tyrosinase

Overview
Nametyrosinase (AFC87780.1)
Smed IDSMED30006796
Uniprot Best hitTyrosinase OS=Gallus gallus GN=TYR PE=2 SV=1 (E=5.41788e-41)
Length (bp)1755
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tyrosinase (SMED30006796) t-SNE clustered cells

Violin plots show distribution of expression levels for tyrosinase (SMED30006796) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

tyrosinase ( tyrosinase ) is expressed during Stage 7 and Stage 8 in the visual system, eye, pigment cup cell and optic cup

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of tyrosinase vs. Ensembl Human
Match: DCT (dopachrome tautomerase [Source:HGNC Symbol;Acc:HGNC:2709])

HSP 1 Score: 153.295 bits (386), Expect = 1.657e-39
Identity = 107/336 (31.85%), Postives = 160/336 (47.62%), Query Frame = 2
Query:   53 LPLSDCLIPRICSRNVTLSNSTCCP---IYNDFVCGGP-FRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFE-DLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            LP +    PR+C    +L N  CCP     +  VCG    RG C              ++  +   DDR  WP +FF   C C  N+ G  C  CK GW G NCE   P  IRQNI ++   +   FL  L+++K ++  D++IT         P N    Q  N S+YD  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL  E DL R I  E     +F LPYW++ T +  C++CT+ L G    +D      NS F  W+ +C    +D++    +C+ + E      +      +LP   +I +  S+ ++D+ P
Sbjct:   18 LPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQ---DDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGP-NGTQPQFANCSVYDFFVWLHYYSVRDTLLGP-----GRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNE-----SFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVC-DSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPP 338          

HSP 2 Score: 55.0694 bits (131), Expect = 2.323e-7
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLR-NRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     ++ NDP+F++ H+F D IF+ W+ R N  +    +   PIG +    +VPF P + N  LF ++++ GY+Y
Sbjct:  375 FLNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAWPQELAPIGHNRMYNMVPFFPPVTNEELFLTSDQLGYSY 455          
BLAST of tyrosinase vs. Ensembl Human
Match: DCT (dopachrome tautomerase [Source:HGNC Symbol;Acc:HGNC:2709])

HSP 1 Score: 153.295 bits (386), Expect = 2.110e-39
Identity = 107/336 (31.85%), Postives = 160/336 (47.62%), Query Frame = 2
Query:   53 LPLSDCLIPRICSRNVTLSNSTCCP---IYNDFVCGGP-FRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFE-DLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            LP +    PR+C    +L N  CCP     +  VCG    RG C              ++  +   DDR  WP +FF   C C  N+ G  C  CK GW G NCE   P  IRQNI ++   +   FL  L+++K ++  D++IT         P N    Q  N S+YD  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL  E DL R I  E     +F LPYW++ T +  C++CT+ L G    +D      NS F  W+ +C    +D++    +C+ + E      +      +LP   +I +  S+ ++D+ P
Sbjct:   18 LPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQ---DDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGP-NGTQPQFANCSVYDFFVWLHYYSVRDTLLGP-----GRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNE-----SFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVC-DSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPP 338          
BLAST of tyrosinase vs. Ensembl Human
Match: TYRP1 (tyrosinase related protein 1 [Source:HGNC Symbol;Acc:HGNC:12450])

HSP 1 Score: 140.198 bits (352), Expect = 4.570e-35
Identity = 97/354 (27.40%), Postives = 165/354 (46.61%), Query Frame = 2
Query:   20 VITIGIVFASFLPL--SDCLIPRICSRNVTLSNSTCCPIYNDFV------CGGP-FRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDC--HICDPSQEEPFLWRKYSST----VDRLPNQNEIDELFSINQYDSEP 1024
            ++++G +F   L    +    PR C+    L +  CCP  +         CG    RG CE   +  +   HS         DDR  WP RFF   C C  N+ G  C  C+ GW+G  C+      +R+N+L++   +   F+  L+++K       +  +  +      + +  Q  N SIY+  V+ H+Y+ + T      ES      ++DF+H+GPAF TWHR++LL  E  ++ +  E     +F+LPYW++ T +  C+ICT+DL+G     D      NS F +W+ +C     D+D    +C+ +++ P       +     V RLP   ++ +   +  +D+ P
Sbjct:    6 LLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEA--VTADSRPHSPQYPHD-GRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRV-LIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESF----GEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEP----SFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVC-DSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPP 346          

HSP 2 Score: 61.2326 bits (147), Expect = 2.785e-9
Identity = 35/84 (41.67%), Postives = 51/84 (60.71%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRR--STYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSA-NEFGYAYD 1409
            F+NGT      SPNDP+F+L HTF D +F+ WL R     ST+P +++ PIG +    +VPF P + N  +F +A +  GY Y+
Sbjct:  383 FLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENA-PIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYE 465          
BLAST of tyrosinase vs. Ensembl Human
Match: TYR (tyrosinase [Source:HGNC Symbol;Acc:HGNC:12442])

HSP 1 Score: 135.961 bits (341), Expect = 1.303e-33
Identity = 105/349 (30.09%), Postives = 175/349 (50.14%), Query Frame = 2
Query:   14 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYND--FVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRK--IRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDI-PTE-DQESNSTFF-KWKPICPQKPNDFDCH--ICDPSQEEPFLWRKYS---STVDRLPNQNEIDELFSINQYDS 1018
            ML+  +  +  SF   S    PR C  +  L    CCP ++     CG    RGSC+  +L           TG    DDR +WPS F+   C C  N+ G  C  CK G+ G NC   + R+  +R+NI ++ + +   F + L ++K+ + +D++I   +   +    N       + +IYD  V++H+Y S   M   L  S   +D  +DFAH+ PAF  WHR +LL +E  ++ +  ++    NFT+PYWDW +   C+ICT++ +G   PT  +  S ++FF  W+ +C  +  +++ H  +C+ + E P      +   S   RLP+  +++   S+ QY+S
Sbjct:    1 MLLAVLYCLLWSF-QTSAGHFPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILLSNAPLGPQFPFTGV---DDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNC---TERRLLVRRNIFDLSAPEKDKFFAYLTLAKHTISSDYVIPIGT---YGQMKNGSTPMFNDINIYDLFVWMHYYVS---MDALLGGSEIWRD--IDFAHEAPAFLPWHRLFLLRWEQEIQKLTGDE----NFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVC-SRLEEYNSHQSLCNGTPEGPLRRNPGNHDKSRTPRLPSSADVEFCLSLTQYES 329          

HSP 2 Score: 81.2629 bits (199), Expect = 1.411e-15
Identity = 38/82 (46.34%), Postives = 55/82 (67.07%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            ++NGT      S NDP+FLLHH F+D IFE WL R+R  +  YP +++ PIG + + ++VPF+PL RN + F S+ + GY Y
Sbjct:  369 YMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLQEVYP-EANAPIGHNRESYMVPFIPLYRNGDFFISSKDLGYDY 449          
BLAST of tyrosinase vs. Ensembl Human
Match: DCT (dopachrome tautomerase [Source:HGNC Symbol;Acc:HGNC:2709])

HSP 1 Score: 73.1738 bits (178), Expect = 8.627e-14
Identity = 45/138 (32.61%), Postives = 74/138 (53.62%), Query Frame = 2
Query:  632 LDFAHKGPAFFTWHRHYLLMFE-DLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            +DF+H+GPAF TWHR++LL  E DL R I  E     +F LPYW++ T +  C++CT+ L G    +D      NS F  W+ +C    +D++    +C+ + E      +      +LP   +I +  S+ ++D+ P
Sbjct:   17 IDFSHQGPAFVTWHRYHLLCLERDLQRLIGNE-----SFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVC-DSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPP 148          
BLAST of tyrosinase vs. Ensembl Zebrafish
Match: tyr (tyrosinase [Source:ZFIN;Acc:ZDB-GENE-991026-3])

HSP 1 Score: 159.073 bits (401), Expect = 1.432e-41
Identity = 103/335 (30.75%), Postives = 160/335 (47.76%), Query Frame = 2
Query:   77 PRICSRNVTLSNSTCCPIY--NDFVCG-GPFRGSCEVSILFQNHTEHSDVITGKLEN---------DDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLA-DFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDCH--ICDPSQEEPFLWRKYSS---TVDRLPNQNEIDELFSINQYDS 1018
            PR+C+    L +  CCP++  +  VCG    RG C+            DV+   L N         DDR  WP  F+   C C  NY G  C +CK G+ G NC       +R+NI  + + +   F+S LN++K  ++ D++I   +   +    N       N S+YD  V++H+Y SR      L+    +    +DFAH+  AF  WHR YLL +E  +R +     G +NFT+PYWDW +   C +CT++L+G   + ++     +S F  WK IC Q P  ++    +CD S E P L          V RLP   +++ +  +  Y++
Sbjct:   21 PRVCTSPEVLQSKRCCPVWPGDGSVCGVQSGRGFCQ------------DVLVSDLPNGPQYPHSGVDDRERWPLVFYNQTCQCAGNYMGFDCGECKFGFFGANC-AERRESVRRNIFQLSTTERQRFISYLNLAKTTISPDYMIVTGT---YAQMNNGSTPMFANISVYDLFVWMHYYVSRDA----LLGGPGNVWADIDFAHESAAFLPWHRVYLLFWEHEIRKLT----GDFNFTIPYWDWRDAQDCQVCTDELMGARSSLNRSLISPSSVFSSWKVICSQ-PESYNLREALCDGSPEGPLLRNPGDHDRIRVPRLPTSADVESVLRLTDYET 330          

