protein arginine N-methyltransferase 3

Overview
Nameprotein arginine N-methyltransferase 3
Smed IDSMED30006795
Length (bp)1576
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protein arginine N-methyltransferase 3 (SMED30006795) t-SNE clustered cells

Violin plots show distribution of expression levels for protein arginine N-methyltransferase 3 (SMED30006795) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protein arginine N-methyltransferase 3 (SMED30006795) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protein arginine N-methyltransferase 3 (SMED30006795) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006795

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006795h1SMcG0021079 SmedASXL_002038SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006795h1SMcG0021079 SmedASXL_002038SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30006795h1SMcG0021079 dd_Smed_v4_5624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Human
Match: PRMT3 (protein arginine methyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:30163])

HSP 1 Score: 318.931 bits (816), Expect = 2.925e-102
Identity = 189/503 (37.57%), Postives = 282/503 (56.06%), Query Frame = 3
Query:   57 DDNSDSYEGDEMQSFNYICLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVN-CDEI-NKGVWKSDEYLKPVIDDDNLLFIDYENVFQIC---------LPENSNRINELENELSICTETIAILRNKITDLLECD------VNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNA 1514
            +D++D   G +       CL C   F   EE  +H  + H FN   ++    +   Y +IK+IN+IR  N  V   + I N   W+ +EYLKPV++DD LL  D E++++           L EN++ + +L++  +      A L     DL +        V  T     + S    +    +ED  YF+ Y HY IH+ M+KDKIRTESYR FI +N    F++K+VLD+GCGTGILSMFAA+AGA  V G+D ++I+Y AM I+  N L++ ITLI GK+E+  LP +KVDV+ISEWMGYFL++ESMLDSV+Y   KYL    G V+P   T+++V        A+ +  W+DV+GF MS MK  V+ E +V+V+    ++++ C I+  D    +              F L   ++    A+  YFD +F   +  N V+FSTGP +  THWKQT+ LL++P  V  GE ++G ++V ++ +  R L  +L +NN+ 
Sbjct:   36 EDDADLPHGKQQTP----CLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEF-YGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPH-IFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYL-AKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLE-----FSSDFTLKITRTSMCTAIAGYFDIYF-EKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNST 525          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Human
Match: PRMT3 (protein arginine methyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:30163])

HSP 1 Score: 295.819 bits (756), Expect = 3.939e-94
Identity = 165/419 (39.38%), Postives = 245/419 (58.47%), Query Frame = 3
Query:  303 WKSDEYLKPVIDDDNLLFIDYENVFQIC---------LPENSNRINELENELSICTETIAILRNKITDLLECD------VNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNA 1514
            W+ +EYLKPV++DD LL  D E++++           L EN++ + +L++  +      A L     DL +        V  T     + S    +    +ED  YF+ Y HY IH+ M+KDKIRTESYR FI +N    F++K+VLD+GCGTGILSMFAA+AGA  V G+D ++I+Y AM I+  N L++ ITLI GK+E+  LP +KVDV+ISEWMGYFL++ESMLDSV+Y   KYL    G V+P   T+++V        A+ +  W+DV+GF MS MK  V+ E +V+V+    ++++ C I+  D    +              F L   ++    A+  YFD +F   +  N V+FSTGP +  THWKQT+ LL++P  V  GE ++G ++V ++ +  R L  +L +NN+ 
Sbjct:   53 WEKEEYLKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPH-IFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYL-AKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLE-----FSSDFTLKITRTSMCTAIAGYFDIYF-EKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNST 463          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Human
Match: PRMT1 (protein arginine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:5187])

HSP 1 Score: 240.736 bits (613), Expect = 4.134e-74
Identity = 135/341 (39.59%), Postives = 205/341 (60.12%), Query Frame = 3
Query:  504 TIKPPVNE---SKITKSSKLNEEDQA----YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            +++PP+ E    +   S K N ED      YF  Y+H+ IH+ M+KD++RT +YR  +  N R  F++K+VLD+G GTGIL MFAA+AGA  V GI+C+ I   A+ IV+ N L   +T+I GK+E+ ELP +KVD++ISEWMGY L YESML++V+Y   K+L P  GL+FP   TL V   +   Y+   +  W +V+GFDMS +K   ++E +VDVV    ++T+ CLI++ D+  +      V        F L   ++    ALVAYF+  F    +  G  FST P +  THWKQT+  ++  + V  GE+I G + +  +++  R L+F++ ++
Sbjct:   23 SLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHN-RHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAP-DGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTV-----KVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTG--FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLD 354          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Human
Match: PRMT1 (protein arginine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:5187])

HSP 1 Score: 236.498 bits (602), Expect = 1.106e-72
Identity = 132/325 (40.62%), Postives = 197/325 (60.62%), Query Frame = 3
Query:  543 SSKLNEEDQA----YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            S K N ED      YF  Y+H+ IH+ M+KD++RT +YR  +  N R  F++K+VLD+G GTGIL MFAA+AGA  V GI+C+ I   A+ IV+ N L   +T+I GK+E+ ELP +KVD++ISEWMGY L YESML++V+Y   K+L P  GL+FP   TL V   +   Y+   +  W +V+GFDMS +K   ++E +VDVV    ++T+ CLI++ D+  +      V        F L   ++    ALVAYF+  F    +  G  FST P +  THWKQT+  ++  + V  GE+I G + +  +++  R L+F++ ++
Sbjct:   21 SEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHN-RHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAP-DGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTV-----KVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTG--FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLD 336          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Human
Match: PRMT8 (protein arginine methyltransferase 8 [Source:HGNC Symbol;Acc:HGNC:5188])

HSP 1 Score: 236.884 bits (603), Expect = 2.929e-72
Identity = 129/331 (38.97%), Postives = 204/331 (61.63%), Query Frame = 3
Query:  528 SKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDV-----QQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            SK+    ++   D  YF  Y+H+ IH+ M+KD++RT +YR  +  N +  F++K+VLD+G GTGILSMFAA+AGA  V+GI+C+ I   +  I++ N L   IT+  GK+E+ ELP +KVD++ISEWMGY L YESML++V++   K+L P  GL+FP    L VV  +   Y+   +  W +V+GFDM+ ++   M+E +VD+V    V+T+ CLI++ D+     ++++F  +A C Q+    +           ALV YF+  F    +  G  FST P A  THWKQT+  L+  + V +GE+I G +S+  +++  R L+F++ ++
Sbjct:   62 SKLLNPEEMTSRDY-YFDSYAHFGIHEEMLKDEVRTLTYRNSMYHN-KHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKP-GGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSF-TSAFCLQIQRNDY---------VHALVTYFNIEFTKCHKKMG--FSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLD 377          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Celegans
Match: prmt-1 (Protein arginine N-methyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2X0])

HSP 1 Score: 212.616 bits (540), Expect = 5.011e-64
Identity = 114/314 (36.31%), Postives = 184/314 (58.60%), Query Frame = 3
Query:  573 YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDT-ELP--CDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            YF  Y+H+ IH+ M+KD++RT +YR  I  N    F++K+V+D+G GTGILSMFAA+AGA  V+ ++ +++   +  I+  N L   + +I  K+ED  ELP   +KVD++ISEWMGY L YESML++V+    ++L P +G++FP    L V   +   Y+ + +  W+ V+GF+MS++K   ++E +VD+V +  V T+ CL++D D+  +            +  F+L   +S    A V +F   F    +  G  FSTGP    THWKQT+  L   + V KGE+I G   +  +   +R L+ +++ +
Sbjct:   27 YFDSYAHFGIHEEMLKDEVRTTTYRNSIYHNSH-LFKDKVVMDVGSGTGILSMFAAKAGAKKVFAMEFSNMALTSRKIIADNNLDHIVEVIQAKVEDVHELPGGIEKVDIIISEWMGYCLFYESMLNTVLVARDRWLAP-NGMLFPDKARLYVCAIEDRQYKEDKIHWWDSVYGFNMSAIKNVAIKEPLVDIVDNAQVNTNNCLLKDVDLYTVKIEDLT-----FKSDFKLRCTRSDYIQAFVTFFTVEFSKCHKKTG--FSTGPDVQYTHWKQTVFYLKDALTVKKGEEITGSFEMAPNKNNERDLDINISFD 331          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Celegans
Match: prmt-1 (Protein arginine N-methyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2X0])

HSP 1 Score: 212.616 bits (540), Expect = 5.011e-64
Identity = 114/314 (36.31%), Postives = 184/314 (58.60%), Query Frame = 3
Query:  573 YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDT-ELP--CDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            YF  Y+H+ IH+ M+KD++RT +YR  I  N    F++K+V+D+G GTGILSMFAA+AGA  V+ ++ +++   +  I+  N L   + +I  K+ED  ELP   +KVD++ISEWMGY L YESML++V+    ++L P +G++FP    L V   +   Y+ + +  W+ V+GF+MS++K   ++E +VD+V +  V T+ CL++D D+  +            +  F+L   +S    A V +F   F    +  G  FSTGP    THWKQT+  L   + V KGE+I G   +  +   +R L+ +++ +
Sbjct:   27 YFDSYAHFGIHEEMLKDEVRTTTYRNSIYHNSH-LFKDKVVMDVGSGTGILSMFAAKAGAKKVFAMEFSNMALTSRKIIADNNLDHIVEVIQAKVEDVHELPGGIEKVDIIISEWMGYCLFYESMLNTVLVARDRWLAP-NGMLFPDKARLYVCAIEDRQYKEDKIHWWDSVYGFNMSAIKNVAIKEPLVDIVDNAQVNTNNCLLKDVDLYTVKIEDLT-----FKSDFKLRCTRSDYIQAFVTFFTVEFSKCHKKTG--FSTGPDVQYTHWKQTVFYLKDALTVKKGEEITGSFEMAPNKNNERDLDINISFD 331          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Celegans
Match: prmt-9 (PRotein arginine MethylTransferase [Source:UniProtKB/TrEMBL;Acc:O02325])

