F C C+  + G  C        GE+  +  PR +R+N LNM + +  +   +L  SK + + + + N SS+ + DP   D +  VN S+YD +VYLH Y+SRST+ + +M              SC    ++LDFAH+GP F  WHRHYLL+ E L  +IA  +FG  +F+LPYWDWT +  C++CT+DL+G +     +D + +S F       ++  CP++ +   CH CDP          S  EP LWR Y++      N +      I+E    L + ++YDS P
Sbjct: 1301 CGGPQRGAC---VAITTAAVDEDPPREELRNDDRLSWPLRFFAFACQCRPAFWGADC--------GESAPL-RPR-LRKNALNMSAEERLLLRQVLVASKNESSGWAVLNISSSANGDPATPDKVSFVNVSVYDLLVYLHLYSSRSTLLEPVMPDEGAAGEDGGEEGSCPRSRHQLDFAHRGPGFLPWHRHYLLLAEALFANIAKSRFGAEDFSLPYWDWTGKSVCDVCTSDLVGPVGNATADDSDPDSGFVGGDFANFRAFCPRRSSPGACHTCDPAKFQDVGGDGSNAEP-LWRSYNADFFNQDNGDAGGLPSIEETAYLLVNASRYDSPP 1619          

HSP 2 Score: 79.7221 bits (195), Expect = 1.301e-11
Identity = 33/85 (38.82%), Postives = 49/85 (57.65%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKS----STPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYD 1409
            ++ GTW+D   SPNDPLF LHH F+DK+FE+WL  +  +  P K+      P+G      +VPF P +   + F  ++  G+ YD
Sbjct: 1658 YMRGTWLDVALSPNDPLFWLHHCFVDKLFEVWLRSSPDAANPDKNLPVDGAPVGHSRRSNMVPFFPPVTVADRFARSDSLGFGYD 1742          
BLAST of tyrosinase vs. TrEMBL
Match: gnl|BL_ORD_ID|175647901 (tr|A0A3B5K999|A0A3B5K999_TAKRU Tyrosinase OS=Takifugu rubripes OX=31033 GN=TYR (1 of many) PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 9.066e-55
Identity = 105/353 (29.75%), Postives = 168/353 (47.59%), Query Frame = 2
Query:   17 LVITIGIVFASFLPLSDCL-----IPRICSRNVTLSNSTCCPIYND--FVCGGP-FRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDCH--ICDPSQEEPFLWRKYSST-----VDRLPNQNEIDELFSINQYDS 1018
            +++T G  F    PL D +      PR+C+    L    CCP ++     CG    RG C+  + F +  +        L  DDR  WPS F+   C C  N+ G +C  CK G+ G  C       +R+NIL++   +    +S LN++K  + +D+++   ++  + +  N  N      S+YD  V++H+Y SR+     L+    +    +DF H  PAF  WHR YLL +E  +R +     G   F++PYWDW +   C++CT++L+G    +D       S F  WK +C   P D++    +CD  QE P   R+         V+RLP   ++    S+ QYD+
Sbjct:    3 ILLTHGATF----PLMDLVKSHQQFPRLCATAAALRTKECCPPWDGDGSPCGASSGRGFCQ-DVEFTHQPDGPQYPFIGL--DDREKWPSVFYNRTCQCVGNFMGFSCADCKYGYFGAKCNERR-ESLRRNILHLSRSERIRLVSYLNLAKQSVSSDYVV---ATGTYEEMENGSNPMFAEVSVYDVFVWMHYYVSRNA----LLGGPGNVWTNVDFGHWAPAFLPWHRAYLLHWEREIRKLT----GDLTFSIPYWDWRDAQGCDVCTDELIGAQSPQDPSFLSPGSVFSSWKTLC-STPEDYNNRGVLCDARQEGPL--RRNPGNHNRNLVERLPTSADVAFTLSLTQYDT 333          

HSP 2 Score: 89.7373 bits (221), Expect = 9.066e-55
Identity = 49/105 (46.67%), Postives = 63/105 (60.00%), Query Frame = 3
Query: 1122 LGRDSPIKIS*CIICFINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNK 1430
            LG  S + +   I  F+NGT      S NDP+FLLHHTF+D I+E WL R+R   S YP  S  PIG +    +VPFLPL RNR+ F S+ + GY Y N +  N+
Sbjct:  358 LGNSSRMGMHAAIHVFLNGTMSSVQASANDPIFLLHHTFVDSIYEQWLRRHRPPPSQYP-DSDAPIGHNGGYHMVPFLPLHRNRDYFISSKDLGYEYSNLLDANQ 461          
BLAST of tyrosinase vs. TrEMBL
Match: gnl|BL_ORD_ID|175295210 (tr|A0A3B4H598|A0A3B4H598_9CICH Tyrosinase OS=Pundamilia nyererei OX=303518 GN=TYR (1 of many) PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.223e-54
Identity = 104/340 (30.59%), Postives = 165/340 (48.53%), Query Frame = 2
Query:   41 FASFLPLSDCLIPRICSRNVTLSNSTCCPIY--NDFVCGGP-FRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLA-DFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDCH--ICDPSQEEPFL---WRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            F +FL     L PR+C+    L    CCP +  +   CG    RG+CE  ++   H +        L  DDR  WP  F+   C C  N+ G  C  C  G+ GENC       +R+NI ++   +    +S LN++K  ++ D+++   ++  + +  N  N      S+YD  V++H+Y SR+ +        TD    +DF H  PAF  WHR YLL +E  +R +     G  +FT+PYWDW +   C++CT++L+GD  T+D       S F  W  +C Q   D+     +CD ++E P          + V+RLP  ++++   S+  YD+ P
Sbjct:    9 FITFLVNFLVLFPRLCATQEALRTKECCPPWEGDGSACGASSGRGTCE-DVVVSAHPDGPQYPFSGL--DDREKWPLVFYNRTCQCTDNFMGFNCGDCMFGYFGENCNERR-ESLRRNIFHLSRAERLKLVSYLNLAKQTISRDYVV---ATGTYREMQNGTNPMFAQVSVYDVFVWMHYYVSRNALLGGPGNVWTD----VDFGHWAPAFLPWHRAYLLHWEHEIRKLT----GDTSFTIPYWDWRDAQGCDVCTDELMGDRSTQDPSLISPGSVFSSWTVLCSQA-QDYSAKGVLCDATEEGPLRRNPGNHNRNLVERLPTSDDVEFTLSLTNYDTGP 332          

HSP 2 Score: 79.337 bits (194), Expect = 1.223e-54
Identity = 41/106 (38.68%), Postives = 65/106 (61.32%), Query Frame = 3
Query: 1122 LGRDSPIKIS*CIICFINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKL 1433
            LG  S + +   +  ++NG+      S NDP+FLLHH F+D ++E WL R+R   S YP +S+ PIG +++  + P LPL RNR+ F S+ + GY Y + +  ++L
Sbjct:  355 LGNSSRLGMHAALHVYMNGSMSSVQGSANDPIFLLHHAFVDCLYEQWLRRHRPSPSQYP-ESNAPIGHNSEYHMAPILPLHRNRDFFISSKDLGYEYTHLLDASEL 459          
BLAST of tyrosinase vs. Ensembl Cavefish
Match: TYR (tyrosinase-like [Source:NCBI gene;Acc:103041136])