HSP 2 Score: 75.485 bits (184), Expect = 5.334e-14
Identity = 37/82 (45.12%), Postives = 52/82 (63.41%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NG+      S NDP+F++HH F+D IFE WL R++  R+ YP  ++ PIG +   F+VPF+PL RN + F S    GY Y
Sbjct:  370 FMNGSMSSVQGSANDPIFIIHHAFIDSIFEQWLRRHQPPRTHYP-TANAPIGHNDGYFMVPFIPLYRNGDYFLSTKALGYEY 450          
BLAST of tyrosinase vs. Ensembl Zebrafish
Match: tyrp1a (tyrosinase-related protein 1a [Source:ZFIN;Acc:ZDB-GENE-070718-2])

HSP 1 Score: 153.68 bits (387), Expect = 8.085e-40
Identity = 109/336 (32.44%), Postives = 161/336 (47.92%), Query Frame = 2
Query:   77 PRICSRNVTLSNSTCCPIYN---DFVCGGPF-RGSC-EVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFE----DLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDC--HICDPSQEEPFLWRKYSST----VDRLPNQNEIDELFSINQYDSEP 1024
            PR+C     L ++ CCP  N   D  CG    RG C +VS   + H       TG+   DDR +WP RFF   C C  NY G  C +CK    GE C+   P  +R+N+L + +    +F+S L+ +K     D +I     +    P N  + Q  N SIY+  V+ H+Y    ++SK  +       + +DF+H+GP F TWHR++LL  E    D+LR  +        F LP+WD+ T    C+ICT+DL+G     D     SNS F  W+ IC +   D+D    IC+ ++  P       +     V RLP   ++     I+ +D+ P
Sbjct:   23 PRVCVTAEGLRSAQCCPSPNGLGDDPCGASLGRGQCVDVSADTRAHGPQYP-YTGR---DDRESWPRRFFTRACRCNGNYSGFDCGRCKHAHTGEECQQRVP-VVRRNVLTLSAEQKRVFVSALDQAKRTTHPDIVIATRHYSEIFGPDN--STQFQNISIYNLFVWTHYY----SVSKTFLGDGEPSFSAVDFSHEGPGFLTWHRYHLLQLERDMQDMLRDPS--------FALPFWDFSTGGSECDICTDDLMGARSRFDSTAISSNSIFSSWRVIC-ESVEDYDTLGTICNSTESSPIRRNPAGNVARPMVQRLPEAQDVAACLEIDAFDTPP 338          

HSP 2 Score: 69.707 bits (169), Expect = 3.735e-12
Identity = 39/84 (46.43%), Postives = 55/84 (65.48%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRR--STYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTS-ANEFGYAYD 1409
            F+NGT      SPNDP+FLL HTF D IF+ WL R+    S+YP +++ PIG + +  +VPF P +RN  +F S A+  GY+Y+
Sbjct:  375 FLNGTGGQTHLSPNDPIFLLLHTFTDAIFDEWLRRHTADVSSYPLENA-PIGHNREFNMVPFWPPVRNAEMFVSAADSLGYSYE 457          
BLAST of tyrosinase vs. Ensembl Zebrafish
Match: dct (dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-000508-1])

HSP 1 Score: 142.51 bits (358), Expect = 1.154e-36
Identity = 107/353 (30.31%), Postives = 166/353 (47.03%), Query Frame = 2
Query:    8 LVMLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYND---FVCGG-PFRGSCEVSILFQNHTEHSDVITG--KLEN-DDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQES---NSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
             V+++   G ++     LS+   PR+C     + +  CCP        VCG    RG+C        H + S    G   L N DDR  WP++FF   C C  N+ G  C +CK GW G NC+      +R++I ++   ++  FL+ L++SK  +  D++I          P N    Q  N SIYD  V+ H+Y+ R T+              +DF+HKGPAF TWHR++LL  E  L+ +     G  NF +PYW++ T Q  C++CT+ LLG     D       S F +W  +C    ++++    +C+ + E         ST   LP  N++    ++  +DS P
Sbjct:    4 FVLMLCCFGCMY-----LSEAQFPRVCCTVEGIVSKECCPALGSDPANVCGLLAGRGNCS-----DVHVD-SKPWGGPYSLRNVDDRERWPTKFFNRTCRCFGNFAGYNCGECKFGWTGLNCDQRKAPVLRKDIHSLSPEELQEFLNALDLSKTTVHPDYMIATQHWLGLLGP-NGTEPQFSNISIYDFFVWQHYYSVRDTLLGP-----GRPFKAIDFSHKGPAFITWHRYHLLSLERELQKLT----GNENFAVPYWNFATGQSECDVCTDSLLGGRDPSDPSRISPRSRFARWGVVC-DSLDEYNRLVTLCNGTNEGSLRRGAAMSTNVTLPTMNDVRSCLNLRDFDSPP 334          
BLAST of tyrosinase vs. Ensembl Zebrafish
Match: dct (dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-000508-1])

HSP 1 Score: 142.124 bits (357), Expect = 1.434e-36
Identity = 107/353 (30.31%), Postives = 166/353 (47.03%), Query Frame = 2
Query:    8 LVMLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYND---FVCGG-PFRGSCEVSILFQNHTEHSDVITG--KLEN-DDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQES---NSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
             V+++   G ++     LS+   PR+C     + +  CCP        VCG    RG+C        H + S    G   L N DDR  WP++FF   C C  N+ G  C +CK GW G NC+      +R++I ++   ++  FL+ L++SK  +  D++I          P N    Q  N SIYD  V+ H+Y+ R T+              +DF+HKGPAF TWHR++LL  E  L+ +     G  NF +PYW++ T Q  C++CT+ LLG     D       S F +W  +C    ++++    +C+ + E         ST   LP  N++    ++  +DS P
Sbjct:    4 FVLMLCCFGCMY-----LSEAQFPRVCCTVEGIVSKECCPALGSDPANVCGLLAGRGNCS-----DVHVD-SKPWGGPYSLRNVDDRERWPTKFFNRTCRCFGNFAGYNCGECKFGWTGLNCDQRKAPVLRKDIHSLSPEELQEFLNALDLSKTTVHPDYMIATQHWLGLLGP-NGTEPQFSNISIYDFFVWQHYYSVRDTLLGP-----GRPFKAIDFSHKGPAFITWHRYHLLSLERELQKLT----GNENFAVPYWNFATGQSECDVCTDSLLGGRDPSDPSRISPRSRFARWGVVC-DSLDEYNRLVTLCNGTNEGSLRRGAAMSTNVTLPTMNDVRSCLNLRDFDSPP 334          
BLAST of tyrosinase vs. Ensembl Zebrafish
Match: dct (dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-000508-1])

HSP 1 Score: 142.124 bits (357), Expect = 1.461e-36
Identity = 107/353 (30.31%), Postives = 166/353 (47.03%), Query Frame = 2
Query:    8 LVMLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYND---FVCGG-PFRGSCEVSILFQNHTEHSDVITG--KLEN-DDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQES---NSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
             V+++   G ++     LS+   PR+C     + +  CCP        VCG    RG+C        H + S    G   L N DDR  WP++FF   C C  N+ G  C +CK GW G NC+      +R++I ++   ++  FL+ L++SK  +  D++I          P N    Q  N SIYD  V+ H+Y+ R T+              +DF+HKGPAF TWHR++LL  E  L+ +     G  NF +PYW++ T Q  C++CT+ LLG     D       S F +W  +C    ++++    +C+ + E         ST   LP  N++    ++  +DS P
Sbjct:    4 FVLMLCCFGCMY-----LSEAQFPRVCCTVEGIVSKECCPALGSDPANVCGLLAGRGNCS-----DVHVD-SKPWGGPYSLRNVDDRERWPTKFFNRTCRCFGNFAGYNCGECKFGWTGLNCDQRKAPVLRKDIHSLSPEELQEFLNALDLSKTTVHPDYMIATQHWLGLLGP-NGTEPQFSNISIYDFFVWQHYYSVRDTLLGP-----GRPFKAIDFSHKGPAFITWHRYHLLSLERELQKLT----GNENFAVPYWNFATGQSECDVCTDSLLGGRDPSDPSRISPRSRFARWGVVC-DSLDEYNRLVTLCNGTNEGSLRRGAAMSTNVTLPTMNDVRSCLNLRDFDSPP 334          
BLAST of tyrosinase vs. Ensembl Xenopus
Match: tyr (tyrosinase [Source:Xenbase;Acc:XB-GENE-988578])