HSP 1 Score: 50.8322 bits (120), Expect = 2.302e-6
Identity = 44/146 (30.14%), Postives = 72/146 (49.32%), Query Frame = 3
Query:  603 HDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGID---CADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFL----IYESMLDSVVYGC--RKYLDPSSGLVFPRYFT 1013
            H  MI D  R E++ K + +  +   R  +V DIG GTGILS  AAR     V  ++   C  +I  +  ++++NG++ ++  +H K       C+K D+V+SE +   +    I E+ LD+ V     R    P    V+ R F+
Sbjct:  142 HIRMINDVKRNEAFAKALNDTIKS--RITVVFDIGSGTGILSAIAARKTNL-VTALEENMCLTMI--SKEVLKRNGVESRVN-VHAKNSTYFETCEKADIVVSETLDCCVFGEKIVETFLDAHVRFSHDRTIFIPHQATVYVRLFS 281          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Fly
Match: Art3 (gene:FBgn0038306 transcript:FBtr0083135)

HSP 1 Score: 290.812 bits (743), Expect = 2.203e-92
Identity = 173/482 (35.89%), Postives = 271/482 (56.22%), Query Frame = 3
Query:   78 EGDEMQSFNYICLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINV-NCDEINKGVWKSDEYLKPVIDDDNLLFIDYENV------FQICLPENSNRINELENELSICTETIAILRNKITDLLECDVNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAI 1502
            EGDE+ +    CL C  +   I   + H+   H  N  Q+ +   + ++Y +IK+INYIR   I+          +W+ ++YL+P  + +  L  DYE +       Q  + E   RI E    L    E +  +RN    LL+  V+   +P  ++  + +++     D  YF  Y+H+ IH  M+ DK+RT +YR  + +N     R K VLD+GCGTGILS+FA++AGAA V GID +DI+Y AM I+ KN + E + LI G+LEDT+LP  K D++ISEWMGYFL+YESMLDS++Y    +L+P +G++ P   TL+++G       A+ V+ W++V+  DMS ++   + E ++ VV ++ ++T+   I ++D+  +        P     QF L   K G+  A V YF+T F   + P+ VMFST P A  THWKQT+  ++ P  V +G+ I G ++  RH +  RGL+  + +
Sbjct:    3 EGDELTT----CLFCTETSANISVAIDHLDARHKVNLSQLQRKFEM-DQYSFIKLINYIRAKKISAEQLLSAEHPLWQDEKYLQPG-EYEPWLCYDYEVLKTDGAPTQPSVLELQQRIAEQSQLLQQANEDMERMRNDYKALLQ-KVHADGEPKGSDQSVPRNNVC--LDNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQN-EAVVRGKTVLDVGCGTGILSIFASKAGAARVVGIDNSDIVYTAMDIIRKNKV-ENVELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSIIYARENHLNP-NGIILPSRCTLSLLGYGDDTLYADEVEFWSNVYEVDMSDLRKQSIEEPLMQVVDAEFMLTEPEQIANFDIMTVDMN----YPNFT-HQFSLKVTKPGRLSAFVGYFETLF---ELPSPVMFSTSPSATPTHWKQTVFFIENPQVVKEGDVICGKITSRRHKEDVRGLSVDIEV 464          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Fly
Match: Art3 (gene:FBgn0038306 transcript:FBtr0083134)

HSP 1 Score: 287.73 bits (735), Expect = 1.075e-90
Identity = 169/471 (35.88%), Postives = 265/471 (56.26%), Query Frame = 3
Query:  111 CLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINV-NCDEINKGVWKSDEYLKPVIDDDNLLFIDYENV------FQICLPENSNRINELENELSICTETIAILRNKITDLLECDVNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAI 1502
            CL C  +   I   + H+   H  N  Q+ +   + ++Y +IK+INYIR   I+          +W+ ++YL+P  + +  L  DYE +       Q  + E   RI E    L    E +  +RN    LL+  V+   +P  ++  + +++     D  YF  Y+H+ IH  M+ DK+RT +YR  + +N     R K VLD+GCGTGILS+FA++AGAA V GID +DI+Y AM I+ KN + E + LI G+LEDT+LP  K D++ISEWMGYFL+YESMLDS++Y    +L+P +G++ P   TL+++G       A+ V+ W++V+  DMS ++   + E ++ VV ++ ++T+   I ++D+  +        P     QF L   K G+  A V YF+T F   + P+ VMFST P A  THWKQT+  ++ P  V +G+ I G ++  RH +  RGL+  + +
Sbjct:   52 CLFCTETSANISVAIDHLDARHKVNLSQLQRKFEM-DQYSFIKLINYIRAKKISAEQLLSAEHPLWQDEKYLQPG-EYEPWLCYDYEVLKTDGAPTQPSVLELQQRIAEQSQLLQQANEDMERMRNDYKALLQ-KVHADGEPKGSDQSVPRNNVC--LDNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQN-EAVVRGKTVLDVGCGTGILSIFASKAGAARVVGIDNSDIVYTAMDIIRKNKV-ENVELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSIIYARENHLNP-NGIILPSRCTLSLLGYGDDTLYADEVEFWSNVYEVDMSDLRKQSIEEPLMQVVDAEFMLTEPEQIANFDIMTVDMN----YPNFT-HQFSLKVTKPGRLSAFVGYFETLF---ELPSPVMFSTSPSATPTHWKQTVFFIENPQVVKEGDVICGKITSRRHKEDVRGLSVDIEV 506          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Fly
Match: Art1 (gene:FBgn0037834 transcript:FBtr0082304)

HSP 1 Score: 231.106 bits (588), Expect = 1.242e-70
Identity = 127/316 (40.19%), Postives = 191/316 (60.44%), Query Frame = 3
Query:  573 YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELP--CDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRD---YDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            YF  Y+H+ IH+ M+KD++RT +YR  +  N +  F+ K VLD+GCGTGILSMFAA+AGAA V  +DC++II  A  +V  N L++ IT++ GK+E+ ELP   + VD++ISEWMGY L YESMLD+V+Y   K+L    G++FP   TL +   +   Y+ E ++ W+DV+GFDMS ++   + E +VDVV    V++  C++++   Y VQ+     ++        +F L   ++    ALV YF+  F    +  G  FST P +  THWKQT+  LD  +   K E+I G   +  + +  R L+F + IN
Sbjct:   56 YFDSYAHFGIHEEMLKDEVRTVTYRNAMYHN-KHLFQGKTVLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWL-KKDGMMFPDRGTLYITAIEDRQYKDEKINWWDDVYGFDMSCIRKVAVTEPLVDVVDPKQVVSTSCMVKEVDLYTVQKADLNFSS--------KFSLCIKRNDFVQALVTYFNIEFTKCHKRLG--FSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQMKPNERNNRDLDFVIDIN 359          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Fly
Match: Art6 (gene:FBgn0038189 transcript:FBtr0082878)

HSP 1 Score: 204.142 bits (518), Expect = 7.851e-61
Identity = 115/320 (35.94%), Postives = 181/320 (56.56%), Query Frame = 3
Query:  552 LNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELP--CDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            L  +D  YF  YS    H  M++D +R +++R  I ++G   F++KIVLD+GCGTGILS+FAA AGA+ V  ++C DI   A  I+  N  +  + ++ G +E  ELP   +KVD+++SEWMG  L  E+M++SV++   K+L    G + P    L ++GA    +R  +++ W +V G DM  ++    +E +V+ VP   ++TD C I   ++       A   P   +  FQL  +++G    LV YFD  F S      V  +T P +  THW+QT+L LD+P+ V   +++RG L++    Q  RG+NF L I+
Sbjct:   12 LEGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDG-GLFQDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFARDKWLT-RGGRILPSTGNLWLMGA-YDPHRRTNLNFWCNVEGIDMGCVRKPFSQEPLVEFVPIQQLLTDECFIHSTNL-----AVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLFPSGKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHIS 323          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Fly
Match: Art2 (gene:FBgn0031592 transcript:FBtr0077476)

HSP 1 Score: 190.274 bits (482), Expect = 2.611e-55
Identity = 113/337 (33.53%), Postives = 181/337 (53.71%), Query Frame = 3
Query:  519 VNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELP--CDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNAAQK 1523
             + ++I K  +  EE   YF  Y    IH+ ++KD +R ++YR+ I+ N  E+FR+K VLD+GCG G+LSMFAA+AG+  V  ++ A I   A  +V+ N     I +I GK+ED ELP    KVD+++ +WMG  L   +ML+S+++   K+L  ++G ++P    L +        R + +  W+DV GFD+S+++     + +V+ V  D +M+  CL++  D+       A          F+L   ++G    LVAYFD  F    Q   + FST P A  THW QT+  L+ P+ V  GE I+G L++           F + +N +  +K
Sbjct:   17 TDANQIIKDRRRQEEH--YFKLYGRIEIHEWLLKDSVRIKAYREAIQHN--EFFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLLFARDKWL-SATGHIYPDTAQLYLAAI---KGRDQDLGFWHDVHGFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKS-----RSLFELKVSRNGWVHGLVAYFDVGFSKSTQR--ISFSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGVLTMKPSEDSIFDTEFDIFVNFDGREK 338          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Zebrafish
Match: prmt3 (protein arginine methyltransferase 3 [Source:ZFIN;Acc:ZDB-GENE-041105-1])