HSP 1 Score: 153.68 bits (387), Expect = 9.334e-55
Identity = 98/347 (28.24%), Postives = 157/347 (45.24%), Query Frame = 2
Query:   14 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIY--NDFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPN-DFDCHICDPSQEEPFL---WRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            M ++ +  +F  FL  +    PR C+    L +  CCP++  +   CG    RG C+  ++ +          G    DDR  WP  F+   C C  NY G  C  C+ G  G NC       +R+ +  + + +    +S LN++K  ++   +  + + L  +  N  N    N S+YD  V++H+Y SR  M    +    +    +DF H  P F  WHR +LL +E  +R +     G + FT+PYWDW +   C +CT+DL+G     +       S F  WK IC + P    +  +CD  +E P L    +   +    LP   E+D    ++QYD+ P
Sbjct:    1 MRLLALISLFIQFLTPTFQQFPRQCATTEALLSKECCPVWEGDGSACGARSGRGVCQDVVVSEEPNGPQYPFEGL---DDRERWPLVFYNRTCRCLQNYMGHNCGDCRFGHFGPNC-AERRESVRKEVFQLSTTERQKLISYLNLAKNTISQDYVIATGTYLEMN--NGTNPLFRNVSVYDLFVWMHYYVSRHAM----LGGTNNVWRGVDFGHWAPGFLPWHRVFLLRWEHEIRKLT----GDFTFTIPYWDWRDAQECEVCTDDLVGSQSRLNPNLISPASVFSSWKVICSRAPEYSLNGVLCDGREEGPLLRNPGKHDRNLASGLPTSAEVDFTLGLSQYDTGP 333          

HSP 2 Score: 80.4925 bits (197), Expect = 9.334e-55
Identity = 40/97 (41.24%), Postives = 60/97 (61.86%), Query Frame = 3
Query: 1122 LGRDSPIKIS*CIICFINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            LG    + +   +  F+NG+      S NDP+FLLHH F+D I+E WL R++  RS YP  ++ PIG +++ ++ PFLPL RN + F S+ + GY Y
Sbjct:  356 LGNSPKLGMHAALHVFMNGSMTSVQGSANDPVFLLHHAFVDSIYEQWLRRHQPERSHYP-TANAPIGHNSEYYMAPFLPLYRNGDYFLSSKDMGYEY 451          
BLAST of tyrosinase vs. Ensembl Cavefish
Match: TYR (tyrosinase-like [Source:NCBI gene;Acc:103041136])

HSP 1 Score: 153.68 bits (387), Expect = 9.334e-55
Identity = 98/347 (28.24%), Postives = 157/347 (45.24%), Query Frame = 2
Query:   14 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIY--NDFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPN-DFDCHICDPSQEEPFL---WRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            M ++ +  +F  FL  +    PR C+    L +  CCP++  +   CG    RG C+  ++ +          G    DDR  WP  F+   C C  NY G  C  C+ G  G NC       +R+ +  + + +    +S LN++K  ++   +  + + L  +  N  N    N S+YD  V++H+Y SR  M    +    +    +DF H  P F  WHR +LL +E  +R +     G + FT+PYWDW +   C +CT+DL+G     +       S F  WK IC + P    +  +CD  +E P L    +   +    LP   E+D    ++QYD+ P
Sbjct:    1 MRLLALISLFIQFLTPTFQQFPRQCATTEALLSKECCPVWEGDGSACGARSGRGVCQDVVVSEEPNGPQYPFEGL---DDRERWPLVFYNRTCRCLQNYMGHNCGDCRFGHFGPNC-AERRESVRKEVFQLSTTERQKLISYLNLAKNTISQDYVIATGTYLEMN--NGTNPLFRNVSVYDLFVWMHYYVSRHAM----LGGTNNVWRGVDFGHWAPGFLPWHRVFLLRWEHEIRKLT----GDFTFTIPYWDWRDAQECEVCTDDLVGSQSRLNPNLISPASVFSSWKVICSRAPEYSLNGVLCDGREEGPLLRNPGKHDRNLASGLPTSAEVDFTLGLSQYDTGP 333          

HSP 2 Score: 80.4925 bits (197), Expect = 9.334e-55
Identity = 40/97 (41.24%), Postives = 60/97 (61.86%), Query Frame = 3
Query: 1122 LGRDSPIKIS*CIICFINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            LG    + +   +  F+NG+      S NDP+FLLHH F+D I+E WL R++  RS YP  ++ PIG +++ ++ PFLPL RN + F S+ + GY Y
Sbjct:  356 LGNSPKLGMHAALHVFMNGSMTSVQGSANDPVFLLHHAFVDSIYEQWLRRHQPERSHYP-TANAPIGHNSEYYMAPFLPLYRNGDYFLSSKDMGYEY 451          
BLAST of tyrosinase vs. Ensembl Cavefish
Match: tyr (tyrosinase-like [Source:NCBI gene;Acc:103040843])

HSP 1 Score: 153.68 bits (387), Expect = 6.847e-40
Identity = 101/332 (30.42%), Postives = 163/332 (49.10%), Query Frame = 2
Query:   74 IPRICSRNVTLSNSTCCPIY--NDFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLEN----DDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNED-NIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDCH--ICDPSQEEPFLWRKYS----STVDRLPNQNEIDELFSINQYDS 1018
             PR C+    L++ +CCP +  +   CG    RG C+  ++       SD+  G        DDR  WP  FF   C C  N+ G  C++CK G+ G  C       +R+NI ++ + +   F+S LN++K  ++   +  +S+    + +N   N    N SIYD  V++H+Y SR T    L+    +    +DFAH+  AF  WHR +LL +E  +R +     G +NFT+PYWDW +   C +CT++L+G   + D       S F  WK IC   P  ++    +CD   E P L+R       + V RLP   +++ +  ++ Y++
Sbjct:   21 FPRFCATPEALTSRSCCPPWPGDGSACGANSGRGFCQDVVV-------SDLPDGPQYPHSGLDDREQWPLAFFNRTCQCAGNFMGYNCNECKFGYYGPTC-AERRESVRRNIFSLSAAEKQTFISYLNLAKNTISPEYVIATSTRAQMNGINGTVNPLFANVSIYDLFVWMHYYVSRDT----LLGGPGNIWQDVDFAHEASAFLPWHRFFLLFWEHEIRKLT----GDFNFTIPYWDWRDARDCQVCTDELMGGQSSLDPNFISPASIFSSWKVIC-TLPEIYNAEETLCDGVGEGP-LFRNPGNHDPNRVRRLPTSADVEFVLGLSDYET 334          