HSP 1 Score: 166.007 bits (419), Expect = 3.809e-44
Identity = 109/340 (32.06%), Postives = 180/340 (52.94%), Query Frame = 2
Query:   50 FLPLSDCLIPRICSRNVTLSNSTCCPIY--NDFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRK--IRQNILNMRSYDVFIFLSILNISKYQLA-DFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDI--PTEDQESNSTFFK-WKPICPQKPNDFDCH--ICDPSQEEPFLWRKYS----STVDRLPNQNEIDELFSINQYDSEP 1024
            FL +     PR CS   +L +  CCP++  +   CG    RG C+  +L  + T      TG    DDR NWP+ F+   C C  N+ G  C  CK G++G NC   + R+  IR+ I  M S +   F++ LN++K+  + D++I   +   +    N  N    + ++YD  V++H+YASR      + E    +D  +DFAH+ PAF  WHR++LL +E  ++ +  ++    NFT+P+WDW +   C+ICT++LLG +   T +  S ++FF  W+ +C  +P +++    +C+ + E P L+R       S   RLP   E++   S+  Y++EP
Sbjct:   16 FLHVCRGQFPRACSTAESLLSKECCPVWSGDGSSCGQLSGRGVCQDVVLTSSATGPQFPFTGV---DDRENWPTVFYNRTCQCLGNFMGYNCADCKFGFRGPNC---TERRTMIRKEIFRMSSAEKSKFVAYLNLAKHTTSRDYVIVTGT---YAQMNNGSNPMFADINVYDLFVWMHYYASRDVF---IGEDALWRD--IDFAHEAPAFVPWHRYFLLHWEHEIQKLTGDE----NFTIPFWDWRDAQGCDICTDELLGGVHPTTTNLLSPASFFASWQIVC-SRPEEYNAQRILCNGTGEGP-LFRNPGGHDRSRTPRLPTTAEVELCLSLTNYETEP 335          

HSP 2 Score: 74.3294 bits (181), Expect = 7.600e-14
Identity = 36/83 (43.37%), Postives = 52/83 (62.65%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRST--YPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYD 1409
            F+NG+      S NDP+F+LHH F+D IFE WL R+  S   YP +++ PIG +   ++VPF+PL  N   F ++ + GY YD
Sbjct:  373 FLNGSMSSVQGSANDPVFVLHHAFVDSIFEQWLRRHGASVDIYP-EANAPIGHNRGYYMVPFIPLYTNGEFFAASRDLGYDYD 454          
BLAST of tyrosinase vs. Ensembl Xenopus
Match: ENSXETT00000043458.3 (pep:known scaffold:JGI_4.2:GL173409.1:196475:198811:-1 gene:ENSXETG00000020142.3 transcript:ENSXETT00000043458.3 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.525 bits (384), Expect = 3.830e-40
Identity = 99/351 (28.21%), Postives = 164/351 (46.72%), Query Frame = 2
Query:    5 SLVMLVITIG--IVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYNDF-VCGG-PFRGSCEVSILFQNHTEHSDVITGKLE--NDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ-ESNSTFFKWKPICP--QKPNDFDCHICDPSQEEPFLWRKYSS--TVDRLPNQNEIDELFSINQYDSEP 1024
            SLV+  + +G  I+ A          PR+C+         CCP + D   CG    RG C   + F      S    G+L   NDDRL+WP  ++   C C  NY G  C  CK G+ G+ C+    R +R+ I  +   +   F   L ++K   +   +  ++ + H    + D  + V+ASIY+   ++H+Y+ +  M    +      D + ++AH+GPAF  WHR  L+ FE  ++ +  ++    +F LPY+DW  +  C+ICTND +GD   +   +  S F+ W+ IC     P+ +     D  QE   L RK  +    + LP+  +++       +D+ P
Sbjct:    1 SLVLPTVMLGLWIILALSFSGVQSQFPRVCTTKEAFQTKVCCPTWTDGSACGSRSGRGQCRNWVAF------SSFAKGQLPIYNDDRLDWPRHYYDSTCECFGNYGGFNCGYCKYGYTGKKCDQKKTR-VRKEIRQLSFTERKRFFGYLALAKTTFSKDYVVLTTGDRH----HRDTYRFVDASIYEVFSWIHYYSIKPIMVNSTL------DPRRNYAHRGPAFPGWHRLGLMFFEREVQHMTGDE----DFALPYYDWRGEQNCSICTNDYMGDNDVQGYLDPYSHFYNWRSICSGYNYPDAYCPGATDGYQER--LHRKPGADPLANTLPSFQDVENTLKWRDFDTPP 328          

HSP 2 Score: 63.5438 bits (153), Expect = 1.522e-10
Identity = 27/80 (33.75%), Postives = 46/80 (57.50%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            ++ GT      S +DP+FLLHH F+DKI+E+W+ + + S      +   GQ  ++   P+ P  RN++L   + +FGY +
Sbjct:  364 YMGGTMSQVPISSSDPMFLLHHNFIDKIYEVWIQKYKGSPKVYPENNEPGQGPNECSTPYFPCWRNKDLLRPSTDFGYKF 443          
BLAST of tyrosinase vs. Ensembl Xenopus
Match: dct (dopachrome tautomerase [Source:Xenbase;Acc:XB-GENE-1007258])

HSP 1 Score: 153.295 bits (386), Expect = 4.776e-40
Identity = 104/351 (29.63%), Postives = 169/351 (48.15%), Query Frame = 2
Query:    5 SLVMLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYN---DFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLEN-DDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            ++++L   +  V A F        PR C     L++  CCP      + VCG    RG C   ++  +    S   T  L N DDR  WP +FF  +C C  N+ G  C +CK GW G  CE   P  +R+NI ++ + +   FL  L+ +K  +    +  +   L     N    Q+ N SIY+  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL+ E  L+ +     G  +F LPYW++ T +  C++CT++L G    +D     + S F +W  +C    ND++    +C+ + E             RLP+  ++ +  S+N++D+ P
Sbjct:    8 AVLLLACCLQAVRAQF--------PRSCVTVEALTSKRCCPALGSDLNNVCGSLEGRGQCTPVVV--DERPWSGPYT--LRNVDDRERWPLKFFNSICRCTGNFAGFNCGECKFGWTGPTCEQRKPPVVRKNIHSLTAQERTQFLDALDQAKNTIHPDYVIATQHWLSILGPNGTEPQVANTSIYNYFVWLHYYSVRDTLLGP-----GRPFTAIDFSHQGPAFVTWHRYHLLLLERDLQRMT----GNESFALPYWNFATGRNECDVCTDELFGAPRLDDPNLISAGSRFSRWGIVC-NSLNDYNRLVTLCNGTNEGFLQRNPLGGAEGRLPSMEDVQKCLSLNEFDNPP 336          

HSP 2 Score: 59.3066 bits (142), Expect = 4.165e-9
Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRS--TYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     +S NDP+F++ H+F D IF+ W+ R + S   +P +   PIG +    +VPF P + N  LF  A + GY Y
Sbjct:  373 FLNGTSAQSHSSANDPIFVVLHSFTDAIFDEWMKRFQPSDVAWP-QELAPIGHNRMYNMVPFFPPVTNEELFLPAEQLGYVY 453          
BLAST of tyrosinase vs. Ensembl Xenopus
Match: ENSXETT00000002949.2 (pep:known scaffold:JGI_4.2:GL175957.1:2840:6117:-1 gene:ENSXETG00000001390.2 transcript:ENSXETT00000002949.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 3.691e-38
Identity = 97/315 (30.79%), Postives = 149/315 (47.30%), Query Frame = 2
Query:   11 VMLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYNDFV-CG-GPFRGSCEVSILFQNHTEHSDVITGK--LENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRK--IRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ-ESNSTFFKWKPICPQKPNDFDCHICDPSQEEPFL 934
             ML + I + F     LS    PR+C+ +  L    CCP + D   CG    RG C   + F      S +  G+  L NDDR +WP  ++   C C  NY G  C  CK G+ GE CE    RK  +R+ I  +   D   F S L ++K   +   +  ++ + H    + D  + V+ASIYD   ++H+++ +  M    +      D+  +FAH+GP F  WHR  L+  E  ++ +  ++    +F  PY+DW  +  C+ICTND +GD   +   +  S F  W+ IC     D+    C P  +EP L
Sbjct:    1 AMLGLWISLTFCLHGVLSQ--FPRVCTTDGALQTKNCCPRWTDGTPCGFRSGRGRCRNGVAF------SSLAAGQVPLYNDDRWDWPRYYYDSTCECYGNYGGFDCGDCKHGYFGERCER---RKTLVRREIRELSLVDRRRFFSYLALAKTTKSKDYVVLTTGDRH----HRDTFRFVDASIYDVFAWMHYFSMKPIMVNSTL------DDSKNFAHQGPVFPGWHRMALMFLEREIQRMTGDE----DFAFPYYDWRGEQNCSICTNDFMGDNDVQGNLDPYSHFSNWRGICSGY--DYPDAYC-PVIQEPIL 287          