HSP 1 Score: 305.064 bits (780), Expect = 1.664e-97
Identity = 179/481 (37.21%), Postives = 268/481 (55.72%), Query Frame = 3
Query:  111 CLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVNCDEINKG---VWKSDEYLKPVIDDDNLLFIDYENVFQICLPENS----------NRINELENELSICTETIAILRNKITDLLECDVN-ETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNN 1511
            CL C+ +   + E   H    H  +   +++   + ++Y +IK+INYIR    +     +       W  DEY+KP + DD LL ID E + +      S          +R+   E  L+   + +  L+     L+   +N +T   P     I +  +  +ED+AYF+ Y HYSIH+ M+KDK+RTESYR F+  N  + F++K+VLD+GCGTGILSMFAA+AGA  V  +D ++IIY AM IV  N L++ ITLI G++E+ +LP +KVD++ISEWMGYFL++ESMLDSV+Y   +YL    GLVFP   ++++     +    + +  W DV+GF M+ MK  V+ E +V+V+  + V+++  +I+  D      G  +V        F L    S    A+V YFD FF      N VMFST P    THWKQT+ LL+ P+ V  GE + G +SV ++ +  R L  +L I  +
Sbjct:   30 CLFCDRNLTSVSETFQHCKADHGVDILDLVQKHKL-DDYGYIKMINYIRTTKCSAESLLLASDGPLPWDGDEYMKPALQDDPLLQIDVEELREASGGMGSSSAADQVNVEDRVQRAEEALARAMQDMHKLKLLAQGLV---LNADTSHGPTCSGAIAELRE--DEDEAYFSSYGHYSIHEEMLKDKVRTESYRDFMYRN-MDVFKDKVVLDVGCGTGILSMFAAKAGAKKVIAVDQSEIIYQAMDIVRSNNLEDTITLIKGRIEEIDLPVEKVDIIISEWMGYFLLFESMLDSVLYARDRYL-ADDGLVFPDRCSISLAAVGDTQKHNDRIAFWEDVYGFKMTCMKKAVIPEAVVEVLKPETVISESAVIKTIDC-----GSVSVSELEFSVDFILKITASSFCTAIVGYFDIFF-HKCCGNKVMFSTAPNCTKTHWKQTVFLLESPVAVKAGEDLPGHISVRKNRKDPRALLITLNIAGH 496          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Zebrafish
Match: prmt3 (protein arginine methyltransferase 3 [Source:ZFIN;Acc:ZDB-GENE-041105-1])

HSP 1 Score: 305.449 bits (781), Expect = 1.810e-97
Identity = 179/481 (37.21%), Postives = 268/481 (55.72%), Query Frame = 3
Query:  111 CLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVNCDEINKG---VWKSDEYLKPVIDDDNLLFIDYENVFQICLPENS----------NRINELENELSICTETIAILRNKITDLLECDVN-ETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNN 1511
            CL C+ +   + E   H    H  +   +++   + ++Y +IK+INYIR    +     +       W  DEY+KP + DD LL ID E + +      S          +R+   E  L+   + +  L+     L+   +N +T   P     I +  +  +ED+AYF+ Y HYSIH+ M+KDK+RTESYR F+  N  + F++K+VLD+GCGTGILSMFAA+AGA  V  +D ++IIY AM IV  N L++ ITLI G++E+ +LP +KVD++ISEWMGYFL++ESMLDSV+Y   +YL    GLVFP   ++++     +    + +  W DV+GF M+ MK  V+ E +V+V+  + V+++  +I+  D      G  +V        F L    S    A+V YFD FF      N VMFST P    THWKQT+ LL+ P+ V  GE + G +SV ++ +  R L  +L I  +
Sbjct:   39 CLFCDRNLTSVSETFQHCKADHGVDILDLVQKHKL-DDYGYIKMINYIRTTKCSAESLLLASDGPLPWDGDEYMKPALQDDPLLQIDVEELREASGGMGSSSAADQVNVEDRVQRAEEALARAMQDMHKLKLLAQGLV---LNADTSHGPTCSGAIAELRE--DEDEAYFSSYGHYSIHEEMLKDKVRTESYRDFMYRN-MDVFKDKVVLDVGCGTGILSMFAAKAGAKKVIAVDQSEIIYQAMDIVRSNNLEDTITLIKGRIEEIDLPVEKVDIIISEWMGYFLLFESMLDSVLYARDRYL-ADDGLVFPDRCSISLAAVGDTQKHNDRIAFWEDVYGFKMTCMKKAVIPEAVVEVLKPETVISESAVIKTIDC-----GSVSVSELEFSVDFILKITASSFCTAIVGYFDIFF-HKCCGNKVMFSTAPNCTKTHWKQTVFLLESPVAVKAGEDLPGHISVRKNRKDPRALLITLNIAGH 505          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Zebrafish
Match: prmt3 (protein arginine methyltransferase 3 [Source:ZFIN;Acc:ZDB-GENE-041105-1])

HSP 1 Score: 286.96 bits (733), Expect = 1.379e-90
Identity = 169/481 (35.14%), Postives = 262/481 (54.47%), Query Frame = 3
Query:  111 CLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVNCDEINKG---VWKSDEYLKPVIDDDNLLFIDYENVFQICLPENS----------NRINELENELSICTETIAILRNKITDLLECDVN-ETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNN 1511
            CL C+ +   + E   H    H  +   +++   + ++Y +IK+INYIR    +     +       W  DEY+KP + DD LL ID E + +      S          +R+   E  L+   + +  L+     L+   +N +T   P     I +  +  +ED+AYF+ Y HYSIH+ M+KDK+RTESYR F+  N  + F++K+VLD+GCGTGILSMFAA+AGA  V  +D ++IIY AM IV  N L++ ITLI G++E+ +LP +KVD++ISEWMGYFL++ESMLDSV+Y   +YL    GLVFP   ++++     +    + +  W DV+GF M+ MK  V+ E +V+V+  + V+++  +I+  D   ++           E +F +  +                I+      VMFST P    THWKQT+ LL+ P+ V  GE + G +SV ++ +  R L  +L I  +
Sbjct:   39 CLFCDRNLTSVSETFQHCKADHGVDILDLVQKHKL-DDYGYIKMINYIRTTKCSAESLLLASDGPLPWDGDEYMKPALQDDPLLQIDVEELREASGGMGSSSAADQVNVEDRVQRAEEALARAMQDMHKLKLLAQGLV---LNADTSHGPTCSGAIAELRE--DEDEAYFSSYGHYSIHEEMLKDKVRTESYRDFMYRN-MDVFKDKVVLDVGCGTGILSMFAAKAGAKKVIAVDQSEIIYQAMDIVRSNNLEDTITLIKGRIEEIDLPVEKVDIIISEWMGYFLLFESMLDSVLYARDRYL-ADDGLVFPDRCSISLAAVGDTQKHNDRIAFWEDVYGFKMTCMKKAVIPEAVVEVLKPETVISESAVIKTIDCGSVSVS---------ELEFSVDFI--------------LKITASSFCTVMFSTAPNCTKTHWKQTVFLLESPVAVKAGEDLPGHISVRKNRKDPRALLITLNIAGH 488          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Zebrafish
Match: prmt8b (protein arginine methyltransferase 8b [Source:NCBI gene;Acc:564110])

HSP 1 Score: 246.514 bits (628), Expect = 5.584e-77
Identity = 130/316 (41.14%), Postives = 197/316 (62.34%), Query Frame = 3
Query:  573 YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDV-----QQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            YF  Y+H+ IH+ M+KD++RT +YR  +  N +  F++KIVLD+G GTGILSMFAA+AGA HVYGI+C+ I   +  I++ N L   IT++ GK+E+TELP D+VD++ISEWMGY L YESML++V+Y   K+L P  G +FP   TL VV  +   Y+   +  W +V+GFDM+ ++   M E +VD+V    V+T+ CL+++ D+     + ++F  +A C Q+    +           ALV YF+  F    +  G  FST P A  THWKQT+  L+  + V +GE+I G ++V  +   +R L+F+  ++
Sbjct:   16 YFDSYAHFGIHEEMLKDEVRTLTYRNSMYHN-KHIFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITILKGKVEETELPVDQVDIIISEWMGYCLFYESMLNTVIYARDKWLKP-GGFMFPDRATLYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMMEPLVDIVDPKQVVTNSCLVKEVDIYTVKTEDLSF-TSAFCLQIQRNDY---------VHALVTYFNIEFTKCHKKTG--FSTAPDAPSTHWKQTVFYLEDYLTVRRGEEILGSITVRPNENNERDLDFTFELD 317          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Zebrafish
Match: PRMT8 (protein arginine N-methyltransferase 8-B-like [Source:NCBI gene;Acc:556054])