HSP 2 Score: 72.7886 bits (177), Expect = 4.036e-13
Identity = 38/85 (44.71%), Postives = 51/85 (60.00%), Query Frame = 3
Query: 1158 IICFINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            I  F+NG+      S NDP+FLLHH F+D IFE WL +++  RS YP  S+ PIG +   ++VPF+PL +N   F      GY Y
Sbjct:  371 IHVFMNGSMSSVQGSANDPIFLLHHAFIDSIFERWLRKHQPPRSHYP-TSNAPIGHNDGYYMVPFIPLNKNGEYFLGTKALGYEY 454          
BLAST of tyrosinase vs. Ensembl Cavefish
Match: dct (dopachrome tautomerase [Source:NCBI gene;Acc:103044028])

HSP 1 Score: 150.599 bits (379), Expect = 6.482e-39
Identity = 102/340 (30.00%), Postives = 160/340 (47.06%), Query Frame = 2
Query:   35 IVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYNDF---VCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            ++F  +   +    PR+C     + +  CCP        VCG    RG+C V    +  T+           DDR  WP++FF   C C  N+ G  C +CK GW G NC+      +R+NIL++   ++  FL  L+ SK  +    +  +   L     N  N Q+ N SIYD  V+ H+Y+ R T+              +DF+HKGPAF TWHR++LL  E  L+ +     G  NF +PYW++ T    C++CT+ LLG     D       S F  W  +C +  ++++    +C+ ++E P       S+  RLP  N++    ++  +DS P
Sbjct:   14 LIFLGWTHQAGAQFPRVCCTVENILSKRCCPQLGPNPADVCGVLSGRGNCTV---VRVDTKPWGGPYSLRNVDDRERWPTKFFNQTCRCFGNFAGYNCGECKFGWTGPNCDQRKAPAVRKNILSLTPVELQEFLDALDQSKNTIHPDYVIATEHWLGLLGPNGTNPQVSNISIYDFFVWQHYYSVRDTLLGP-----GRPFKAIDFSHKGPAFITWHRYHLLSLERDLQKMT----GNENFAVPYWNFATGGSECDVCTDSLLGGRDPADPTRISPGSRFTSWGVVC-ESLDEYNRLVTLCNGTREGPLRRGVGDSSSPRLPTINDVRSCLNLRDFDSPP 340          

HSP 2 Score: 58.9214 bits (141), Expect = 9.742e-9
Identity = 30/81 (37.04%), Postives = 50/81 (61.73%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLR-NRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     ++ NDP+FL+ H F D IFE WL R +   ++P + + PIG +    +VPF P + N  ++ ++++ GY+Y
Sbjct:  377 FLNGTSGMSHSAANDPIFLVLHAFTDAIFEEWLRRFDGNGSFPDEMA-PIGHNRHYNMVPFFPPVTNEEIYITSSQLGYSY 456          
BLAST of tyrosinase vs. Ensembl Cavefish
Match: tyrp1b (5,6-dihydroxyindole-2-carboxylic acid oxidase-like [Source:NCBI gene;Acc:103027103])

HSP 1 Score: 128.642 bits (322), Expect = 2.400e-31
Identity = 100/348 (28.74%), Postives = 154/348 (44.25%), Query Frame = 2
Query:   26 TIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPI----YNDFVCGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWT-NQITCNICTNDLLGDIPT----EDQESNSTFFKWKPICPQ-KPNDFDCHICDPSQEEPFLWRKYSSTVDR-----LPNQNEIDELFSINQYDSEP 1024
            T+ ++  S L ++    PR C     L + TCCP      ND       RG C      +         +G+   DDR  WP RFF   C C  N+ G  C +CK G  G +C       +R+NIL M S +   F++ L+ +K  +   L+  +         + ++ Q  N +IY+  V+ H+Y+    + K  M    D    +DF+H+GP F TWHR +LL  E  ++ +     G   F LPYW +      C+ICT++L G            +NS F +W+ IC   +  +    IC+ S E   L R     VDR     LP   +I +   ++ +D+ P
Sbjct:    4 TVLLLCGSIL-MTQGQFPRQCVTPEGLRSGTCCPSPTGRTNDECGSSTGRGRCVTVTADERPHGPQYPHSGR---DDRERWPLRFFNRTCQCNENFSGHHCGRCKHGLTGPSCN-QKVNVVRRNILQMSSEEQKAFINALDQAKRTVHPDLVICTRRYEEIFGADGNSPQFENITIYNFFVWTHYYS----VGKTYMGPGQDGFGGVDFSHEGPGFVTWHRFHLLQLERDMQDM----LGDPTFALPYWYFAIGGSECDICTDNLFGARSNFGNGRTISANSVFSQWRVICDHLEEYEKLGTICN-STEGGTLRRHAGGNVDRPMVQKLPEPQDIIDCLDLDTFDTPP 337          

HSP 2 Score: 65.0846 bits (157), Expect = 1.113e-10
Identity = 38/84 (45.24%), Postives = 51/84 (60.71%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRST--YPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANE-FGYAYD 1409
            F+NGT      SPNDP+F+L HTF D IF+ WL R+   T  YP +++ PIG +    +VPF P I N  +F +A E  GY Y+
Sbjct:  374 FLNGTGGQTHLSPNDPIFVLLHTFTDAIFDEWLQRHSPGTVGYP-EANAPIGHNRHFNMVPFWPPITNAEMFVAAPEGLGYNYE 456          
BLAST of tyrosinase vs. Ensembl Sea Lamprey
Match: dct (dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-000508-1])

HSP 1 Score: 71.2478 bits (173), Expect = 2.955e-14
Identity = 43/145 (29.66%), Postives = 72/145 (49.66%), Query Frame = 2
Query:  629 KLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDI-PTEDQ--ESNSTFFKWKPICPQKPNDFD-----CHICDPSQEEPFLWRKYS----STVDRLPNQNEIDELFSINQYDSEP 1024
             +DF+H+GP+F TWHR++LL+ E  ++ +     G  +F LP+WD+ T    C++C +DL G   P E       S F +W+ +C    N  D       +C+ S E P               RLP ++++ +   + ++D EP
Sbjct:    8 AIDFSHQGPSFITWHRYHLLLLERDIQRLT----GDPSFALPFWDFATGSAACDVCVDDLFGGPDPAEPTLLSPVSPFSQWQIVC----NSLDEYNLRVTLCNGSAEGPIRRNPGGDLSHPGAGRLPTRDDVAQCLGVARFDGEP 144          
BLAST of tyrosinase vs. Ensembl Sea Lamprey
Match: dct (dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-000508-1])

HSP 1 Score: 62.3882 bits (150), Expect = 3.005e-11
Identity = 33/84 (39.29%), Postives = 49/84 (58.33%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLR---NRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYD 1409
            F+NGT     +S NDP+F++ HTF+D +F+ W+ R   N    +P +   PIG +    +VPF P + N+ +F  A E GY YD
Sbjct:  149 FLNGTGGASFSSANDPVFVVLHTFVDAVFDEWMRRFRPNVTEAWP-EQLAPIGHNLHYNMVPFFPPVPNQLMFVPAEELGYGYD 231          
BLAST of tyrosinase vs. Ensembl Nematostella
Match: EDO46249 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQY2])