HSP 2 Score: 62.003 bits (149), Expect = 4.635e-10
Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            ++ GT      S NDP+F++HH F+DKIF+ W+ +   S      +   GQ  ++   P+ P IRN++L   + +FGY Y
Sbjct:  356 YLGGTMSRVPISSNDPIFIVHHGFVDKIFDKWIQKYNISPSLYPPNDEPGQGPNECCTPYFPCIRNKDLLWKSTQFGYRY 435          
BLAST of tyrosinase vs. Ensembl Xenopus
Match: tyrp1 (tyrosinase-related protein 1 [Source:Xenbase;Acc:XB-GENE-1001464])

HSP 1 Score: 141.739 bits (356), Expect = 4.360e-36
Identity = 102/340 (30.00%), Postives = 163/340 (47.94%), Query Frame = 2
Query:   74 IPRICSRNVTLSNSTCCPIY--------NDFVCGGPFRGSC-EVSILFQNHTEHSDVITGKLEN-DDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWT---NQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDC--HICDPSQEEPFLWRKYSST----VDRLPNQNEIDELFSINQYDSEP 1024
             PR C+    L +  CCP          ND       RG C  V++  + H         +L+  DDR  WP RFF   C C   + G  C  CK GW G+NC+      +R+NIL +R  +   F++ L+++K  +  D++I         DPV ++     N SIYD  V+ H+Y    ++SK  +      +  +DF+H+GPAF TWHR++L+  E  ++ +  +     +F LPYW++    NQ  C+ICT+DLLG     D     +NS F +W+ +C +   D++    IC+ ++  P       +     V RLP   ++     +N +D+ P
Sbjct:   27 FPRQCATAQALLSGECCPGLFPGQSPDPNDQCGLSLGRGQCGPVTVDTRPHGPQY-----RLDGLDDREQWPIRFFNRACRCNGRFYGHNCGSCKPGWTGDNCDQPV-AVVRRNILELREEEKRRFVNALDLAKNTMHPDYVIATRRYAELIDPV-QNTTNFENISIYDFFVWNHYY----SVSKTFLGPGQGSEGGIDFSHEGPAFLTWHRYHLMQLERDMQVMLRDP----SFALPYWNFAIGGNQ--CDICTDDLLGARSNFDANLLSTNSVFSQWQVVC-EYVEDYESLGTICNSTRNSPIRRNPAGNVARPMVQRLPEPQDVALCLEVNMFDTPP 348          

HSP 2 Score: 62.3882 bits (150), Expect = 3.513e-10
Identity = 35/84 (41.67%), Postives = 52/84 (61.90%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANE-FGYAYD 1409
            F+NGT      SPNDP+F+L HTF D +F+ W+ R+    S YP +++ PIG +    +VPF P + N  +F +A E  GY+Y+
Sbjct:  385 FLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWIRRHNADSSQYPLENA-PIGHNRQYNMVPFWPPVTNNEMFLTAPENLGYSYE 467          
BLAST of tyrosinase vs. Ensembl Mouse
Match: Tyr (tyrosinase [Source:MGI Symbol;Acc:MGI:98880])

HSP 1 Score: 151.754 bits (382), Expect = 4.406e-39
Identity = 103/331 (31.12%), Postives = 167/331 (50.45%), Query Frame = 2
Query:   59 LSDCLIPRICSRNVTLSNSTCCPIY--NDFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQE--SNSTFF-KWKPICPQKPNDFDCH--ICDPSQEEPFLWRKYS---STVDRLPNQNEIDELFSINQYDS 1018
            +SD   PR C+ +  L    CCP +  +   CG    RGSC+  +L    +       G    DDR +WPS F+   C C  N+ G  C  CK G+ G NC       IR+NI ++   +   F S L ++K+ ++   +  + +    +  N       + +IYD  V++H+Y SR T+   L  S   +D  +DFAH+ P F  WHR +LL++E  +R +  ++    NFT+PYWDW +   C+ICT++ LG    E+    S ++FF  W+ IC  +  +++ H  +CD + E P L    +   +   RLP+  +++   S+ QY+S
Sbjct:   15 ISDGHFPRACASSKNLLAKECCPPWMGDGSPCGQLSGRGSCQDILLSSAPSGPQFPFKGV---DDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFGGPNC-TEKRVLIRRNIFDLSVSEKNKFFSYLTLAKHTISSVYVIPTGTYGQMN--NGSTPMFNDINIYDLFVWMHYYVSRDTL---LGGSEIWRD--IDFAHEAPGFLPWHRLFLLLWEQEIRELTGDE----NFTVPYWDWRDAENCDICTDEYLGGRHPENPNLLSPASFFSSWQIIC-SRSEEYNSHQVLCDGTPEGPLLRNPGNHDKAKTPRLPSSADVEFCLSLTQYES 329          

HSP 2 Score: 81.6481 bits (200), Expect = 7.816e-16
Identity = 39/82 (47.56%), Postives = 54/82 (65.85%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRR--STYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT      S NDP+FLLHH F+D IFE WL R+R     YP +++ PIG + D ++VPF+PL RN + F ++ + GY Y
Sbjct:  369 FMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLLEVYP-EANAPIGHNRDSYMVPFIPLYRNGDFFITSKDLGYDY 449          
BLAST of tyrosinase vs. Ensembl Mouse
Match: Dct (dopachrome tautomerase [Source:MGI Symbol;Acc:MGI:102563])

HSP 1 Score: 148.673 bits (374), Expect = 3.687e-38
Identity = 100/328 (30.49%), Postives = 155/328 (47.26%), Query Frame = 2
Query:   74 IPRICSRNVTLSNSTCCPIYN---DFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDCHI--CDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
             PR+C     + N  CCP        +CG    RG C      Q  T            DDR  WP +FF   C C  N+ G  C  CK GW G +C    P  +R+NI ++ + +   FL  L+++K  +  D++IT         P N    Q+ N S+YD  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL  E  L+ +     G  +F LPYW++ T +  C++CT++LLG    +D      NS F  W+ +C    +D++  +  C+ + E      K     ++LP    + +  S+ ++DS P
Sbjct:   25 FPRVCMTLDGVLNKECCPPLGPEATNICGFLEGRGQCAE---VQTDTRPWSGPYILRNQDDREQWPRKFFNRTCKCTGNFAGYNCGGCKFGWTGPDCNRKKPAILRRNIHSLTAQEREQFLGALDLAKKSIHPDYVITTQHWLGLLGP-NGTQPQIANCSVYDFFVWLHYYSVRDTLLGP-----GRPYKAIDFSHQGPAFVTWHRYHLLWLERELQRLT----GNESFALPYWNFATGKNECDVCTDELLGAARQDDPTLISRNSRFSTWEIVC-DSLDDYNRRVTLCNGTYEGLLRRNKVGRNNEKLPTLKNVQDCLSLQKFDSPP 338          

HSP 2 Score: 60.8474 bits (146), Expect = 2.569e-9
Identity = 34/82 (41.46%), Postives = 49/82 (59.76%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRST--YPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     ++ NDP+F++ H+F D IF+ WL RN  ST  +P +   PIG +    +VPF P + N  LF +A + GY Y
Sbjct:  375 FLNGTNALPHSAANDPVFVVLHSFTDAIFDEWLKRNNPSTDAWP-QELAPIGHNRMYNMVPFFPPVTNEELFLTAEQLGYNY 455          
BLAST of tyrosinase vs. Ensembl Mouse
Match: Tyrp1 (tyrosinase-related protein 1 [Source:MGI Symbol;Acc:MGI:98881])

HSP 1 Score: 135.191 bits (339), Expect = 1.787e-33
Identity = 97/340 (28.53%), Postives = 161/340 (47.35%), Query Frame = 2
Query:   74 IPRICSRNVTLSNSTCCPIYNDFVCGGPF---------RGSCEVSIL-FQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENC--EVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDC--HICDPSQEEPFLWRKYSS----TVDRLPNQNEIDELFSINQYDSEP 1024
             PR C+    L    CCP  +     GP          RG C   I   + H+ H     GK   DDR  WP RFF   C C  N+ G  C  C+ GW+G  C  ++++   +R+N+L++   +   F+  L+++K      F+I          P + +  Q  N S+Y+  V+ H+Y+ + T      ES  D    +DF+H+GPAF TWHR++LL  E  ++ +  E     +F+LPYW++ T +  C++CT+DL+G     D      NS F +W+ +C +   ++D    +C+ ++  P       +     V RLP   ++ +   +  +D+ P
Sbjct:   26 FPRECANIEALRRGVCCP--DLLPSSGPGTDPCGSSSGRGRCVAVIADSRPHSRHYP-HDGK---DDREAWPLRFFNRTCQCNDNFSGHNCGTCRPGWRGAACNQKILT---VRRNLLDLSPEEKSHFVRALDMAKRTTHPQFVIATRRLEDILGP-DGNTPQFENISVYNYFVWTHYYSVKKTFLGTGQESFGD----VDFSHEGPAFLTWHRYHLLQLERDMQEMLQEP----SFSLPYWNFATGKNVCDVCTDDLMGSRSNFDSTLISPNSVFSQWRVVC-ESLEEYDTLGTLCNSTEGGPIRRNPAGNVGRPAVQRLPEPQDVTQCLEVRVFDTPP 346          