HSP 1 Score: 246.514 bits (628), Expect = 5.050e-76
Identity = 134/324 (41.36%), Postives = 201/324 (62.04%), Query Frame = 3
Query:  552 LNEEDQA----YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIE--RQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            LN E+      YF  Y+H+ IH+ M+KD++RT +YR  +  N +  F++KIVLD+G GTGILSMFAA+AGA HVYGI+C+ I   +  I++ N L   IT+  GK+E+TELP D+VD++ISEWMGY L YESML++V+Y   K+L P  GL+FP    L VV  +   Y+   +  W +V+GFDM+ ++   M+E +VD+V S  V+++ CLI++ D+         V P+ +     F L   ++    ALV YF+  F    +  G  FST P A  THWKQT+  L++ + V +GE+I G +S+  + +  R L+F+  ++
Sbjct:   81 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHN-KHIFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKANHLDSVITIFKGKVEETELPVDQVDIIISEWMGYCLFYESMLNTVIYARDKWLKP-GGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMKEPLVDIVDSKQVVSNSCLIKEVDIY-------TVKPEELSFTSSFCLQIQRNDYIHALVTYFNIEFTKCHKKTG--FSTAPDAPFTHWKQTVFYLEEYLTVKRGEEIVGTVSMKPNEKNVRDLDFTFELD 393          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 242.276 bits (617), Expect = 8.486e-75
Identity = 135/341 (39.59%), Postives = 205/341 (60.12%), Query Frame = 3
Query:  504 TIKPPVNESKITK---SSKLNEEDQA----YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            +++ P+ +   T+   S K N ED      YF  Y+H+ IH+ M+KD++RT +YR  +  N R  F++K+VLD+G GTGIL MFAA+AGA  V GI+C+ I   A+ IV+ N L   +T+I GK+E+ ELP +KVD++ISEWMGY L YESML++V+Y   K+L P  GL+FP   TL V   +   Y+   +  W +V+GFDMS +K   ++E +VDVV    ++T+ CLI++ D+  +               F L   ++    ALVAYF+  F    +  G  FST P +  THWKQT+  ++  + V  GE+I G +S+  +++  R L+F++ I+
Sbjct:   21 SLRTPIEDVSCTQPESSVKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHN-RHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIYARDKWLTP-DGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLT-----FTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTG--FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDID 352          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 241.891 bits (616), Expect = 1.090e-74
Identity = 135/341 (39.59%), Postives = 205/341 (60.12%), Query Frame = 3
Query:  504 TIKPPVNESKITK---SSKLNEEDQA----YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            +++ P+ +   T+   S K N ED      YF  Y+H+ IH+ M+KD++RT +YR  +  N R  F++K+VLD+G GTGIL MFAA+AGA  V GI+C+ I   A+ IV+ N L   +T+I GK+E+ ELP +KVD++ISEWMGY L YESML++V+Y   K+L P  GL+FP   TL V   +   Y+   +  W +V+GFDMS +K   ++E +VDVV    ++T+ CLI++ D+  +               F L   ++    ALVAYF+  F    +  G  FST P +  THWKQT+  ++  + V  GE+I G +S+  +++  R L+F++ I+
Sbjct:   11 SLRTPIEDVSCTQPESSVKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHN-RHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIYARDKWLTP-DGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLT-----FTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTG--FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDID 342          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 240.35 bits (612), Expect = 2.606e-74
Identity = 133/325 (40.92%), Postives = 197/325 (60.62%), Query Frame = 3
Query:  543 SSKLNEEDQA----YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            S K N ED      YF  Y+H+ IH+ M+KD++RT +YR  +  N R  F++K+VLD+G GTGIL MFAA+AGA  V GI+C+ I   A+ IV+ N L   +T+I GK+E+ ELP +KVD++ISEWMGY L YESML++V+Y   K+L P  GL+FP   TL V   +   Y+   +  W +V+GFDMS +K   ++E +VDVV    ++T+ CLI++ D+  +               F L   ++    ALVAYF+  F    +  G  FST P +  THWKQT+  ++  + V  GE+I G +S+  +++  R L+F++ I+
Sbjct:   15 SVKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHN-RHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIYARDKWLTP-DGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLT-----FTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTG--FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDID 330          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 240.35 bits (612), Expect = 2.665e-74
Identity = 133/325 (40.92%), Postives = 197/325 (60.62%), Query Frame = 3
Query:  543 SSKLNEEDQA----YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            S K N ED      YF  Y+H+ IH+ M+KD++RT +YR  +  N R  F++K+VLD+G GTGIL MFAA+AGA  V GI+C+ I   A+ IV+ N L   +T+I GK+E+ ELP +KVD++ISEWMGY L YESML++V+Y   K+L P  GL+FP   TL V   +   Y+   +  W +V+GFDMS +K   ++E +VDVV    ++T+ CLI++ D+  +               F L   ++    ALVAYF+  F    +  G  FST P +  THWKQT+  ++  + V  GE+I G +S+  +++  R L+F++ I+
Sbjct:   19 SVKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHN-RHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIYARDKWLTP-DGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLT-----FTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTG--FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDID 334          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Xenopus
Match: il1rap (interleukin 1 receptor accessory protein [Source:Xenbase;Acc:XB-GENE-492428])

HSP 1 Score: 240.35 bits (612), Expect = 3.109e-74
Identity = 133/325 (40.92%), Postives = 197/325 (60.62%), Query Frame = 3
Query:  543 SSKLNEEDQA----YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            S K N ED      YF  Y+H+ IH+ M+KD++RT +YR  +  N R  F++K+VLD+G GTGIL MFAA+AGA  V GI+C+ I   A+ IV+ N L   +T+I GK+E+ ELP +KVD++ISEWMGY L YESML++V+Y   K+L P  GL+FP   TL V   +   Y+   +  W +V+GFDMS +K   ++E +VDVV    ++T+ CLI++ D+  +               F L   ++    ALVAYF+  F    +  G  FST P +  THWKQT+  ++  + V  GE+I G +S+  +++  R L+F++ I+
Sbjct:   17 SVKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHN-RHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIYARDKWLTP-DGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVDDLT-----FTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTG--FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDID 332          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Mouse
Match: Prmt3 (protein arginine N-methyltransferase 3 [Source:MGI Symbol;Acc:MGI:1919224])

HSP 1 Score: 314.309 bits (804), Expect = 1.061e-100
Identity = 184/484 (38.02%), Postives = 274/484 (56.61%), Query Frame = 3
Query:  111 CLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVN-CDEI-NKGVWKSDEYLKPVIDDDNLLFIDYENVFQIC---------LPENSNRINELENELSICTETIAILRNKITDLLEC-----DVNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNA 1514
            CL C+  F   EE  +H    H FN   ++    +   Y +IK+IN+IR  N  V   + I N   W+ DEYLKPV++DD LL  D E++++           L E+++ + +L++  +      A L     DL +      D    +      S  T +    +ED  YF+ Y HY IH+ M+KDK+RTESYR FI +N    F++K+VLD+GCGTGILSMFAA+ GA  V  +D ++I+Y AM I+  N L++ I LI GK+E+  LP +KVDV+ISEWMGYFL++ESMLDSV+Y   KYL    G V+P   T+++V     +  A+ +  W+DV+GF+MS MK  V+ E +V+VV    +++D C I+  D    +              F L   K+    A+  YFD +F   +  N V+FSTGP +  THWKQT+ LL++P  V  GE ++G ++V ++ +  R L  +L +N++ 
Sbjct:   48 CLFCDRLFASAEETFSHCKLEHQFNIDSMVHKHGLEF-YGYIKLINFIRLKNPTVEYMNSIYNPVPWEKDEYLKPVLEDDLLLQFDVEDLYEPVSTPFSYPNGLSESASVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMNVDVRTCSSTTTIADLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPH-IFKDKVVLDVGCGTGILSMFAAKVGAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEKVDVIISEWMGYFLLFESMLDSVLYAKSKYL-AKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIKHIDCHTTSISDLE-----FSSDFTLRTTKTAMCTAVAGYFDIYF-EKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFPVKAGEALKGKITVHKNKKDPRSLIVTLTLNSST 522          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Mouse
Match: Prmt1 (protein arginine N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:107846])

HSP 1 Score: 238.81 bits (608), Expect = 1.401e-73
Identity = 134/341 (39.30%), Postives = 205/341 (60.12%), Query Frame = 3
Query:  504 TIKPPVNE---SKITKSSKLNEEDQA----YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            +++PP+ E    +   S K N ED      YF  Y+H+ IH+ M+KD++RT +YR  +  N R  F++K+VLD+G GTGIL MFAA+AGA  V GI+C+ I   A+ IV+ N L   +T+I GK+E+ ELP +KVD++ISEWMGY L YESML++V++   K+L P  GL+FP   TL V   +   Y+   +  W +V+GFDMS +K   ++E +VDVV    ++T+ CLI++ D+  +      V        F L   ++    ALVAYF+  F    +  G  FST P +  THWKQT+  ++  + V  GE+I G + +  +++  R L+F++ ++
Sbjct:   23 SLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHN-RHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAP-DGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTV-----KVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTG--FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLD 354          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Mouse
Match: Prmt8 (protein arginine N-methyltransferase 8 [Source:MGI Symbol;Acc:MGI:3043083])

HSP 1 Score: 236.884 bits (603), Expect = 1.867e-72
Identity = 129/331 (38.97%), Postives = 204/331 (61.63%), Query Frame = 3
Query:  528 SKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDV-----QQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            SK+    ++   D  YF  Y+H+ IH+ M+KD++RT +YR  +  N +  F++K+VLD+G GTGILSMFAA+AGA  V+GI+C+ I   +  I++ N L   IT+  GK+E+ ELP +KVD++ISEWMGY L YESML++V++   K+L P  GL+FP    L VV  +   Y+   +  W +V+GFDM+ ++   M+E +VD+V    V+T+ CLI++ D+     ++++F  +A C Q+    +           ALV YF+  F    +  G  FST P A  THWKQT+  L+  + V +GE+I G +S+  +++  R L+F++ ++
Sbjct:   62 SKLLNPEEMTSRDY-YFDSYAHFGIHEEMLKDEVRTLTYRNSMYHN-KHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNVITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKP-GGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSF-TSAFCLQIQRNDY---------VHALVTYFNIEFTKCHKKMG--FSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLD 377          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Mouse
Match: Prmt1 (protein arginine N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:107846])

HSP 1 Score: 234.572 bits (597), Expect = 3.953e-72
Identity = 131/325 (40.31%), Postives = 197/325 (60.62%), Query Frame = 3
Query:  543 SSKLNEEDQA----YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            S K N ED      YF  Y+H+ IH+ M+KD++RT +YR  +  N R  F++K+VLD+G GTGIL MFAA+AGA  V GI+C+ I   A+ IV+ N L   +T+I GK+E+ ELP +KVD++ISEWMGY L YESML++V++   K+L P  GL+FP   TL V   +   Y+   +  W +V+GFDMS +K   ++E +VDVV    ++T+ CLI++ D+  +      V        F L   ++    ALVAYF+  F    +  G  FST P +  THWKQT+  ++  + V  GE+I G + +  +++  R L+F++ ++
Sbjct:   21 SEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHN-RHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAP-DGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTV-----KVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTG--FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLD 336          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Mouse
Match: Prmt1 (protein arginine N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:107846])

HSP 1 Score: 216.468 bits (550), Expect = 1.183e-65
Identity = 120/298 (40.27%), Postives = 183/298 (61.41%), Query Frame = 3
Query:  612 MIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            M+KD++RT +YR  +  N R  F++K+VLD+G GTGIL MFAA+AGA  V GI+C+ I   A+ IV+ N L   +T+I GK+E+ ELP +KVD++ISEWMGY L YESML++V++   K+L P  GL+FP   TL V   +   Y+   +  W +V+GFDMS +K   ++E +VDVV    ++T+ CLI++ D+  +      V        F L   ++    ALVAYF+  F    +  G  FST P +  THWKQT+  ++  + V  GE+I G + +  +++  R L+F++ ++
Sbjct:   13 MLKDEVRTLTYRNSMFHN-RHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAP-DGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTV-----KVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTG--FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLD 301          
BLAST of protein arginine N-methyltransferase 3 vs. UniProt/SwissProt
Match: sp|O60678|ANM3_HUMAN (Protein arginine N-methyltransferase 3 OS=Homo sapiens OX=9606 GN=PRMT3 PE=1 SV=4)