HSP 1 Score: 51.6026 bits (122), Expect = 5.160e-7
Identity = 36/116 (31.03%), Postives = 53/116 (45.69%), Query Frame = 2
Query:  659 FFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCN-ICTNDLLGDIPTEDQES-NSTFFKWKPICPQKPNDFDCHICDPSQEEPFLWRKYSSTV-DRLPNQNEIDELF 997
            FF WHR YLL+FE+LLR I          T+PYWDW+  +    +     L D+ +             K I    P   D        E+P+L R+++    +RLPN +E+ +L 
Sbjct:  120 FFPWHRWYLLLFENLLRKIDC------RVTVPYWDWSRAVGAGRLWRGSYLHDVWSPGPHGIGGNGEGSKRIVTNGPLRKDSWELPAWHEQPWLSREFNDCYKERLPNSHEVRDLL 229          
BLAST of tyrosinase vs. Ensembl Medaka
Match: TYR (tyrosinase [Source:NCBI gene;Acc:101171514])

HSP 1 Score: 154.836 bits (390), Expect = 1.382e-54
Identity = 106/350 (30.29%), Postives = 169/350 (48.29%), Query Frame = 2
Query:   14 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIY--NDFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRK--IRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPN-DFDCHICDPSQEEPFLWRKYS---STVDRLPNQNEIDELFSINQYDSEP 1024
            M ++ + I     +P      PR+C+    L +  CCP +  +   CG    RGSCE  +   +  +        L  DDR  WP  FF   C C  N+ G  C  CK G+ GE C   S R+  +R+N+ ++   +   F+S LN++K  L +D+++   ++  + +  N  N    N +IYD  V++H+Y SR+     L+    +    +DFAH  PAF  WHR YLL +E  +R +     G   F++PYWDW +   C++CT++L+G     D      +S F  WK +C Q    +    +CD  +E P      +   + V R+P   E++   S+  YD+EP
Sbjct:    1 MWLLEVVIFLLCLVPTHQ-QFPRLCATQEALQSRECCPPWQGDGSACGARSGRGSCE-DVSVSDQPDGPQYPFSGL--DDREKWPLVFFNRTCQCTGNFMGFNCADCKFGYFGERC---SERRESLRRNVFHLTRAERNRFVSYLNLAKQTLSSDYVV---ATGTYREMQNGSNPLFANVTIYDVFVWMHYYVSRNA----LLGGPGNVWANVDFAHWAPAFSPWHRVYLLHWEHEIRKLT----GDTTFSIPYWDWRDAQGCDVCTDELMGSRSPLDPNLISPSSVFSSWKVLCSQAEEYNNRGVLCDAREEGPVQRNPGNHDRNLVARIPTSAEVEFTLSLPNYDTEP 332          

HSP 2 Score: 78.9518 bits (193), Expect = 1.382e-54
Identity = 40/108 (37.04%), Postives = 64/108 (59.26%), Query Frame = 3
Query: 1122 LGRDSPIKIS*CIICFINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLFT 1439
            LG  S + +   +  F+NG+      S NDP+FLLHH F+D I+E WL R+    S YP +++ PIG + D ++ PF+PL +N+  F S+ + GY Y + +  N+  +
Sbjct:  355 LGSSSRLGMHAALHVFMNGSMSSVQGSANDPIFLLHHAFVDSIYEQWLRRHNPDPSQYP-QANAPIGHNGDYYMAPFIPLHQNKEYFISSKDLGYEYSHLLDTNQRLS 461          
BLAST of tyrosinase vs. Ensembl Medaka
Match: tyr (tyrosinase [Source:NCBI gene;Acc:100049427])

HSP 1 Score: 153.68 bits (387), Expect = 7.855e-40
Identity = 104/352 (29.55%), Postives = 171/352 (48.58%), Query Frame = 2
Query:    8 LVMLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIY--NDFVCGG-PFRGSC-EVSILFQNHTE---HSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPN-DFDCHICDPSQEEPFLWRKYS---STVDRLPNQNEIDELFSINQYDS 1018
             +M  + +  V   F        PR C+ +  L    CCP++  +   CG    RG C +VS+  + +     HS +       DDR  WP  FF   C C  NY G  C +C+ G+ G NC       +R+NI++M + +   F+S LN++K  +  D++IT  +     +  N ++    + + YD  V++H+Y SR T     +    +    +DFAH+  AF  WHR YLL +E  +R IA    G +NFT+PYWDW +  +C +CT++L+G     +       S F  WK IC Q+   +    +C+ + E P L    +   + V R+P   +++   S+ +Y++
Sbjct:    6 FIMKSLFLSAVLLQFFETCWSQFPRPCANSEGLRTKECCPVWSGDGSPCGALSGRGFCADVSVSDEPNGPQYPHSGI-------DDRERWPLAFFNRTCRCAGNYGGFNCGECRFGYWGSNCAEYR-ESVRRNIMSMSTTEQQKFISYLNLAKNTINPDYVITTGTRAEMGE--NGESPMFSDINTYDLFVWIHYYVSRDT----FLGGPGNVWRDIDFAHESAAFLPWHRVYLLHWEQEIRKIA----GDFNFTIPYWDWRDAQSCEVCTDNLMGGRNALNPNLISPASVFSSWKVICTQQEEYNNQEALCNATAEGPLLRNPGNHDPNRVPRIPTTADVEFTISLPEYET 339          

HSP 2 Score: 73.9442 bits (180), Expect = 1.655e-13
Identity = 38/82 (46.34%), Postives = 51/82 (62.20%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NG+      S NDP+FLLHH F+D IFE WL  ++  RS YP +++ PIG +   ++VPFLPL RN +   S    GY Y
Sbjct:  379 FMNGSMSSVQGSANDPIFLLHHAFIDSIFERWLRTHQPPRSIYP-RTNAPIGHNDGYYMVPFLPLYRNGDYLLSNKALGYEY 459          
BLAST of tyrosinase vs. Ensembl Medaka
Match: tyr (tyrosinase [Source:NCBI gene;Acc:100049427])

HSP 1 Score: 152.91 bits (385), Expect = 1.323e-39
Identity = 104/350 (29.71%), Postives = 170/350 (48.57%), Query Frame = 2
Query:   14 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIY--NDFVCGG-PFRGSC-EVSILFQNHTE---HSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPN-DFDCHICDPSQEEPFLWRKYS---STVDRLPNQNEIDELFSINQYDS 1018
            M  + +  V   F        PR C+ +  L    CCP++  +   CG    RG C +VS+  + +     HS +       DDR  WP  FF   C C  NY G  C +C+ G+ G NC       +R+NI++M + +   F+S LN++K  +  D++IT  +     +  N ++    + + YD  V++H+Y SR T     +    +    +DFAH+  AF  WHR YLL +E  +R IA    G +NFT+PYWDW +  +C +CT++L+G     +       S F  WK IC Q+   +    +C+ + E P L    +   + V R+P   +++   S+ +Y++
Sbjct:    1 MKSLFLSAVLLQFFETCWSQFPRPCANSEGLRTKECCPVWSGDGSPCGALSGRGFCADVSVSDEPNGPQYPHSGI-------DDRERWPLAFFNRTCRCAGNYGGFNCGECRFGYWGSNCAEYR-ESVRRNIMSMSTTEQQKFISYLNLAKNTINPDYVITTGTRAEMGE--NGESPMFSDINTYDLFVWIHYYVSRDT----FLGGPGNVWRDIDFAHESAAFLPWHRVYLLHWEQEIRKIA----GDFNFTIPYWDWRDAQSCEVCTDNLMGGRNALNPNLISPASVFSSWKVICTQQEEYNNQEALCNATAEGPLLRNPGNHDPNRVPRIPTTADVEFTISLPEYET 332          