HSP 2 Score: 63.1586 bits (152), Expect = 4.335e-10
Identity = 37/91 (40.66%), Postives = 54/91 (59.34%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRR--STYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSA-NEFGYAYDNNIVGNK 1430
            F+NGT      SPNDP+F+L HTF D +F+ WL R     ST+P +++ PIG +    +VPF P + N  +F +A +  GYAY+    G +
Sbjct:  383 FLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENA-PIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYAYEVQWPGQE 472          
BLAST of tyrosinase vs. Ensembl Mouse
Match: Tyrp1 (tyrosinase-related protein 1 [Source:MGI Symbol;Acc:MGI:98881])

HSP 1 Score: 135.191 bits (339), Expect = 1.787e-33
Identity = 97/340 (28.53%), Postives = 161/340 (47.35%), Query Frame = 2
Query:   74 IPRICSRNVTLSNSTCCPIYNDFVCGGPF---------RGSCEVSIL-FQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENC--EVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDC--HICDPSQEEPFLWRKYSS----TVDRLPNQNEIDELFSINQYDSEP 1024
             PR C+    L    CCP  +     GP          RG C   I   + H+ H     GK   DDR  WP RFF   C C  N+ G  C  C+ GW+G  C  ++++   +R+N+L++   +   F+  L+++K      F+I          P + +  Q  N S+Y+  V+ H+Y+ + T      ES  D    +DF+H+GPAF TWHR++LL  E  ++ +  E     +F+LPYW++ T +  C++CT+DL+G     D      NS F +W+ +C +   ++D    +C+ ++  P       +     V RLP   ++ +   +  +D+ P
Sbjct:   26 FPRECANIEALRRGVCCP--DLLPSSGPGTDPCGSSSGRGRCVAVIADSRPHSRHYP-HDGK---DDREAWPLRFFNRTCQCNDNFSGHNCGTCRPGWRGAACNQKILT---VRRNLLDLSPEEKSHFVRALDMAKRTTHPQFVIATRRLEDILGP-DGNTPQFENISVYNYFVWTHYYSVKKTFLGTGQESFGD----VDFSHEGPAFLTWHRYHLLQLERDMQEMLQEP----SFSLPYWNFATGKNVCDVCTDDLMGSRSNFDSTLISPNSVFSQWRVVC-ESLEEYDTLGTLCNSTEGGPIRRNPAGNVGRPAVQRLPEPQDVTQCLEVRVFDTPP 346          

HSP 2 Score: 63.1586 bits (152), Expect = 4.335e-10
Identity = 37/91 (40.66%), Postives = 54/91 (59.34%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRR--STYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSA-NEFGYAYDNNIVGNK 1430
            F+NGT      SPNDP+F+L HTF D +F+ WL R     ST+P +++ PIG +    +VPF P + N  +F +A +  GYAY+    G +
Sbjct:  383 FLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENA-PIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYAYEVQWPGQE 472          
BLAST of tyrosinase vs. Ensembl Mouse
Match: Tyrp1 (tyrosinase-related protein 1 [Source:MGI Symbol;Acc:MGI:98881])

HSP 1 Score: 96.6709 bits (239), Expect = 6.885e-22
Identity = 68/218 (31.19%), Postives = 103/218 (47.25%), Query Frame = 2
Query:   74 IPRICSRNVTLSNSTCCPIYNDFVCGGPF---------RGSCEVSIL-FQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENC--EVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLL 688
             PR C+    L    CCP  +     GP          RG C   I   + H+ H     GK   DDR  WP RFF   C C  N+ G  C  C+ GW+G  C  ++++   +R+N+L++   +   F+  L+++K      F+I          P + +  Q  N S+Y+  V+ H+Y+ + T      ES  D    +DF+H+GPAF TWHR++LL
Sbjct:   26 FPRECANIEALRRGVCCP--DLLPSSGPGTDPCGSSSGRGRCVAVIADSRPHSRHYP-HDGK---DDREAWPLRFFNRTCQCNDNFSGHNCGTCRPGWRGAACNQKILT---VRRNLLDLSPEEKSHFVRALDMAKRTTHPQFVIATRRLEDILGP-DGNTPQFENISVYNYFVWTHYYSVKKTFLGTGQESFGD----VDFSHEGPAFLTWHRYHLL 229          
BLAST of tyrosinase vs. UniProt
Match: sp|P55024|TYRO_CHICK (Tyrosinase OS=Gallus gallus GN=TYR PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 5.418e-41
Identity = 110/346 (31.79%), Postives = 178/346 (51.45%), Query Frame = 2
Query:   14 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYND--FVCG-GPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISK-YQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDI-PTE-DQESNSTFF-KWKPICPQKPN-DFDCHICDPSQEEPFLWRKYS---STVDRLPNQNEIDELFSINQYDS 1018
            M +  +G++     P S    PR+C+   +L    CCP ++     CG    RG+C+  +L Q         +G    DDR +WPS F+   C C+ N+ G  C +CK G+ G+NC     R  R+NI  +   +   FL+ LN++K     D++I   ++  +    N  N    N ++YD  V++H+YASR T+   L  S   +D  +DFAH+ P F  WHR +LL++E  ++ I  ++    NFT+PYWDW +   C ICT++ +G   PT  +  S ++FF  W+ IC Q    +    +C+ + E P L    +   S   RLP+ +E++   ++ QY+S
Sbjct:    1 MFLFAMGLLLVILQP-STGQFPRVCANTQSLLRKECCPPWDGDGTPCGERSNRGTCQRILLSQAPLGPQFPFSGV---DDREDWPSVFYNRTCRCRGNFMGFNCGECKFGFSGQNCTERRLR-TRRNIFQLTISEKDKFLAYLNLAKNIPSKDYVI---ATGTYAQMNNGSNPMFRNINVYDLFVWMHYYASRDTL---LGGSNVWRD--IDFAHEAPGFLPWHRAFLLLWEREIQKITGDE----NFTIPYWDWRDAEDCVICTDEYMGGQHPTNPNLLSPASFFSSWQVICTQSEEYNSQQALCNATSEGPILRNPGNNDKSRTPRLPSSSEVEFCLTLTQYES 329          

HSP 2 Score: 79.7221 bits (195), Expect = 2.347e-14
Identity = 37/83 (44.58%), Postives = 54/83 (65.06%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRR--STYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYD 1409
            ++NG+      S NDP+F+LHH F+D IFE WL R+R     YP  ++ PIG + ++++VPF+PL RN   F S+ E GY Y+
Sbjct:  369 YMNGSMSQVQGSANDPIFILHHAFVDSIFERWLRRHRPMLEVYPA-ANAPIGHNRENYMVPFIPLYRNGEFFISSRELGYDYE 450          
BLAST of tyrosinase vs. UniProt
Match: sp|Q4R1H1|TYRP2_PIG (L-dopachrome tautomerase OS=Sus scrofa GN=DCT PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 6.664e-41
Identity = 105/345 (30.43%), Postives = 165/345 (47.83%), Query Frame = 2
Query:   23 ITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYN---DFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISK-YQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDCHI--CDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            + +G + ++  P +    PR+C    +L    CCP        VCG    RG C      Q  T            DDR  WP +FF   C C  N+ G  C  CK GW G NC+   P  +RQNI ++ + +   FL  L+++K     D++IT         P N    Q+ N SIYD  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL  E  L+ +     G  +F +PYW++ T +  C++CT+ LLG    +D      NS F  W+ +C    +D++  +  C+ + E      +     ++LP+  +I++  S+ Q+D+ P
Sbjct:    8 LLLGCLGSALGPGAQAQFPRVCMTVGSLQAKECCPPLGAEPSNVCGSLEGRGRCAE---VQADTRPWSGPYVLRNQDDRERWPRKFFDRTCRCTGNFAGYNCGDCKFGWTGPNCDQKKPLVVRQNIHSLTAQEREQFLGALDLAKNTPHPDYVITTQHWLGLLGP-NGTQPQIANCSIYDLFVWLHYYSVRDTLLGP-----GRPYKAIDFSHQGPAFVTWHRYHLLWLERALQRLT----GNESFAVPYWNFATGRNECDVCTDQLLGAARPDDPTLISQNSRFSSWEIVC-DSLDDYNRRVTLCNGTYEGLLRRNQVGRNSEKLPSLKDIEDCLSLKQFDNPP 338          