HSP 1 Score: 318.931 bits (816), Expect = 1.405e-101
Identity = 189/503 (37.57%), Postives = 282/503 (56.06%), Query Frame = 3
Query:   57 DDNSDSYEGDEMQSFNYICLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVN-CDEI-NKGVWKSDEYLKPVIDDDNLLFIDYENVFQIC---------LPENSNRINELENELSICTETIAILRNKITDLLECD------VNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNA 1514
            +D++D   G +       CL C   F   EE  +H  + H FN   ++    +   Y +IK+IN+IR  N  V   + I N   W+ +EYLKPV++DD LL  D E++++           L EN++ + +L++  +      A L     DL +        V  T     + S    +    +ED  YF+ Y HY IH+ M+KDKIRTESYR FI +N    F++K+VLD+GCGTGILSMFAA+AGA  V G+D ++I+Y AM I+  N L++ ITLI GK+E+  LP +KVDV+ISEWMGYFL++ESMLDSV+Y   KYL    G V+P   T+++V        A+ +  W+DV+GF MS MK  V+ E +V+V+    ++++ C I+  D    +              F L   ++    A+  YFD +F   +  N V+FSTGP +  THWKQT+ LL++P  V  GE ++G ++V ++ +  R L  +L +NN+ 
Sbjct:   36 EDDADLPHGKQQTP----CLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEF-YGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPH-IFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYL-AKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLE-----FSSDFTLKITRTSMCTAIAGYFDIYF-EKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNST 525          
BLAST of protein arginine N-methyltransferase 3 vs. UniProt/SwissProt
Match: sp|O70467|ANM3_RAT (Protein arginine N-methyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Prmt3 PE=1 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 7.406e-101
Identity = 187/484 (38.64%), Postives = 273/484 (56.40%), Query Frame = 3
Query:  111 CLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVN-CDEI-NKGVWKSDEYLKPVIDDDNLLFIDYENVFQIC---------LPENSNRINELENELSICTETIAILRNKITDLLEC-----DVNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNA 1514
            CL C+  F   EE  +H    H FN   ++    +   Y +IK+IN+IR  N  V   + I N   W  DEYLKPV++DD LL  D E++++           L EN++ + +L+   +      A L     DL +      D    +      S  T +    +ED  YF+ Y HY IH+ M+KDK+RTESYR FI +N    F++K+VLD+GCGTGILSMFAA+AGA  V  +D ++I+Y AM I+  N L++ I LI GK+E+  LP +KVDV+ISEWMGYFL++ESMLDSV+Y   KYL    G V+P   T+++V     +  A+ +  W+DV+GF+MS MK  V+ E +V+VV    +++D C I+  D    +              F L   K+    A+  YFD +F   +  N V+FSTGP +  THWKQTI LL++P  V  GE ++G ++V ++ +  R L  +L +N++ 
Sbjct:   48 CLFCDRLFRSAEETFSHCKLEHQFNIDGMVHKHGLEF-YGYIKLINFIRLKNPTVEYMNSIYNPVPWDKDEYLKPVLEDDLLLQFDVEDLYEPVSAPFTYPNGLSENTSAVEKLKLMEARALSAEAALARAREDLQKMKQFAQDFVMNVDVRTCSSTTTIADLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPH-IFKDKVVLDVGCGTGILSMFAAKAGAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEKVDVIISEWMGYFLLFESMLDSVLYAKSKYL-AKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIKHIDCHTTSISDLE-----FSSDFTLRTTKTAMCTAVAGYFDIYF-EKNCHNRVVFSTGPQSTKTHWKQTIFLLEKPFPVKAGEALKGKITVHKNKKDPRSLIVTLTLNSST 522          
BLAST of protein arginine N-methyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q922H1|ANM3_MOUSE (Protein arginine N-methyltransferase 3 OS=Mus musculus OX=10090 GN=Prmt3 PE=1 SV=2)

HSP 1 Score: 314.309 bits (804), Expect = 7.960e-100
Identity = 184/484 (38.02%), Postives = 277/484 (57.23%), Query Frame = 3
Query:  111 CLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVN-CDEI-NKGVWKSDEYLKPVIDDDNLLFIDYENVFQIC---------LPENSNRINELENELSICTETIAILRNKITDLLEC-----DVNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNA 1514
            CL C+  F   EE  +H    H FN   ++    +   Y +IK+IN+IR  N  V   + I N   W+ DEYLKPV++DD LL  D E++++           L E+++ + +L++  +      A L     DL +      D    +      S  T +    +ED  YF+ Y HY IH+ M+KDK+RTESYR FI +N    F++K+VLD+GCGTGILSMFAA+ GA  V  +D ++I+Y AM I+  N L++ I LI GK+E+  LP +KVDV+ISEWMGYFL++ESMLDSV+Y   KYL    G V+P   T+++V     +  A+ +  W+DV+GF+MS MK  V+ E +V+VV    +++D C I+  D + +     ++        F L   K+    A+  YFD +F   +  N V+FSTGP +  THWKQT+ LL++P  V  GE ++G ++V ++ +  R L  +L +N++ 
Sbjct:   48 CLFCDRLFASAEETFSHCKLEHQFNIDSMVHKHGLEF-YGYIKLINFIRLKNPTVEYMNSIYNPVPWEKDEYLKPVLEDDLLLQFDVEDLYEPVSTPFSYPNGLSESASVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMNVDVRTCSSTTTIADLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPH-IFKDKVVLDVGCGTGILSMFAAKVGAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEKVDVIISEWMGYFLLFESMLDSVLYAKSKYL-AKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIK-MDGKHIDCHTTSISDLEFSSDFTLRTTKTAMCTAVAGYFDIYF-EKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFPVKAGEALKGKITVHKNKKDPRSLIVTLTLNSST 526          
BLAST of protein arginine N-methyltransferase 3 vs. UniProt/SwissProt
Match: sp|P38074|HMT1_YEAST (Protein arginine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HMT1 PE=1 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 1.139e-83
Identity = 140/321 (43.61%), Postives = 196/321 (61.06%), Query Frame = 3
Query:  537 TKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLA 1499
            T+ +KL+E +Q YF  Y HY IH+ M++D +RT SYR  I +N ++ F++KIVLD+GCGTGILSMFAA+ GA HV G+D + II  A  +VE NG  +KITL+ GKLED  LP  KVD++ISEWMGYFL+YESM+D+V+Y    YL    GL+FP   ++++ G + S Y+ E ++ W DV+GFD S     V+ E IVD V  ++V T    + ++D+  +     A      +  F+LTA +      +V +FD  F +P     V FSTGP A  THWKQTI      +D   G+ I G L    + +  R LN  ++
Sbjct:   11 TEKTKLSESEQHYFNSYDHYGIHEEMLQDTVRTLSYRNAIIQN-KDLFKDKIVLDVGCGTGILSMFAAKHGAKHVIGVDMSSIIEMAKELVELNGFSDKITLLRGKLEDVHLPFPKVDIIISEWMGYFLLYESMMDTVLYARDHYL-VEGGLIFPDKCSIHLAGLEDSQYKDEKLNYWQDVYGFDYSPFVPLVLHEPIVDTVERNNVNTTSDKLIEFDLNTVKISDLA-----FKSNFKLTAKRQDMINGIVTWFDIVFPAPKGKRPVEFSTGPHAPYTHWKQTIFYFPDDLDAETGDTIEGELVCSPNEKNNRDLNIKIS 324          
BLAST of protein arginine N-methyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q9URX7|ANM1_SCHPO (Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rmt1 PE=1 SV=2)