HSP 2 Score: 73.9442 bits (180), Expect = 1.521e-13
Identity = 38/82 (46.34%), Postives = 51/82 (62.20%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NG+      S NDP+FLLHH F+D IFE WL  ++  RS YP +++ PIG +   ++VPFLPL RN +   S    GY Y
Sbjct:  372 FMNGSMSSVQGSANDPIFLLHHAFIDSIFERWLRTHQPPRSIYP-RTNAPIGHNDGYYMVPFLPLYRNGDYLLSNKALGYEY 452          
BLAST of tyrosinase vs. Ensembl Medaka
Match: tyrp1a (tyrosinase related protein 1 [Source:NCBI gene;Acc:101166337])

HSP 1 Score: 149.058 bits (375), Expect = 2.219e-38
Identity = 105/353 (29.75%), Postives = 169/353 (47.88%), Query Frame = 2
Query:   11 VMLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYNDFV---CG-GPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENC-EVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWT-NQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDC--HICDPSQEEPFLWRKYSST----VDRLPNQNEIDELFSINQYDSEP 1024
            +M+  +  +VFAS L +S    PR C     L +  CCP    FV   CG    RG C VS+                  DDR  WP RFF   C C  N+ G  C +C+ G  G NC + VS   +R++++ + + +   F+S L+ +K  +   L+  +           D+ Q  N +IY+  V+ H+Y    ++SK  + +       +DF+H+GP F TWHR++LL  E  ++ +  +     +F LPYW++     TC+ICT+DL+G   T D     SNS F +W+ +C +   D+D    IC+ ++  P       +     V RLP   ++ +   +N +D+ P
Sbjct:    1 MMMWRSCVLVFASALAVS-AQFPRECVTVEGLRSGQCCPSPPGFVDDPCGFSAGRGQC-VSLTVDARPHGPQYPHDG--RDDRERWPVRFFNRTCQCNGNFSGFNCGRCRHGLTGPNCDQRVS--VVRRDVMRLSADEKRAFVSALDQAKRTVHPDLVIATRHYSDVFGPGGDSPQFENVTIYNYFVWTHYY----SVSKTFLGAGQASFGGVDFSHEGPGFVTWHRYHLLQLERDMQDMLQDP----SFALPYWNFAIGGNTCDICTDDLMGARSTFDSNSLSSNSIFSQWRVVC-ESVEDYDTLGTICNSTETSPIRRNPAGNVNRPMVQRLPEPQDVADCLQVNTFDTPP 338          

HSP 2 Score: 67.0106 bits (162), Expect = 2.596e-11
Identity = 35/88 (39.77%), Postives = 53/88 (60.23%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSA-NEFGYAYDNNIVGN 1427
            F+NGT      SPNDP+F+L HT+ D IF+ WL R+  + YP +++ PIG +    +VPF P + N  +F +A +  GY+Y+    G 
Sbjct:  375 FLNGTGGQTHLSPNDPIFVLLHTYTDAIFDEWLRRHGPAAYPDENA-PIGHNRGYNMVPFWPPVTNSEMFVTAPDNLGYSYEAEWPGQ 461          
BLAST of tyrosinase vs. Ensembl Medaka
Match: dct (dopachrome tautomerase [Source:NCBI gene;Acc:101166914])

HSP 1 Score: 147.132 bits (370), Expect = 8.316e-38
Identity = 98/347 (28.24%), Postives = 167/347 (48.13%), Query Frame = 2
Query:   17 LVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYNDF---VCGG-PFRGSCEVSILFQNHTEHSDVITGKLEN-DDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            ++I   ++F   L   +   PR+C     + +  CCP        +CG    RGSC  ++   N          +L N DDR  WP++FF   C C  N+ G  C +CK GW G NC+      +R+NI ++   ++  FL++L+++K  +    +  +   L     N  + Q  N SIYD  V+ H+Y+ R T+              +DF+HKGPAF TWHR++LL  E  L+ ++ ++    NF +PYW++ T Q  C++CT+ +LG    ++     + S F +W  +C    +D++    +C+ + E          +   LP+ N++     +  +DS P
Sbjct:    1 MMIAFTLLF--LLVPVEAQFPRVCCTVEGIQSKRCCPALGSDPADICGSLSGRGSC-TAVRVDNKPWGGPY---RLRNVDDRERWPTKFFNQTCRCTGNFAGFDCGQCKFGWTGPNCDQKKAPVLRKNIHSLTQEELNEFLNVLDLAKNTIHPDYVIATQHWLGLLGPNGTDPQFANISIYDFFVWQHYYSVRDTLLGP-----GRPFKAIDFSHKGPAFITWHRYHLLSLERELQRLSGDE----NFAIPYWNFATGQSECDVCTDSMLGGRNPDNPSLISNQSRFSRWGVVC-NSLDDYNRLVTLCNGTNEGLIQRGIMERSNGTLPSMNDVRSCLGLRDFDSPP 331          

HSP 2 Score: 57.7658 bits (138), Expect = 1.905e-8
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLR--NRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
             +NGT     ++ NDP+FL+ H F D IF+ W+ R     +T+P + + PIG + D  +VPF P I N  ++  + + GY+Y
Sbjct:  368 MLNGTSALSHSAANDPIFLVLHAFTDAIFDEWMRRFVPSNATFPDEMA-PIGHNRDYNMVPFFPPITNEEIYIPSEQLGYSY 448          
BLAST of tyrosinase vs. Planmine SMEST
Match: SMESG000065741.1 (SMESG000065741.1)

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 388/398 (97.49%), Postives = 391/398 (98.24%), Query Frame = 2
Query:   14 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYNDFVCGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQESNSTFFKWKPICPQKPNDFDCHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEPXXXXXXXXXXXXXXAEGYYRVHPNSDDMKMKDIGKGLPHQNIMMHNMFYQWNLDGFHNESQ 1207
            MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYNDFVCGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQESNSTFFKWKPICPQKPNDFDCHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEPFNSSSFSRKSFRNFAEGYYRVHPNSDDMKMKDIGKGLPHQNIMMHNM  + NL  F ++ Q
Sbjct:    1 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYNDFVCGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQESNSTFFKWKPICPQKPNDFDCHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEPFNSSSFSRKSFRNFAEGYYRVHPNSDDMKMKDIGKGLPHQNIMMHNMVKE-NLSFFLSKIQ 397          