HSP 2 Score: 55.4546 bits (132), Expect = 9.120e-7
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLR--NRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     ++ NDP+F++ H+F D IF+ W+ R       +P +   PIG +    +VPF P + N  LF +A++ GY+Y
Sbjct:  375 FLNGTSALPHSAANDPVFVVLHSFTDAIFDEWMKRFSPPVDAWP-QELAPIGHNRMYNMVPFFPPVTNEELFLTADQLGYSY 455          
BLAST of tyrosinase vs. UniProt
Match: sp|O93505|TYRP2_CHICK (L-dopachrome tautomerase OS=Gallus gallus GN=DCT PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 3.973e-39
Identity = 105/335 (31.34%), Postives = 166/335 (49.55%), Query Frame = 2
Query:   53 LPLSDCLIPRICSRNVTLSNSTCCPIYN---DFVCGG-PFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            LP ++   PR+C     + +  CCP        VCG    RG C+     Q  T+           DDR  WP +FF   C C  N+ G  C  CK GW G +C V  P  +R+NI ++   +   FL +L+ +K  +  D++I          P  E+  Q+ N SIY+  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL+ E  L+ +     G  +F LPYWD+ T + TC++CT+ L G    +D      NS F +W+ +C    +D++    +C+ S +E  L R+   + ++LP   ++    S +++DS P
Sbjct:   20 LPRAEAQFPRVCMTVEAIRSKRCCPALGPDPGNVCGVLQGRGWCQG---VQVDTQPWSGPYTLRNVDDRERWPLKFFNQSCWCTGNFAGYNCGDCKFGWTGPDCSVRKPPVVRKNIHSLTVEEREQFLDVLDRAKTTIHPDYVIATQHWMSLLGPSGEEP-QIANCSIYNYFVWLHYYSVRDTLLGP-----GRPFTAIDFSHQGPAFVTWHRYHLLLLERDLQRL----MGNESFALPYWDFATGRNTCDVCTDQLFGAPRPDDPGLISLNSRFSRWQIVC-NSLDDYNRLVTLCNGS-DEGLLQRRPRDSGEQLPTAEDVRRCLSRHEFDSPP 339          

HSP 2 Score: 55.8398 bits (133), Expect = 7.297e-7
Identity = 31/89 (34.83%), Postives = 51/89 (57.30%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLR--NRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGN 1427
            F+NGT +    + NDP+F++ H+F D IF+ W+ R     + +P +   PIG +    +VPF P + N  LF +A + GY Y  ++ G+
Sbjct:  376 FLNGTRVLPHAAANDPIFVVLHSFTDAIFDEWMKRFHPPDNAWP-EELAPIGHNRLYNMVPFFPPVTNDQLFQTAEQLGYTYAIDLPGS 463          
BLAST of tyrosinase vs. UniProt
Match: sp|Q08410|TYRO_COTJA (Tyrosinase (Fragment) OS=Coturnix coturnix japonica GN=TYR PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 5.960e-39
Identity = 92/270 (34.07%), Postives = 144/270 (53.33%), Query Frame = 2
Query:   14 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIY--NDFVCG-GPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISK-YQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLG 811
            ML+ T+G++ A   P S    PR+C+   +L    CCP +  +   CG    RG+C+  +L Q         +G    DDR +WPS F+   C C+ N+ G  C +CK G+ G+NC     R  R+NI  +   +   FL+ LN++K     D++I   ++  +    N  N    N ++YD  V++H+YASR T+   L  S   +D  +DFAH+ P F  WHR +LL++E  ++ I  ++    NFT+PYWDW +   C ICT++ +G
Sbjct:    1 MLLFTMGLLLAILQP-STGQFPRVCANTQSLLRKECCPPWEGDGSPCGERSNRGTCQRILLSQAPLGPQFPFSGV---DDREDWPSVFYNRTCRCRGNFMGFNCGECKFGFSGQNCTERRLR-TRRNIFQLTIREKDKFLAYLNLAKNIPSKDYVI---ATGTYAQMNNGSNPMFRNINVYDLFVWMHYYASRDTL---LGGSNVWRD--IDFAHEAPGFLPWHRAFLLLWEREIQKITGDE----NFTIPYWDWRDAEDCVICTDEYMG 253          
BLAST of tyrosinase vs. UniProt
Match: sp|P40126|TYRP2_HUMAN (L-dopachrome tautomerase OS=Homo sapiens GN=DCT PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 8.514e-39
Identity = 107/336 (31.85%), Postives = 160/336 (47.62%), Query Frame = 2
Query:   53 LPLSDCLIPRICSRNVTLSNSTCCP---IYNDFVCGGP-FRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFE-DLLRSIAVEQFGYYNFTLPYWDW-TNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFD--CHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            LP +    PR+C    +L N  CCP     +  VCG    RG C              ++  +   DDR  WP +FF   C C  N+ G  C  CK GW G NCE   P  IRQNI ++   +   FL  L+++K ++  D++IT         P N    Q  N S+YD  V+LH+Y+ R T+              +DF+H+GPAF TWHR++LL  E DL R I  E     +F LPYW++ T +  C++CT+ L G    +D      NS F  W+ +C    +D++    +C+ + E      +      +LP   +I +  S+ ++D+ P
Sbjct:   18 LPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQ---DDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGP-NGTQPQFANCSVYDFFVWLHYYSVRDTLLGP-----GRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNE-----SFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVC-DSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPP 338          

HSP 2 Score: 55.0694 bits (131), Expect = 1.194e-6
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLR-NRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            F+NGT     ++ NDP+F++ H+F D IF+ W+ R N  +    +   PIG +    +VPF P + N  LF ++++ GY+Y
Sbjct:  375 FLNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAWPQELAPIGHNRMYNMVPFFPPVTNEELFLTSDQLGYSY 455          
BLAST of tyrosinase vs. TrEMBL
Match: tr|H9B8J5|H9B8J5_SCHMD (Tyrosinase OS=Schmidtea mediterranea PE=2 SV=1)

HSP 1 Score: 499.975 bits (1286), Expect = 4.203e-169
Identity = 251/261 (96.17%), Postives = 256/261 (98.08%), Query Frame = 2
Query:  395 MRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQESNSTFFKWKPICPQKPNDFDCHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEPXXXXXXXXXXXXXXAEGYYRVHPNSDDMKMKDIGKGLPHQNIMMHNMFYQW 1177
            MRSYDVFIFLS+LNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGY+NFTLPYWDWTNQ TCNICTNDLLGDIPTEDQESNSTFFKWKPICPQKPNDFDCHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEPFNSS+FSRKSFRNFAEGYYRV  NSDDMKMKDIGKGLPHQNIMMHNM + +
Sbjct:    1 MRSYDVFIFLSVLNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYFNFTLPYWDWTNQTTCNICTNDLLGDIPTEDQESNSTFFKWKPICPQKPNDFDCHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEPFNSSTFSRKSFRNFAEGYYRVDQNSDDMKMKDIGKGLPHQNIMMHNMVHSF 261          

HSP 2 Score: 308.531 bits (789), Expect = 1.391e-94
Identity = 163/183 (89.07%), Postives = 168/183 (91.80%), Query Frame = 3
Query: 1110 K*KTLGRDSP---IKIS*CIICFINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLFTNHQLDFEKSSSEIYYILTXXXXXXXXXXXXGLYCFRPSQISHTAYEFIEDQEQEEKTNYFNNNEKMPLLK 1649
            K K +G+  P   I +   +  FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLF NHQLDFEKSSSEIYYILTAVAFVVLVA +VGLYCFRPSQISHTAYEFIEDQEQEEKTNYFNNNEKMPLLK
Sbjct:  239 KMKDIGKGLPHQNIMMHNMVHSFINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLFKNHQLDFEKSSSEIYYILTAVAFVVLVATIVGLYCFRPSQISHTAYEFIEDQEQEEKTNYFNNNEKMPLLK 421          
BLAST of tyrosinase vs. TrEMBL
Match: tr|A0A183VMI2|A0A183VMI2_TRIRE (Uncharacterized protein OS=Trichobilharzia regenti PE=4 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 7.675e-60
Identity = 128/342 (37.43%), Postives = 177/342 (51.75%), Query Frame = 2
Query:  146 CGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQ-LADFLITNSSSNLHCDPVNEDNIQLVN-ASIYDTMVYLHFYASRSTMSKELMES--CTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLR---------SIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLG----DIPTEDQESNSTFFKWKPICPQKPNDFDCHICDPSQ---------------------EEPF----LWR-------KYSSTVDRLPNQNEIDELFSINQYDSEP 1024
            CGGP RG C     F    + +  +  K   DDRL WP+RFF+  C+C+ N+ G AC +CK GW G +C    P +IR+N+L M + +   F   + ++K   + ++L+ N S + + DPV  +N+QL+   SIYD  V++H YASRS++  E      C   +++LDFAHKGPAF TWHR YLL +E+ L          S+  E  G   FTLPYWDWT+   C ICTNDL+G    +  T   + NS F +W   CPQ+    DCH+CDP +                       P     LWR         SS  +RLPNQN++        YD+ P
Sbjct:    6 CGGPGRGLCREISAFPEDLDLAQ-LDSKFLLDDRLAWPTRFFEAACACQGNFQGYACHRCKDGWTGVSCRTRKPLRIRRNVLQMTTTEQREFRDRIALAKLTPMTEWLVINISDSSNGDPVGSENLQLIQPPSIYDYFVFIHLYASRSSLVSEETNGPWCNPNEHRLDFAHKGPAFITWHRAYLLFWENELARLGRGNKNDSMGQEDDG-DGFTLPYWDWTSANGCPICTNDLIGAPDLNSTTGSLDPNSVFSQWITYCPQRSGINDCHVCDPGKLISLQLVLICTCKSILWSDNPNHPMAGGPLWRLRSDNGTSISSIFNRLPNQNDVLRTLETPDYDAWP 345          