HSP 1 Score: 261.922 bits (668), Expect = 5.458e-82
Identity = 141/331 (42.60%), Postives = 207/331 (62.54%), Query Frame = 3
Query:  528 SKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNAAQ 1520
            +K +  S L  +D  YF  YSH+ IH+ M+KD +RT SYR  I +N    FR+KIVLD+GCGTGILSMF ARAGA HVYG+D ++II+ A+ IVE N L ++ITLI GK+E+ +LP +KVD+++SEWMGYFL+YESMLD+V+    +YL P  GL+FP    + +   + + Y++E +  W+DV+GFD S +K +V +E +VD V    V T+ C+I D D++ +     A         F++TA ++    A +A+FD  F +  +P  + FSTGP +  THWKQT+    + + V  GE IRG ++        R L+  ++   N  +
Sbjct:    5 TKKSADSGLTAKDY-YFDSYSHWGIHEEMLKDDVRTLSYRDAIMQNPH-LFRDKIVLDVGCGTGILSMFCARAGAKHVYGVDMSEIIHKAVQIVEVNKLSDRITLIQGKMEEIQLPVEKVDIIVSEWMGYFLLYESMLDTVLVARDRYLAP-DGLLFPDRAQIQLAAIEDADYKSEKIGFWDDVYGFDFSPIKKDVWKEPLVDTVDRIAVNTNSCVILDLDLKTVKKEDLA-----FSSPFEITATRNDFVHAFLAWFDIEFSACHKP--IKFSTGPFSRYTHWKQTVFYTHKDLTVKAGEYIRGTITCKPAEGNHRELDIDISYTFNPRE 325          
BLAST of protein arginine N-methyltransferase 3 vs. TrEMBL
Match: A0A1S3IYY7 (protein arginine N-methyltransferase 3 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106168779 PE=3 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 1.201e-105
Identity = 198/497 (39.84%), Postives = 288/497 (57.95%), Query Frame = 3
Query:   78 EGDEMQSFNYICLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNI---NVNCDEIN-KGVWKSDEYLKPVIDDDNLLFIDYENVF----QICLPENSN-------------------RINELENELSICTETIAILRNKITDLLECDVNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVG-ADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGL 1484
            E D+      +CL C+ +F   E +  H    H F+  Q+  T+N+ + + +IK++N+IR H     ++    I+ +  W  D Y+KPV+D+D LL  D E+      +  LPE S                    ++ +LE +L    +T+  +RN   + L         P V  S+    S   +ED+AYF+ Y H+SIH+ M+KDK+RTESYR  + +N  + F+ K+VLDIGCGTGILSMFAA+AGA  V GID +DII  A+ IV +NG+++ ITLI GK+ED ++P  +VD++ISEWMGYFL++ESMLD+V+Y   K+L P  G V P +  +++ G  D S YR + V  W+DV+GF MS MK  VMRE  V+VV  D V+T  C+++D D+++       V        F L A   G+  A+V YFD FF S  Q N VMFST P    THWKQT+ LL  P++V K +++ G +S  ++ +  R L
Sbjct:   30 ECDDESPVPVLCLFCQQTFPAAESVFEHCKTCHMFDIFQLRNTLNL-DCFSYIKLVNFIRSHKPLPGDITTMYISGQASWNDDAYMKPVLDEDQLLQYDIEDSECPWEEPSLPEISGEKDSNSAKLLMEKLRWREAQVEQLEIDLQQAAKTVEKMRNSAKEFL------ISAPEVPVSQNAIESLQEDEDEAYFSSYGHFSIHEEMLKDKVRTESYRDCMYKN-TDLFKGKVVLDIGCGTGILSMFAAKAGARRVIGIDQSDIICQAIDIVRENGMEDVITLIKGKVEDVDIPEKEVDIIISEWMGYFLLFESMLDTVLYARDKWLSP-GGSVLPSHCNISLAGLRDESLYR-KHVAYWDDVYGFKMSCMKVAVMREASVEVVNKDSVLTTACVVKDIDIEK-----CTVKELDFSSPFSLEATSDGELTAIVGYFDIFFNSGCQ-NKVMFSTSPSDTATHWKQTVFLLQTPVNVEKNQRLEGSVSCKKNRRDPRSL 510          
BLAST of protein arginine N-methyltransferase 3 vs. TrEMBL
Match: A0A1S3IZH7 (protein arginine N-methyltransferase 3 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106168779 PE=3 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 2.288e-105
Identity = 198/497 (39.84%), Postives = 288/497 (57.95%), Query Frame = 3
Query:   78 EGDEMQSFNYICLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNI---NVNCDEIN-KGVWKSDEYLKPVIDDDNLLFIDYENVF----QICLPENSN-------------------RINELENELSICTETIAILRNKITDLLECDVNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVG-ADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGL 1484
            E D+      +CL C+ +F   E +  H    H F+  Q+  T+N+ + + +IK++N+IR H     ++    I+ +  W  D Y+KPV+D+D LL  D E+      +  LPE S                    ++ +LE +L    +T+  +RN   + L         P V  S+    S   +ED+AYF+ Y H+SIH+ M+KDK+RTESYR  + +N  + F+ K+VLDIGCGTGILSMFAA+AGA  V GID +DII  A+ IV +NG+++ ITLI GK+ED ++P  +VD++ISEWMGYFL++ESMLD+V+Y   K+L P  G V P +  +++ G  D S YR + V  W+DV+GF MS MK  VMRE  V+VV  D V+T  C+++D D+++       V        F L A   G+  A+V YFD FF S  Q N VMFST P    THWKQT+ LL  P++V K +++ G +S  ++ +  R L
Sbjct:   37 ECDDESPVPVLCLFCQQTFPAAESVFEHCKTCHMFDIFQLRNTLNL-DCFSYIKLVNFIRSHKPLPGDITTMYISGQASWNDDAYMKPVLDEDQLLQYDIEDSECPWEEPSLPEISGEKDSNSAKLLMEKLRWREAQVEQLEIDLQQAAKTVEKMRNSAKEFL------ISAPEVPVSQNAIESLQEDEDEAYFSSYGHFSIHEEMLKDKVRTESYRDCMYKN-TDLFKGKVVLDIGCGTGILSMFAAKAGARRVIGIDQSDIICQAIDIVRENGMEDVITLIKGKVEDVDIPEKEVDIIISEWMGYFLLFESMLDTVLYARDKWLSP-GGSVLPSHCNISLAGLRDESLYR-KHVAYWDDVYGFKMSCMKVAVMREASVEVVNKDSVLTTACVVKDIDIEK-----CTVKELDFSSPFSLEATSDGELTAIVGYFDIFFNSGCQ-NKVMFSTSPSDTATHWKQTVFLLQTPVNVEKNQRLEGSVSCKKNRRDPRSL 517          
BLAST of protein arginine N-methyltransferase 3 vs. TrEMBL
Match: A0A383ZIG0 (protein arginine N-methyltransferase 3 isoform X1 OS=Balaenoptera acutorostrata scammoni OX=310752 GN=PRMT3 PE=3 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 3.746e-102
Identity = 191/487 (39.22%), Postives = 278/487 (57.08%), Query Frame = 3
Query:  111 CLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVN-CDEI-NKGVWKSDEYLKPVIDDDNLLFIDYENVFQIC---------LPENSNRINELENELSICTETIAILRNKITDLLECD-------VNETIKPPVNESKITKSSKLNE-EDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNA 1514
            CL C+  F   EE  +H  + H FN   ++    +   Y +IK+IN+IR  N  V   + I N   W+ +EYLKPV++DD LL  D E++++           L EN++ + +L++  +      A L     DL           +N  ++     S  T  + L E ED  YF+ Y HY IH+ M+KDK+RTESYR FI +N    F++K+VLD+GCGTGILSMFAA+AGA  V G+D ++I+Y AM I+  N L++ I LI GK+ED  LP +KVDV+ISEWMGYFL++ESMLDSV+Y   KYL    G V+P   T+++V        A+ +  W+DV+GF+MS MK  V+ E +V+V+    +++D C I+  D         +V        F L   K+    A   YFD +F   +  N VMFSTGP +  THWKQTI LL++P  V  GE ++G ++V ++ +  R L  +L ++N+ 
Sbjct:   52 CLFCDRLFTSAEETFSHCKSEHQFNIDNMVHKHGLEF-YGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALAGAREDLQRMKQFAQDFVMNADVR--TCSSSTTAIADLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPH-IFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMHIIRLNKLEDTIMLIKGKIEDVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYL-AKGGSVYPDICTISLVAVSDMNKHADRITFWDDVYGFNMSCMKKAVIPEAVVEVLDPKTLISDPCSIKHIDCHT-----TSVSDLEFSSDFTLKITKTSLCTAFAGYFDIYF-EKNCHNKVMFSTGPQSTKTHWKQTIFLLEKPFSVKAGEALKGKITVHKNKKDPRSLIVTLTLDNST 527          
BLAST of protein arginine N-methyltransferase 3 vs. TrEMBL
Match: A0A4X1T3B7 (Protein arginine methyltransferase 3 OS=Sus scrofa OX=9823 GN=PRMT3 PE=3 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 5.415e-102
Identity = 193/505 (38.22%), Postives = 288/505 (57.03%), Query Frame = 3
Query:   57 DDNSDSYEGDEMQSFNYICLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVN-CDEI-NKGVWKSDEYLKPVIDDDNLLFIDYENVFQ-ICLP--------ENSNRINELENELSICTETIAILRNKITDLLECD-------VNETIKPPVNESKITKSSKLNE-EDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNA 1514
            DD   S+E  +       CL C+  F   EE  +H  + H FN   ++    +   Y +IK+IN+IR  N  V   + I N   W+ +EYLKPV++DD LL  D E++++ + +P        EN++ + +L++  +      A L     DL           +N  ++P    S  T  + L E ED  YF+ Y HY IH+ M+KDK+RTESYR FI +N    F++K+VLD+GCGTGILSMFAA+AGA  V G+D ++I+Y AM I+  N L++ +TLI GK+E+  LP +KVDV+ISEWMGYFL++ESMLDSV+Y   KYL    G V+P   T+++V        A+ +  W+DV+GF+MS MK  V+ E +V+V+    +++D   I+  D         +V        F L   K+    A+  YFD +F   +  N V+FSTGP +  THWKQT+ LL++P  V  GE ++G ++V ++ +  R L  +L +NN+ 
Sbjct:   38 DDADPSHEKQQTP-----CLFCDRLFTSAEETFSHCKSEHQFNIGNMVHKHGLEF-YGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLGENTSVVEKLKHMEARALSAEAALAGAREDLQRMKQFAQDFVMNADVRP--CSSSTTAIADLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNAH-IFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTVTLIKGKIEEVRLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYL-AKGGSVYPDVCTISLVAVSDVNKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVLDPKTLISDPSTIKHIDCHT-----TSVSDLEFSSDFTLKITKTSLCTAIAGYFDIYF-EKNCHNKVVFSTGPQSATTHWKQTVFLLEKPFSVKAGEGLKGKITVHKNKKDPRSLIVTLTLNNST 526          
BLAST of protein arginine N-methyltransferase 3 vs. TrEMBL
Match: I3LPU5 (Protein arginine methyltransferase 3 OS=Sus scrofa OX=9823 GN=PRMT3 PE=3 SV=2)