HSP 2 Score: 309.301 bits (791), Expect = 9.010e-98
Identity = 161/161 (100.00%), Postives = 161/161 (100.00%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLFTNHQLDFEKSSSEIYYILTXXXXXXXXXXXXGLYCFRPSQISHTAYEFIEDQEQEEKTNYFNNNEKMPLLK 1649
            FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLFTNHQLDFEKSSSEIYYILTAVAFVVLVAIVVGLYCFRPSQISHTAYEFIEDQEQEEKTNYFNNNEKMPLLK
Sbjct:  404 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLFTNHQLDFEKSSSEIYYILTAVAFVVLVAIVVGLYCFRPSQISHTAYEFIEDQEQEEKTNYFNNNEKMPLLK 564          
BLAST of tyrosinase vs. Planmine SMEST
Match: SMESG000049779.1 (SMESG000049779.1)

HSP 1 Score: 185.267 bits (469), Expect = 8.636e-52
Identity = 109/324 (33.64%), Postives = 167/324 (51.54%), Query Frame = 2
Query:   11 VMLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYNDF--VCGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQES-------NSTFFKWKPICPQKPNDFDCHICDPSQEEPFLWRKYSST 955
            ++L+ T+G +  + +     L+P++C  NV+ +  TCCPI + F   CGG  RG C+          H + I    +NDDR++WP+RFFK +C+C+ N+ GIAC+ C  GW+G NC+     KIR+NI +    +   FL IL IS    ++FL+   SS  H DP+   N     A+  + + ++H YASRST+     +        LD+ H   +F TWHR  +L +E  L  IA+++F + +F +PYWDW +   C +C N  +G     D ++        S F  W   C     +  C  C   +  P L R+Y ST
Sbjct:    5 ILLIFTVGSITINSI---SGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGVGRGVCDKVY------THWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCD-RRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPL--VNPVFFLATFQEFIAFIHRYASRSTLFAN--KQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNRRYIST 314          

HSP 2 Score: 54.6842 bits (130), Expect = 1.307e-7
Identity = 29/97 (29.90%), Postives = 48/97 (49.48%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIW--LLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLFTNHQL 1451
             + G+    +T+ NDPLF+LHH+ +D+I E W  +   + +  P     P G   +  +V  LP +++  +FT     G  YDN   G K F   ++
Sbjct:  374 MVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEP-GNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKKGFECSKM 469          
BLAST of tyrosinase vs. Planmine SMEST
Match: SMESG000080469.1 (SMESG000080469.1)

HSP 1 Score: 181.8 bits (460), Expect = 1.740e-50
Identity = 110/342 (32.16%), Postives = 183/342 (53.51%), Query Frame = 2
Query:   17 LVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCP--IYNDFVCGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQES-----NSTFFKWKPICPQKPNDFD---CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQY 1012
            L+     + + F  +S CLIP +C  N T +   CCP    N  VCGG  RG C     F       + I      DDR+ WP RFF  +C C+ NY GIAC++C  GW+G +C+  +   IR+NI ++   D +I  ++++ S Y  +++ +     N + DP+ +   + + ASI   +V++H + SR+TM ++ ++        L+F H+   F TWHR+Y++ +E LL++IA ++FG  NF LPYWDWT+Q +C+ICT+D+ G      ++       S F  W   C Q+P++ D   C+ C  +     + R+++S     P   +++ + S  Q+
Sbjct:    5 LIFVTFSILSVFFNVSLCLIPTVCVYNAT-TTGVCCPRSKQNHEVCGGHERGICGHIDYFH------EKIPEIFRYDDRVQWPKRFFHSVCHCRDNYFGIACNECWYGWEGHHCDKRT-MIIRRNIKHLSKRDKYITKTVIDRSLYVPSEYSVYVDQLNANNDPLTKPT-KWIPASIQYMIVFVHRFGSRATMFEDYLD--CQNFGILNFNHEAIGFATWHRYYMMFWERLLQNIARKEFGIKNFALPYWDWTDQTSCDICTDDMAGAPGFRGKDGVRISLRSPFGNWTEFC-QEPDNADESPCYGCHVTGNYGKITREWNSF--EFPTSADVEFVLSKPQF 332          

HSP 2 Score: 62.003 bits (149), Expect = 6.384e-10
Identity = 34/89 (38.20%), Postives = 52/89 (58.43%), Query Frame = 3
Query: 1170 INGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRS--TYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNK 1430
            I+G+     T+P+DPLF+ HHT  D+IFE +L R +     YP  ++ P G     ++   LPLI + +LF  + + GY YDN I G++
Sbjct:  375 IDGSMCCSGTAPSDPLFIFHHTQTDRIFEEYLNRYKPKLDEYPETNARP-GHSRHSYLPAILPLITHAHLFKPSKKLGYKYDNFIFGSR 462          
BLAST of tyrosinase vs. Planmine SMEST
Match: SMESG000002576.1 (SMESG000002576.1)

HSP 1 Score: 167.162 bits (422), Expect = 6.197e-45
Identity = 94/325 (28.92%), Postives = 168/325 (51.69%), Query Frame = 2
Query:   65 DCLIPRICSRNVT-LSNSTCCPIYNDF--VCGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKL-DFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDI-PT----EDQESNSTFFKWKPICPQKPNDFDCHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQY 1012
            + LIP  C +N+T   ++ CCPI   F   CG PFRG C     F   T        ++END R  WP + FK+ C C  N+ G+ C  C  G+ G NC +     +R+N++N+   ++  F +++N+S+++ + +++ + +S       N++  +++ A+IY+ +V++H +A+R  +  +++ +     ++  D  H GP F TWHRH++L +E L   IA E F   +F  PYWDWT +  C++CT+D++G   P+    +     S F  W  IC     +  C  CD          ++  + ++ P   E++ +  +  Y
Sbjct:   63 NALIPNQCEQNLTSYGSNVCCPIPEGFTNACGFPFRGKCS---FFPLETHSILAPLPEIENDIRFEWPFKLFKYFCRCYKNFSGVDCGYCGFGFAGINC-LKKRVIVRKNVMNLNQTELKYFRTVVNLSRFKRSSYMVLSETSG------NKNLQKMLPATIYEVLVFIHQFAARPILEDDILCATRKTFSEYTDHNHNGPGFLTWHRHFMLEWERLSGLIAKEYFDIDDFAFPYWDWTGKSHCDVCTDDIVGGFGPSIGNFKMLSPKSLFSNWTEICSHDDQN-PCKPCDILNSSKIKITRFWMS-NKFPTTFEVNRVLMLPDY 375          

HSP 2 Score: 63.929 bits (154), Expect = 1.565e-10
Identity = 35/82 (42.68%), Postives = 51/82 (62.20%), Query Frame = 3
Query: 1176 GTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDF---IVPFLPLIRNRNLFTSANEFGYAYDN 1412
            GT+    +S NDPLF+LHHT +D+IFE WL RN  + Y  K    + QH   +   +V F+P +R+ ++F  +N FGY YD+
Sbjct:  430 GTFYSTRSSVNDPLFILHHTQIDRIFEFWLRRNEGNLY-FKFPKAVIQHGHCYFCHMVGFIPPLRHIDVFKPSNNFGYDYDS 510          
BLAST of tyrosinase vs. Planmine SMEST
Match: SMESG000009335.1 (SMESG000009335.1)