HSP 2 Score: 62.003 bits (149), Expect = 1.078e-6
Identity = 25/39 (64.10%), Postives = 33/39 (84.62%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRS 1283
            ++NG+W D +TSPNDPLFLLHHTF+DK+FE+W  + R S
Sbjct:  417 YMNGSWFDVSTSPNDPLFLLHHTFVDKLFELWYRKYRPS 455          
BLAST of tyrosinase vs. TrEMBL
Match: tr|A0A1I8GS15|A0A1I8GS15_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.760e-54
Identity = 119/333 (35.74%), Postives = 175/333 (52.55%), Query Frame = 2
Query:  146 CGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELME-------------SCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDI---PTEDQESNSTFF-----KWKPICPQKPNDFDCHICDP----------SQEEPFLWRKYSSTVDRLPNQN-----EIDE----LFSINQYDSEP 1024
            CGGP RG+C   +         D    +L NDDRL+WP RFF F C C+  + G  C        GE+  +  PR +R+N LNM + +  +   +L  SK + + + + N SS+ + DP   D +  VN S+YD +VYLH Y+SRST+ + +M              SC    ++LDFAH+GP F  WHRHYLL+ E L  +IA  +FG  +F+LPYWDWT +  C++CT+DL+G +     +D + +S F       ++  CP++ +   CH CDP          S  EP LWR Y++      N +      I+E    L + ++YDS P
Sbjct: 1301 CGGPQRGAC---VAITTAAVDEDPPREELRNDDRLSWPLRFFAFACQCRPAFWGADC--------GESAPL-RPR-LRKNALNMSAEERLLLRQVLVASKNESSGWAVLNISSSANGDPATPDKVSFVNVSVYDLLVYLHLYSSRSTLLEPVMPDEGAAGEDGGEEGSCPRSRHQLDFAHRGPGFLPWHRHYLLLAEALFANIAKSRFGAEDFSLPYWDWTGKSVCDVCTSDLVGPVGNATADDSDPDSGFVGGDFANFRAFCPRRSSPGACHTCDPAKFQDVGGDGSNAEP-LWRSYNADFFNQDNGDAGGLPSIEETAYLLVNASRYDSPP 1619          

HSP 2 Score: 79.7221 bits (195), Expect = 5.384e-12
Identity = 33/85 (38.82%), Postives = 49/85 (57.65%), Query Frame = 3
Query: 1167 FINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKS----STPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYD 1409
            ++ GTW+D   SPNDPLF LHH F+DK+FE+WL  +  +  P K+      P+G      +VPF P +   + F  ++  G+ YD
Sbjct: 1658 YMRGTWLDVALSPNDPLFWLHHCFVDKLFEVWLRSSPDAANPDKNLPVDGAPVGHSRRSNMVPFFPPVTVADRFARSDSLGFGYD 1742          
BLAST of tyrosinase vs. TrEMBL
Match: tr|H2TGS7|H2TGS7_TAKRU (Uncharacterized protein OS=Takifugu rubripes GN=TYR (1 of many) PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.740e-54
Identity = 99/329 (30.09%), Postives = 158/329 (48.02%), Query Frame = 2
Query:   74 IPRICSRNVTLSNSTCCPIYND--FVCGGP-FRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQL-ADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDCH--ICDPSQEEPFLWRKYSST-----VDRLPNQNEIDELFSINQYDS 1018
             PR+C+    L    CCP ++     CG    RG C+  + F +  +        L  DDR  WPS F+   C C  N+ G +C  CK G+ G  C       +R+NIL++   +    +S LN++K  + +D+++   ++  + +  N  N      S+YD  V++H+Y SR+     L+    +    +DF H  PAF  WHR YLL +E  +R +     G   F++PYWDW +   C++CT++L+G    +D       S F  WK +C   P D++    +CD  QE P   R+         V+RLP   ++    S+ QYD+
Sbjct:   20 FPRLCATAAALRTKECCPPWDGDGSPCGASSGRGFCQ-DVEFTHQPDGPQYPFIGL--DDREKWPSVFYNRTCQCVGNFMGFSCADCKYGYFGAKCNERR-ESLRRNILHLSRSERIRLVSYLNLAKQSVSSDYVV---ATGTYEEMENGSNPMFAEVSVYDVFVWMHYYVSRNA----LLGGPGNVWTNVDFGHWAPAFLPWHRAYLLHWEREIRKLT----GDLTFSIPYWDWRDAQGCDVCTDELIGAQSPQDPSFLSPGSVFSSWKTLC-STPEDYNNRGVLCDARQEGPL--RRNPGNHNRNLVERLPTSADVAFTLSLTQYDT 330          

HSP 2 Score: 88.5817 bits (218), Expect = 2.740e-54
Identity = 48/99 (48.48%), Postives = 60/99 (60.61%), Query Frame = 3
Query: 1122 LGRDSPIKIS*CIICFINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNR--RSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDN 1412
            LG  S + +   I  F+NGT      S NDP+FLLHHTF+D I+E WL R+R   S YP  S  PIG +    +VPFLPL RNR+ F S+ + GY Y N
Sbjct:  355 LGNSSRMGMHAAIHVFLNGTMSSVQASANDPIFLLHHTFVDSIYEQWLRRHRPPPSQYP-DSDAPIGHNGGYHMVPFLPLHRNRDYFISSKDLGYEYSN 452          
BLAST of tyrosinase vs. TrEMBL
Match: tr|I3JAR0|I3JAR0_ORENI (Uncharacterized protein OS=Oreochromis niloticus GN=TYR (1 of many) PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 3.785e-54
Identity = 100/331 (30.21%), Postives = 159/331 (48.04%), Query Frame = 2
Query:   74 IPRICSRNVTLSNSTCCPIY--NDFVCGGP-FRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLA-DFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQ---ESNSTFFKWKPICPQKPNDFDCH--ICDPSQEEPFLWRKYSST-----VDRLPNQNEIDELFSINQYDSEP 1024
             PR+C+    L    CCP +  +   CG    RG+CE  ++           +G    DDR  WP  F+   C C  N+ G  C  C  G+ GENC       +R+NI ++   +    +S LN++K  ++ D+++   +   + +  N  N      S+YD  V++H+Y SR+ +        TD    +DF H  PAF  WHR YLL +E  +R +     G  +FT PYWDW +   C++CT++L+GD  T+D       S F  W+ +C Q   D+     +CD ++E P   R+         V+RLP  ++++   S+  YD+ P
Sbjct:   20 FPRMCATQEALRTKECCPTWEGDGSACGASSGRGTCEDVVVSAQPDGPQYPFSGL---DDREKWPLVFYNRTCQCTENFMGFNCGDCMFGYFGENCNERR-ESLRRNIFHLSRAERIKLVSYLNLAKQTISRDYVVVTGT---YREMQNGTNPMFAEVSVYDVFVWMHYYVSRNALLGGPGNVWTD----VDFGHWAPAFLPWHRAYLLHWEHEIRKLT----GDMSFTTPYWDWRDAQGCDVCTDELMGDRSTQDPSLISPGSVFSSWRVLCSQA-QDYSARGVLCDATEEGPL--RRNPGNHNRNLVERLPTSDDVEFTLSLTNYDTGP 332          