HSP 1 Score: 326.25 bits (835), Expect = 7.183e-102
Identity = 193/505 (38.22%), Postives = 288/505 (57.03%), Query Frame = 3
Query:   57 DDNSDSYEGDEMQSFNYICLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVN-CDEI-NKGVWKSDEYLKPVIDDDNLLFIDYENVFQ-ICLP--------ENSNRINELENELSICTETIAILRNKITDLLECD-------VNETIKPPVNESKITKSSKLNE-EDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNA 1514
            DD   S+E  +       CL C+  F   EE  +H  + H FN   ++    +   Y +IK+IN+IR  N  V   + I N   W+ +EYLKPV++DD LL  D E++++ + +P        EN++ + +L++  +      A L     DL           +N  ++P    S  T  + L E ED  YF+ Y HY IH+ M+KDK+RTESYR FI +N    F++K+VLD+GCGTGILSMFAA+AGA  V G+D ++I+Y AM I+  N L++ +TLI GK+E+  LP +KVDV+ISEWMGYFL++ESMLDSV+Y   KYL    G V+P   T+++V        A+ +  W+DV+GF+MS MK  V+ E +V+V+    +++D   I+  D         +V        F L   K+    A+  YFD +F   +  N V+FSTGP +  THWKQT+ LL++P  V  GE ++G ++V ++ +  R L  +L +NN+ 
Sbjct:   37 DDADPSHEKQQTP-----CLFCDRLFTSAEETFSHCKSEHQFNIGNMVHKHGLEF-YGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLDENTSVVEKLKHMEARALSAEAALAGAREDLQRMKQFAQDFVMNADVRP--CSSSTTAIADLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNAH-IFKDKVVLDVGCGTGILSMFAAKAGAKMVLGVDQSEILYQAMDIIRLNKLEDTVTLIKGKIEEVRLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYL-AKGGSVYPDVCTISLVAVSDVNKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVLDPKTLISDPSTIKHIDCHT-----TSVSDLEFSSDFTLKITKTSLCTAIAGYFDIYF-EKNCHNKVVFSTGPQSATTHWKQTVFLLEKPFSVKAGEGLKGKITVHKNKKDPRSLIVTLTLNNST 525          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Cavefish
Match: prmt8b (protein arginine N-methyltransferase 8-B [Source:NCBI gene;Acc:103024775])

HSP 1 Score: 246.128 bits (627), Expect = 6.139e-76
Identity = 134/327 (40.98%), Postives = 200/327 (61.16%), Query Frame = 3
Query:  552 LNEEDQA----YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDV-----QQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            LN E+      YF  Y+H+ IH+ M+KD++RT +YR  +  N +  F++KIVLD+G GTGILSMFAA+AGA HVYGI+C+ I   +  I++ N L + IT+  GK+E+TELP D+VD+++SEWMGY L YESML +V+Y   K+L P  G +FP   TL VV  +   Y+   +  W +V+GFDM+ ++   M E +VD+V    V+T+ CLI++ D+     + +AF  +A C Q+    +           ALV YF+  F    +  G  FST P A  THWKQT+  L+  + V +GE+I G ++V  +   +R L+F+  ++
Sbjct:   84 LNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHN-KHLFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDDVITIFKGKVEETELPVDQVDIIVSEWMGYCLFYESMLKTVIYARDKWLKP-GGYMFPDRATLYVVAIEDRQYKDFKIHWWENVYGFDMTCIRNVAMMEPLVDIVDPKQVVTNSCLIKEVDIYTVKLEDLAFT-SAFCLQIQRNDY---------IHALVTYFNIEFTKCHKKTG--FSTAPDAPSTHWKQTVFYLEDYLTVRRGEEILGSIAVKPNENNERDLDFTFELD 396          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Cavefish
Match: prmt1 (protein arginine methyltransferase 1 [Source:NCBI gene;Acc:103022674])

HSP 1 Score: 236.113 bits (601), Expect = 1.187e-72
Identity = 133/344 (38.66%), Postives = 200/344 (58.14%), Query Frame = 3
Query:  474 TDLLECDVNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            TD +E    E+ + P  E   +K          YF  Y+H+ IH+ M+KD++RT +YR  +  N +  F++K+VLD+G GTGIL MFAA+AGA  V GI+C+ I   A+ IV+ N L   +T+I GK+E+ ELP + VD++ISEWMGY L YESML++V+Y   K+L P  GL+FP   TL V   +   Y+   +  W +V+GFDMS +K   ++E +VDVV    +++  CLI++ D+  +     +         F L   ++    ALV YF+  F    +  G  FST P +  THWKQT+  LD  + V  GE+I G +S+  + +  R L+F++ I+
Sbjct:   19 TDRMEVSQGESSEKPAAEDMTSK--------DYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHN-KHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANKLDHIVTIIKGKVEEVELPVEHVDIIISEWMGYCLFYESMLNTVIYARDKWLKP-DGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKEVAIKEPLVDVVDPKQLVSSACLIKEVDIYTVKIEDLS-----FTSPFCLQVKRNDYIHALVTYFNIEFTRCHKRTG--FSTSPESPYTHWKQTVFYLDDYLTVKTGEEIFGTISMKPNVKNNRDLDFTVDID 345          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Cavefish
Match: prmt3 (protein arginine methyltransferase 3 [Source:ZFIN;Acc:ZDB-GENE-041105-1])

HSP 1 Score: 231.876 bits (590), Expect = 3.499e-70
Identity = 144/381 (37.80%), Postives = 223/381 (58.53%), Query Frame = 3
Query:  111 CLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVNCDEINKGV--WKSDEYLKPVIDDDNLLFIDYENVFQICLPENSNRINELENELSICTETIAILRNK-----------------ITDLLECDV-NETIKPPVNESKITKSSKLNE----EDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIR 1181
            CL C+ SF+ + E   H  + H  +  Q++ T  + +EY +IK+INYIR    + +      G   W  DEY+KP + DD LL ID E++    +  ++    ++E +     +T A+LR                   + DL +  V  + +      +  + S  + E    ED+AYF+ Y HYSIH+ M+KD +RTESYR FI  N  + F++K+VLD+GCGTGILSMFAAR+GA  V  +D ++IIY A+ IV  N L+  ITLI G++ED +LP +KVD++ISEWMGYFL++ESMLDSV++   +YL    GLVFP    +++     +   ++ +  W++V+GF M  MK  V+ E +V+V+  + V+++  +I+
Sbjct:   46 CLFCQRSFSSVPETFQHCQSEHGVDLLQLVTTHRL-DEYGYIKMINYIRTAKCSGDSLAGLGGALPWDGDEYMKPALPDDPLLLIDLEDLIGGEMKLDAAPGGQVEGK----DQTTALLRKAQQAEERAERSEEALARAMEDLHKLKVLAQGLVLSAGRAGPSCSGAVAELQEDEDEAYFSSYGHYSIHEEMLKDTVRTESYRDFIYGN-PDVFKDKVVLDVGCGTGILSMFAARSGAKKVIAVDQSEIIYQAIDIVRSNQLENTITLIKGRIEDVDLPVEKVDIIISEWMGYFLLFESMLDSVLWARDRYL-ADGGLVFPDRCIISLAAVGDTEKHSDRIAFWDNVYGFKMECMKEVVIPEAVVEVLKPETVISEPAVIQ 419          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Cavefish
Match: prmt1 (protein arginine methyltransferase 1 [Source:NCBI gene;Acc:103022674])

HSP 1 Score: 216.853 bits (551), Expect = 7.236e-66
Identity = 120/298 (40.27%), Postives = 180/298 (60.40%), Query Frame = 3
Query:  612 MIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            M+KD++RT +YR  +  N +  F++K+VLD+G GTGIL MFAA+AGA  V GI+C+ I   A+ IV+ N L   +T+I GK+E+ ELP + VD++ISEWMGY L YESML++V+Y   K+L P  GL+FP   TL V   +   Y+   +  W +V+GFDMS +K   ++E +VDVV    +++  CLI++ D+  +     +         F L   ++    ALV YF+  F    +  G  FST P +  THWKQT+  LD  + V  GE+I G +S+  + +  R L+F++ I+
Sbjct:   11 MLKDEVRTLTYRNSMFHN-KHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANKLDHIVTIIKGKVEEVELPVEHVDIIISEWMGYCLFYESMLNTVIYARDKWLKP-DGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKEVAIKEPLVDVVDPKQLVSSACLIKEVDIYTVKIEDLS-----FTSPFCLQVKRNDYIHALVTYFNIEFTRCHKRTG--FSTSPESPYTHWKQTVFYLDDYLTVKTGEEIFGTISMKPNVKNNRDLDFTVDID 299          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Cavefish
Match: prmt6 (protein arginine methyltransferase 6 [Source:NCBI gene;Acc:448867])

HSP 1 Score: 181.03 bits (458), Expect = 9.957e-52
Identity = 109/309 (35.28%), Postives = 172/309 (55.66%), Query Frame = 3
Query:  555 NEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVG-ADLSAYRAESVDCWNDV---FGFDMSSM----KGNVMR-EVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSV 1454
            + +D  YF  Y+  SIH+ M+ D +RT++YR+ I          K VLD+G GTG+LS+F A+AGA  VY ++ + I   A  IV +N +++++ +I G +E  ELP ++VDV++SEWMGY L++ESML+SV+    ++L P  GL+ P    L V   +DL A   E ++ W+ V   +G DMS M    +  V+  E+ V  V  +DV++  C     D++ +         + +   F      S    AL  +F   F + D P  ++ ST P   +THWKQ +L LD+P+DV +  K+ G +S+
Sbjct:   27 SAQDSLYFQSYADVSIHEEMLADTVRTDTYRRAIFRCA-AALAGKAVLDVGAGTGVLSVFCAQAGARRVYAVEASSIAEQAARIVRQNRVEDRVQVIRGTVESVELP-ERVDVIVSEWMGYALLHESMLNSVITARDRWLKP-GGLILPERAELFVAPISDLVA--EERLNFWDTVKGQYGVDMSCMAEFARSCVLNGEIAVHPVTVEDVLSHPCRFAQLDLRTVTLEEL----KRVSGAFCCQCFGSSSLNALCVWFTVTFPAEDMPP-LVLSTSPFKAETHWKQAVLYLDEPVDVRQDTKVEGNISM 325          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Sea Lamprey
Match: prmt1 (protein arginine methyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-693])