HSP 1 Score: 149.058 bits (375), Expect = 5.816e-39
Identity = 108/355 (30.42%), Postives = 174/355 (49.01%), Query Frame = 2
Query:   14 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPI-YNDF-VCGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKI--RQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLL---GDIPTEDQ---ESNSTFFKWKPICPQKPNDFD---------CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSE 1021
            M +  I I+  S   + +  IP+ C +N TL   TCCP   ND   CG P +G C    + ++ +   +        D R+ WP  +FK LC CK N+ G +C  C  G++GENC   S + +  R+NI++  S +  I + +L   + +  D+LI   +          ++++L N  +++ +V +HF A+R  +     E C D     +  HK   F TWHRH++L++E   R IA + F   +F+ PYWDW ++ +C ICT+DL+   G+I  +D     + S F KWK  C    N FD         C  C  S++   L R++    D  P ++ +    S  ++ SE
Sbjct:    1 MKIFLIEILIIS---ICNSQIPKECGQNFTLKTGTCCPKGENDLNPCGFPSKGECLTVTINESPSGWDNY------KDSRMLWPKYWFKKLCRCKKNFYGPSCTDCFYGYKGENC---SEKYLITRRNIMSYNSREKEILVDVLVAMRQEYLDYLIVEEAYR-----NKPESLRLGN--VHEMIVNIHFLAARFLIISNRRE-CKDSP-VFNLNHKNIGFLTWHRHFMLLWEKWARKIAKKLFNIEDFSFPYWDWVDKTSCEICTDDLIGSEGEISDDDSFYLNTKSKFNKWKVYC----NLFDPKNGILENSCSPCSSSKQSQRLKRRF--ITDTFPTKDHVRFALSRKRFGSE 328          

HSP 2 Score: 51.2174 bits (121), Expect = 1.755e-6
Identity = 29/87 (33.33%), Postives = 44/87 (50.57%), Query Frame = 3
Query: 1176 GTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLR--NRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNK 1430
            G++ + TTS NDPLF+ HH  +D+IF+ W  +  +    YP  S    G       V F+P I +   F  +   GY YD+ + G +
Sbjct:  368 GSFAESTTSTNDPLFIFHHIQIDRIFQAWWEKTSDEDKVYPNISHP--GHCFKCNQVGFIPAITHERFFVDSENLGYQYDSFLFGKE 452          
The following BLAST results are available for this feature:
BLAST of tyrosinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCT1.319e-3931.85dopachrome tautomerase [Source:HGNC Symbol;Acc:HGN... [more]
DCT1.992e-3931.85dopachrome tautomerase [Source:HGNC Symbol;Acc:HGN... [more]
TYRP15.965e-3527.40tyrosinase related protein 1 [Source:HGNC Symbol;A... [more]
TYR1.700e-3330.09tyrosinase [Source:HGNC Symbol;Acc:HGNC:12442][more]
DCT6.896e-1432.61dopachrome tautomerase [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of tyrosinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tyrosinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tyrosinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyr1.015e-4130.75tyrosinase [Source:ZFIN;Acc:ZDB-GENE-991026-3][more]
tyrp1a7.052e-4032.44tyrosinase-related protein 1a [Source:ZFIN;Acc:ZDB... [more]
dct7.120e-3630.31dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
tyrp1b6.605e-3529.09tyrosinase-related protein 1b [Source:ZFIN;Acc:ZDB... [more]
dct6.439e-2730.80dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of tyrosinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyr4.932e-4432.06tyrosinase [Source:NCBI gene;Acc:100125152][more]
dct1.045e-3929.63dopachrome tautomerase [Source:NCBI gene;Acc:54991... [more]
dct1.080e-3929.63dopachrome tautomerase [Source:NCBI gene;Acc:54991... [more]
ENSXETT00000011816.18.160e-3929.69pep primary_assembly:Xenopus_tropicalis_v9.1:KV462... [more]
ENSXETT00000000812.11.265e-3827.54pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of tyrosinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tyr4.252e-3931.12tyrosinase [Source:MGI Symbol;Acc:MGI:98880][more]
Dct3.748e-3830.49dopachrome tautomerase [Source:MGI Symbol;Acc:MGI:... [more]
Tyrp12.417e-3328.53tyrosinase-related protein 1 [Source:MGI Symbol;Ac... [more]
Tyrp12.417e-3328.53tyrosinase-related protein 1 [Source:MGI Symbol;Ac... [more]
Tyrp13.135e-2231.19tyrosinase-related protein 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of tyrosinase vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P55024|TYRO_CHICK3.017e-4131.79Tyrosinase OS=Gallus gallus OX=9031 GN=TYR PE=2 SV... [more]
sp|Q4R1H1|TYRP2_PIG3.594e-4130.43L-dopachrome tautomerase OS=Sus scrofa OX=9823 GN=... [more]
sp|Q08410|TYRO_COTJA2.225e-3934.07Tyrosinase (Fragment) OS=Coturnix japonica OX=9393... [more]
sp|O93505|TYRP2_CHICK2.839e-3931.34L-dopachrome tautomerase OS=Gallus gallus OX=9031 ... [more]
sp|P40126|TYRP2_HUMAN6.334e-3931.85L-dopachrome tautomerase OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of tyrosinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203459731.513e-17096.17tr|H9B8J5|H9B8J5_SCHMD Tyrosinase OS=Schmidtea med... [more]
gnl|BL_ORD_ID|164482771.602e-6037.43tr|A0A183VMI2|A0A183VMI2_TRIRE Uncharacterized pro... [more]
gnl|BL_ORD_ID|182540186.045e-5535.74tr|A0A1I8GS15|A0A1I8GS15_9PLAT UBIQUITIN_CONJUGAT_... [more]
gnl|BL_ORD_ID|1756479019.066e-5529.75tr|A0A3B5K999|A0A3B5K999_TAKRU Tyrosinase OS=Takif... [more]
gnl|BL_ORD_ID|1752952101.223e-5430.59tr|A0A3B4H598|A0A3B4H598_9CICH Tyrosinase OS=Punda... [more]
back to top
BLAST of tyrosinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TYR9.334e-5528.24tyrosinase-like [Source:NCBI gene;Acc:103041136][more]
TYR9.334e-5528.24tyrosinase-like [Source:NCBI gene;Acc:103041136][more]
tyr6.847e-4030.42tyrosinase-like [Source:NCBI gene;Acc:103040843][more]
dct6.482e-3930.00dopachrome tautomerase [Source:NCBI gene;Acc:10304... [more]
tyrp1b2.400e-3128.745,6-dihydroxyindole-2-carboxylic acid oxidase-like... [more]
back to top
BLAST of tyrosinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dct2.955e-1429.66dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
dct3.005e-1139.29dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of tyrosinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tyrosinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO462495.160e-731.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tyrosinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TYR1.382e-5430.29tyrosinase [Source:NCBI gene;Acc:101171514][more]
tyr7.855e-4029.55tyrosinase [Source:NCBI gene;Acc:100049427][more]
tyr1.323e-3929.71tyrosinase [Source:NCBI gene;Acc:100049427][more]
tyrp1a2.219e-3829.75tyrosinase related protein 1 [Source:NCBI gene;Acc... [more]
dct8.316e-3828.24dopachrome tautomerase [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of tyrosinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065741.19.010e-9897.49SMESG000065741.1[more]
SMESG000049779.18.636e-5233.64SMESG000049779.1[more]
SMESG000080469.11.740e-5032.16SMESG000080469.1[more]
SMESG000002576.16.197e-4528.92SMESG000002576.1[more]
SMESG000009335.15.816e-3930.42SMESG000009335.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006796
GenBankAFC87780.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006796 ID=SMED30006796|Name=tyrosinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1755bp
TGTCAGTTTAGTCATGCTCGTAATCACAATAGGCATAGTCTTTGCATCTT
TCTTACCTTTGAGTGACTGCCTAATCCCAAGGATTTGCAGTAGGAATGTC
ACTCTTTCTAATTCAACATGTTGTCCAATTTATAATGATTTTGTTTGCGG
TGGTCCTTTTCGTGGATCTTGTGAAGTCTCCATTCTTTTTCAAAATCACA
CTGAGCACTCGGATGTTATCACCGGAAAATTGGAAAATGACGACAGACTC
AACTGGCCATCAAGATTTTTTAAATTTCTTTGCAGTTGCAAGTCAAACTA
TGATGGAATAGCCTGTGACAAGTGTAAATCAGGGTGGCAAGGGGAAAACT
GTGAGGTGGTCTCCCCGAGAAAGATTAGACAAAATATTCTTAACATGAGA
TCATACGATGTTTTTATTTTTTTATCGATACTGAACATCAGCAAATATCA
GTTGGCCGATTTCCTGATCACAAATTCGTCCTCAAACCTTCACTGTGACC
CTGTCAATGAAGACAACATTCAATTGGTCAATGCTTCCATTTATGATACA
ATGGTTTACTTACATTTCTATGCGTCCAGGAGTACAATGTCTAAAGAACT
TATGGAATCCTGCACAGACAAGGATAACAAATTAGACTTCGCTCATAAAG
GTCCAGCTTTTTTTACATGGCACCGACATTATTTACTGATGTTTGAAGAC
TTATTAAGGAGTATTGCAGTCGAACAATTTGGATATTATAATTTCACATT
ACCATATTGGGACTGGACGAATCAAATAACTTGTAATATATGTACAAATG
ACTTACTTGGCGATATTCCCACTGAAGATCAAGAATCTAACAGCACATTT
TTTAAATGGAAACCGATTTGCCCTCAGAAACCTAACGATTTTGATTGTCA
TATTTGCGATCCAAGCCAGGAAGAACCTTTTTTATGGAGAAAATACTCAT
CAACGGTAGACAGACTTCCTAATCAGAACGAAATTGATGAGTTATTCTCA
ATCAACCAATATGATTCGGAGCCCTTCAATTCCAGCTCATTTAGTAGGAA
AAGCTTTCGGAATTTTGCAGAGGGATATTATCGAGTTCATCCAAACTCAG
ATGATATGAAAATGAAAGACATTGGGAAGGGACTCCCCCATCAAAATATC
ATGATGCATAATATGTTTTATCAATGGAACTTGGATGGATTTCACAACGA
GTCCCAATGATCCATTATTTCTACTACATCATACGTTTATGGACAAAATC
TTTGAAATTTGGCTATTAAGAAATAGACGATCTACATACCCTGGGAAATC
TTCAACACCAATCGGGCAGCATGCTGACGATTTTATTGTGCCTTTCCTTC
CACTAATCAGAAACAGGAATTTGTTTACTTCAGCAAATGAATTTGGCTAC
GCCTACGATAACAATATTGTTGGAAATAAATTGTTCACAAATCATCAACT
AGATTTCGAAAAGAGCTCATCGGAAATTTACTACATCCTAACGGCAGTTG
CCTTTGTAGTACTAGTTGCGATCGTCGTCGGATTGTACTGCTTCAGACCC
AGTCAAATCAGTCACACGGCTTATGAATTCATTGAAGACCAGGAGCAGGA
GGAAAAGACAAATTACTTTAACAACAATGAAAAAATGCCTCTACTGAAAT
GACAAGCCATTTCTGATGACTATTATAATATTGTCACCTTAAATTTTCTT
TGAAACAACTTTATTATTGACAAATTTTGAAGAATCCTTTTAAGCAAAAT
AAAGT
back to top