HSP 2 Score: 79.337 bits (194), Expect = 3.785e-54
Identity = 40/97 (41.24%), Postives = 61/97 (62.89%), Query Frame = 3
Query: 1122 LGRDSPIKIS*CIICFINGTWMDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRS--TYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAY 1406
            LG  S + +   +  ++NG+      S NDP+FLLHH F+D ++E WL R+R S   YP +S+ PIG +++  + PFLPL RN++ F S+ + GY Y
Sbjct:  355 LGNSSRLGMHAALHVYMNGSMSSVQGSANDPIFLLHHAFVDCLYEQWLRRHRPSPNQYP-ESNAPIGHNSEYHMAPFLPLHRNQDFFISSKDLGYEY 450          
The following BLAST results are available for this feature:
BLAST of tyrosinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
DCT1.657e-3931.85dopachrome tautomerase [Source:HGNC Symbol;Acc:HGN... [more]
DCT2.110e-3931.85dopachrome tautomerase [Source:HGNC Symbol;Acc:HGN... [more]
TYRP14.570e-3527.40tyrosinase related protein 1 [Source:HGNC Symbol;A... [more]
TYR1.303e-3330.09tyrosinase [Source:HGNC Symbol;Acc:HGNC:12442][more]
DCT8.627e-1432.61dopachrome tautomerase [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of tyrosinase vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tyrosinase vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tyrosinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
tyr1.432e-4130.75tyrosinase [Source:ZFIN;Acc:ZDB-GENE-991026-3][more]
tyrp1a8.085e-4032.44tyrosinase-related protein 1a [Source:ZFIN;Acc:ZDB... [more]
dct1.154e-3630.31dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
dct1.434e-3630.31dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
dct1.461e-3630.31dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of tyrosinase vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
tyr3.809e-4432.06tyrosinase [Source:Xenbase;Acc:XB-GENE-988578][more]
ENSXETT00000043458.33.830e-4028.21pep:known scaffold:JGI_4.2:GL173409.1:196475:19881... [more]
dct4.776e-4029.63dopachrome tautomerase [Source:Xenbase;Acc:XB-GENE... [more]
ENSXETT00000002949.23.691e-3830.79pep:known scaffold:JGI_4.2:GL175957.1:2840:6117:-1... [more]
tyrp14.360e-3630.00tyrosinase-related protein 1 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of tyrosinase vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Tyr4.406e-3931.12tyrosinase [Source:MGI Symbol;Acc:MGI:98880][more]
Dct3.687e-3830.49dopachrome tautomerase [Source:MGI Symbol;Acc:MGI:... [more]
Tyrp11.787e-3328.53tyrosinase-related protein 1 [Source:MGI Symbol;Ac... [more]
Tyrp11.787e-3328.53tyrosinase-related protein 1 [Source:MGI Symbol;Ac... [more]
Tyrp16.885e-2231.19tyrosinase-related protein 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of tyrosinase vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P55024|TYRO_CHICK5.418e-4131.79Tyrosinase OS=Gallus gallus GN=TYR PE=2 SV=1[more]
sp|Q4R1H1|TYRP2_PIG6.664e-4130.43L-dopachrome tautomerase OS=Sus scrofa GN=DCT PE=2... [more]
sp|O93505|TYRP2_CHICK3.973e-3931.34L-dopachrome tautomerase OS=Gallus gallus GN=DCT P... [more]
sp|Q08410|TYRO_COTJA5.960e-3934.07Tyrosinase (Fragment) OS=Coturnix coturnix japonic... [more]
sp|P40126|TYRP2_HUMAN8.514e-3931.85L-dopachrome tautomerase OS=Homo sapiens GN=DCT PE... [more]
back to top
BLAST of tyrosinase vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|H9B8J5|H9B8J5_SCHMD4.203e-16996.17Tyrosinase OS=Schmidtea mediterranea PE=2 SV=1[more]
tr|A0A183VMI2|A0A183VMI2_TRIRE7.675e-6037.43Uncharacterized protein OS=Trichobilharzia regenti... [more]
tr|A0A1I8GS15|A0A1I8GS15_9PLAT1.760e-5435.74Uncharacterized protein OS=Macrostomum lignano PE=... [more]
tr|H2TGS7|H2TGS7_TAKRU2.740e-5430.09Uncharacterized protein OS=Takifugu rubripes GN=TY... [more]
tr|I3JAR0|I3JAR0_ORENI3.785e-5430.21Uncharacterized protein OS=Oreochromis niloticus G... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 2..24
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 108..130
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..15
score: 0.843
IPR002227Tyrosinase copper-binding domainPFAMPF00264Tyrosinasecoord: 8..37
e-value: 7.6E-8
score: 32.8
IPR002227Tyrosinase copper-binding domainPROSITEPS00498TYROSINASE_2coord: 19..30
IPR002227Tyrosinase copper-binding domainPRINTSPR00092TYROSINASEcoord: 215..232
score: 51.25
coord: 250..255
score: 77.21
IPR002227Tyrosinase copper-binding domainPFAMPF00264Tyrosinasecoord: 179..361
e-value: 6.4E-18
score: 65.7
IPR002227Tyrosinase copper-binding domainPROSITEPS00497TYROSINASE_1coord: 215..232
IPR008922Uncharacterised domain, di-copper centreGENE3DG3DSA:1.10.1280.10coord: 7..86
e-value: 3.0E-15
score: 56.0
IPR008922Uncharacterised domain, di-copper centreSUPERFAMILYSSF48056Di-copper centre-containing domaincoord: 5..86
IPR008922Uncharacterised domain, di-copper centreGENE3DG3DSA:1.10.1280.10coord: 84..389
e-value: 2.0E-34
score: 119.0
IPR008922Uncharacterised domain, di-copper centreSUPERFAMILYSSF48056Di-copper centre-containing domaincoord: 81..317

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002227Tyrosinase_Cu-bd
IPR008922Unchr_di-copper_centre
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000075optic cup
PLANA:0000031pigment cup cell
PLANA:0000124visual system
PLANA:0000036eye
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000007Stage 7
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006796 ID=SMED30006796|Name=tyrosinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1755bp
TGTCAGTTTAGTCATGCTCGTAATCACAATAGGCATAGTCTTTGCATCTT
TCTTACCTTTGAGTGACTGCCTAATCCCAAGGATTTGCAGTAGGAATGTC
ACTCTTTCTAATTCAACATGTTGTCCAATTTATAATGATTTTGTTTGCGG
TGGTCCTTTTCGTGGATCTTGTGAAGTCTCCATTCTTTTTCAAAATCACA
CTGAGCACTCGGATGTTATCACCGGAAAATTGGAAAATGACGACAGACTC
AACTGGCCATCAAGATTTTTTAAATTTCTTTGCAGTTGCAAGTCAAACTA
TGATGGAATAGCCTGTGACAAGTGTAAATCAGGGTGGCAAGGGGAAAACT
GTGAGGTGGTCTCCCCGAGAAAGATTAGACAAAATATTCTTAACATGAGA
TCATACGATGTTTTTATTTTTTTATCGATACTGAACATCAGCAAATATCA
GTTGGCCGATTTCCTGATCACAAATTCGTCCTCAAACCTTCACTGTGACC
CTGTCAATGAAGACAACATTCAATTGGTCAATGCTTCCATTTATGATACA
ATGGTTTACTTACATTTCTATGCGTCCAGGAGTACAATGTCTAAAGAACT
TATGGAATCCTGCACAGACAAGGATAACAAATTAGACTTCGCTCATAAAG
GTCCAGCTTTTTTTACATGGCACCGACATTATTTACTGATGTTTGAAGAC
TTATTAAGGAGTATTGCAGTCGAACAATTTGGATATTATAATTTCACATT
ACCATATTGGGACTGGACGAATCAAATAACTTGTAATATATGTACAAATG
ACTTACTTGGCGATATTCCCACTGAAGATCAAGAATCTAACAGCACATTT
TTTAAATGGAAACCGATTTGCCCTCAGAAACCTAACGATTTTGATTGTCA
TATTTGCGATCCAAGCCAGGAAGAACCTTTTTTATGGAGAAAATACTCAT
CAACGGTAGACAGACTTCCTAATCAGAACGAAATTGATGAGTTATTCTCA
ATCAACCAATATGATTCGGAGCCCTTCAATTCCAGCTCATTTAGTAGGAA
AAGCTTTCGGAATTTTGCAGAGGGATATTATCGAGTTCATCCAAACTCAG
ATGATATGAAAATGAAAGACATTGGGAAGGGACTCCCCCATCAAAATATC
ATGATGCATAATATGTTTTATCAATGGAACTTGGATGGATTTCACAACGA
GTCCCAATGATCCATTATTTCTACTACATCATACGTTTATGGACAAAATC
TTTGAAATTTGGCTATTAAGAAATAGACGATCTACATACCCTGGGAAATC
TTCAACACCAATCGGGCAGCATGCTGACGATTTTATTGTGCCTTTCCTTC
CACTAATCAGAAACAGGAATTTGTTTACTTCAGCAAATGAATTTGGCTAC
GCCTACGATAACAATATTGTTGGAAATAAATTGTTCACAAATCATCAACT
AGATTTCGAAAAGAGCTCATCGGAAATTTACTACATCCTAACGGCAGTTG
CCTTTGTAGTACTAGTTGCGATCGTCGTCGGATTGTACTGCTTCAGACCC
AGTCAAATCAGTCACACGGCTTATGAATTCATTGAAGACCAGGAGCAGGA
GGAAAAGACAAATTACTTTAACAACAATGAAAAAATGCCTCTACTGAAAT
GACAAGCCATTTCTGATGACTATTATAATATTGTCACCTTAAATTTTCTT
TGAAACAACTTTATTATTGACAAATTTTGAAGAATCCTTTTAAGCAAAAT
AAAGT
back to top

protein sequence of SMED30006796-orf-1

>SMED30006796-orf-1 ID=SMED30006796-orf-1|Name=SMED30006796-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MDFTTSPNDPLFLLHHTFMDKIFEIWLLRNRRSTYPGKSSTPIGQHADDF
IVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLFTNHQLDFEKSSSEIYY
ILTAVAFVVLVAIVVGLYCFRPSQISHTAYEFIEDQEQEEKTNYFNNNEK
MPLLK*
back to top

protein sequence of SMED30006796-orf-2

>SMED30006796-orf-2 ID=SMED30006796-orf-2|Name=SMED30006796-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=403bp
VSLVMLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYNDFVCG
GPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNY
DGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQ
LADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTMSKEL
MESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTL
PYWDWTNQITCNICTNDLLGDIPTEDQESNSTFFKWKPICPQKPNDFDCH
ICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEPFNSSSFSRK
SFRNFAEGYYRVHPNSDDMKMKDIGKGLPHQNIMMHNMFYQWNLDGFHNE
SQ*
back to top
Aliases
The feature 'tyrosinase' has the following synonyms
Synonym
tyrosinase
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006796
GenBankAFC87780.1