protein sequence of SMED30006796-orf-1

>SMED30006796-orf-1 ID=SMED30006796-orf-1|Name=SMED30006796-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDF
IVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLFTNHQLDFEKSSSEIYY
ILTAVAFVVLVAIVVGLYCFRPSQISHTAYEFIEDQEQEEKTNYFNNNEK
MPLLK*
back to top

protein sequence of SMED30006796-orf-2

>SMED30006796-orf-2 ID=SMED30006796-orf-2|Name=SMED30006796-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=403bp
VSLVMLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYNDFVCG
GPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNY
DGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQ
LADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKEL
MESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTL
PYWDWTNQITCNICTNDLLGDIPTEDQESNSTFFKWKPICPQKPNDFDCH
ICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEPFNSSSFSRK
SFRNFAEGYYRVHPNSDDMKMKDIGKGLPHQNIMMHNMFYQWNLDGFHNE
SQ*
back to top
Aliases
The feature 'tyrosinase' has the following synonyms
Synonym
tyrosinase
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000036eye
PLANA:0000075optic cup
PLANA:0000124visual system
PLANA:0000031pigment cup cell
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000007Stage 7
Vocabulary: INTERPRO
TermDefinition
IPR002227Tyrosinase_Cu-bd
IPR008922Unchr_di-copper_centre
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002227Tyrosinase copper-binding domainPRINTSPR00092TYROSINASEcoord: 215..232
score: 51.25
coord: 250..255
score: 77.21
IPR002227Tyrosinase copper-binding domainPFAMPF00264Tyrosinasecoord: 179..361
e-value: 7.0E-18
score: 65.7
IPR002227Tyrosinase copper-binding domainPROSITEPS00497TYROSINASE_1coord: 215..232
IPR008922Uncharacterised domain, di-copper centreGENE3DG3DSA:1.10.1280.10coord: 168..392
e-value: 1.7E-30
score: 108.9
IPR008922Uncharacterised domain, di-copper centreSUPERFAMILYSSF48056Di-copper centre-containing domaincoord: 81..317
NoneNo IPR availablePANTHERPTHR11474TYROSINASE FAMILY MEMBERcoord: 17..363
NoneNo IPR availablePANTHERPTHR11474:SF93TYROSINASEcoord: 17..363
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 94..118
e-value: 0.00610704
score: 32.7114
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..15
score: 0.843