HSP 1 Score: 230.72 bits (587), Expect = 1.899e-71
Identity = 129/334 (38.62%), Postives = 200/334 (59.88%), Query Frame = 3
Query:  513 PPVN---ESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVK-GEKIRGFLSVGRHSQGKRGLNFSLAI 1502
            P VN   E     + ++  +D  YF  Y+H+ IH+ M+KD++RT +YR  +  N R  F++K+VLD+G GTGIL MFAA+AGA  V+GI+C++I   +  I++ N L   IT++ GK+E+ +L  DKVD++ISEWMGY L+YESML++V+    K+L P  G +FP   +L +   +   Y+   ++ W DV+GFDMS ++   ++E +VDVV    V+T+ CL+++ D+  +      V        F L   ++    ALVAYF   F    +  G  FST P A  THWKQT+  L +    VK GE+I G +S+  +++  R L+F++ +
Sbjct:   11 PTVNGSVEGTAPNADEMTSKDY-YFDSYAHFGIHEEMLKDEVRTRTYRNAMYHN-RHLFKDKVVLDVGSGTGILCMFAAKAGAKKVFGIECSNIADYSQQIIKANNLDSVITIVKGKVEEVDLLVDKVDIIISEWMGYCLLYESMLNTVICARDKWLKP-GGAIFPDRASLFLTAIEDRQYKENKINWWEDVYGFDMSCIRDVAIQEPLVDVVEPKQVVTNSCLVKEVDIYTV-----KVDDLTFTSPFCLQVRRADYVHALVAYFTVEFTRCHKRTG--FSTAPDAPYTHWKQTVFYLKEDCLTVKPGEEIYGTISLRPNAKNNRDLDFTIDV 334          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Sea Lamprey
Match: prmt2 (protein arginine methyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-041104-1])

HSP 1 Score: 165.236 bits (417), Expect = 5.938e-46
Identity = 93/333 (27.93%), Postives = 172/333 (51.65%), Query Frame = 3
Query:  561 EDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAAR-AGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDV-----VPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLN----FSLAINNNAAQKFE 1529
            +D  YF  YS   +   M+ D++RTE+Y   ++ + R + R K VLD+GCG+GI+SM  A+ A  + VY ++ +++      +V  NG+K+ + ++ G++ED ELP   VD ++SEWMG  L++E M++SV+    ++L    G+++P    L++          + +  W+  +  D S ++    +E          +  DD + + C I   D+ ++         + I  +F     K+G      A+F T F  PD    ++  TGP +  THWKQT+ +LD P+ V  G+ + G +++ R+   +R ++    + +A + +A  + E
Sbjct:   95 QDDEYFNSYSKLKLQQEMLADRVRTETYGAVMKRS-RAWLRGKAVLDVGCGSGIISMLCAKHAQPSRVYAVEASELARLTEQVVRCNGMKDTVRVLQGRVEDVELP-GSVDCLVSEWMGTCLLFEFMIESVLQARDRWLR-DGGVMWPSTAALHLTPCSAQREYTDKIGFWDWQYELDFSQLRTEAAKEYFSKPKHDHQMDPDDCLAEPCCILQLDMSKVQTSEL----EEITYEFIFEVKKAGPMHGFAAWFSTEFKCPDSNPSIILDTGPMSTATHWKQTLFMLDSPVAVTPGDFVVGSVALRRNPVWRRHMSVAFRWRVAPSTDATSRRE 420          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Sea Lamprey
Match: carm1 (coactivator-associated arginine methyltransferase 1 [Source:NCBI gene;Acc:445251])

HSP 1 Score: 147.132 bits (370), Expect = 2.418e-38
Identity = 109/342 (31.87%), Postives = 172/342 (50.29%), Query Frame = 3
Query:  465 NKITDLLECDVNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVG-ADLSAYRAE--SVDCW--NDVFGFDMSSMKGNVM----REVIVD-------VVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRG 1442
            N   +LL+     +++  V   +  +SS +      YF  Y + S    M++D IRT +Y++ I +N  + FR+KIVLD+GCG+GILS FA +AGA  VY ++ + +   A  +V  N L+++I +I GK+ED  +P DKVDV+ISE MGY L  E ML+S ++  +K+L P +G +FP    +++    D   Y  +    + W      G D+SS++G  +    R+ IVD       +  S     ++   R+ D+ +            IE  F+   ++SG    L  +FD  F+       V  ST P    THW Q   LL  P+    G+ + G
Sbjct:   94 NSFMNLLKSCQGRSVERSVFSERTEESSAVQ-----YFQFYGYLSQQQNMMQDYIRTGTYQRAILQNHAD-FRDKIVLDVGCGSGILSFFAVQAGARKVYAVEASSMAQHAEVLVRSNNLQDRIVVIPGKVEDVSIP-DKVDVIISEPMGYMLFNERMLESYLH-AKKWLKP-NGNMFPTLGDVHLAPFTDEQLYMEQFSKANFWYQQSFHGVDLSSLRGAALEEYFRQPIVDTFDIRILMARSIKYTVNFQQAREEDLHR------------IEIPFKFQMLQSGLVHGLAFWFDVAFVGSMLT--VWLSTAPTEPLTHWYQVRCLLQSPLFTKAGDTLSG 412          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Yeast
Match: HMT1 (Nuclear SAM-dependent mono- and asymmetric methyltransferase; modifies hnRNPs, including Npl3p and Hrp1p, affecting their activity and nuclear export; methylates U1 snRNP protein Snp1p, ribosomal protein Rps2p, and histones H3 and H4; interacts genetically with genes encoding components of Rpd3(L) and this interaction is important for Rpd3 recruitment to the subtelomeric region [Source:SGD;Acc:S000000238])

HSP 1 Score: 266.544 bits (680), Expect = 1.640e-85
Identity = 140/321 (43.61%), Postives = 196/321 (61.06%), Query Frame = 3
Query:  537 TKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLA 1499
            T+ +KL+E +Q YF  Y HY IH+ M++D +RT SYR  I +N ++ F++KIVLD+GCGTGILSMFAA+ GA HV G+D + II  A  +VE NG  +KITL+ GKLED  LP  KVD++ISEWMGYFL+YESM+D+V+Y    YL    GL+FP   ++++ G + S Y+ E ++ W DV+GFD S     V+ E IVD V  ++V T    + ++D+  +     A      +  F+LTA +      +V +FD  F +P     V FSTGP A  THWKQTI      +D   G+ I G L    + +  R LN  ++
Sbjct:   11 TEKTKLSESEQHYFNSYDHYGIHEEMLQDTVRTLSYRNAIIQN-KDLFKDKIVLDVGCGTGILSMFAAKHGAKHVIGVDMSSIIEMAKELVELNGFSDKITLLRGKLEDVHLPFPKVDIIISEWMGYFLLYESMMDTVLYARDHYL-VEGGLIFPDKCSIHLAGLEDSQYKDEKLNYWQDVYGFDYSPFVPLVLHEPIVDTVERNNVNTTSDKLIEFDLNTVKISDLA-----FKSNFKLTAKRQDMINGIVTWFDIVFPAPKGKRPVEFSTGPHAPYTHWKQTIFYFPDDLDAETGDTIEGELVCSPNEKNNRDLNIKIS 324          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Nematostella
Match: EDO49961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RER6])

HSP 1 Score: 292.738 bits (748), Expect = 8.933e-93
Identity = 183/527 (34.72%), Postives = 282/527 (53.51%), Query Frame = 3
Query:   54 SDDNSDSYE--GDEMQSFNYICLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVNCDEIN------KGVWKSDEYLKPVIDDDNLLFIDYENVFQICLPENSN-----------------------RINELENELSICTETIAILRNKITDLLEC------DVNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNAAQK 1523
            S D  D +E   D+  S    CL C+ +F     +  H    H F+  ++ +   + + Y  IK+INYIRK    ++C   +         W  +++L+PVI DD LL+ D+E+  Q   P  ++                       R+  +E++LS     +   R+ I+ L  C      D  +   P  + S+   S+  ++ED AYF+ YSH+ IH+ M+KDK+RTESYR FI  N  + F++K+VLD+GCGTGILSMFAAR+GA  V GID ++IIY AM I+ +NG ++ ITLI GK E+  LP ++VDV+ISEWMGYFL++ESMLD+V++   K+L+P  G V+P   T+++V       +   ++ W+DV+GF MS MK  V +E  ++ V  D +++  C I+  D+                  F+    K   F  +V+YFD FF   +    V+FST P    THWKQ I     PI V +G+ + G +S  ++ +  R L+  + + +   +K
Sbjct:   19 SGDGGDEWEEVDDDCPSVTVNCLFCDENFENASSVWAHCDQGHGFDISKVKQKFGL-DCYGCIKLINYIRK----MSCAPASVFAASAPFPWDDNKFLQPVIADDGLLWDDFEDEDQEEKPSLTDNTLSNGRTCEETVPLQDYLTLKKRLCVMEDKLSRADADLMKARDDISQL-RCVAMSFLDEGDNTNPRSSTSQKKVSNMEDDEDGAYFSSYSHFGIHEEMLKDKVRTESYRDFIYGNP-DIFKDKVVLDVGCGTGILSMFAARSGARQVIGIDQSEIIYQAMDIIRENGFEKTITLIKGKAEEVTLPVEQVDVIISEWMGYFLLFESMLDTVLFCRDKWLNP-QGSVYPDKCTMHLVAIGTGEKKQPKINFWDDVYGFKMSCMKKTVSKEAAIETVDVDALISTHCTIKSIDINSCKKEDLNFI-----SSFRFEIKKPDFFTGIVSYFDIFF-EHEAKEKVVFSTSPAHTPTHWKQAIFYFQNPIPVTQGQILTGHISCYKNLKEPRSLDVRIEVVDKGTEK 531          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Nematostella
Match: EDO47611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLI7])

HSP 1 Score: 241.506 bits (615), Expect = 5.631e-75
Identity = 128/311 (41.16%), Postives = 191/311 (61.41%), Query Frame = 3
Query:  573 YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            YF  Y+H+ IH+ M+KD++RT +YR  +  N +  FR+KIVLD+GCGTGILSMFAA+AGA HVY I+ + I+  +  I++ N     ITLI GK+ED ELP +KVD++ISEWMGY L YESMLD+V+Y   K+L P  G++FP    L V   +   Y+ E +  W+ V+GFDMSS++   + E +VDVV    V+T+ C++++ D+Q +               F+L   ++    ALV++F   F    +  G  FST P    THWKQT+  L+  + V  GE+I G + +  +++  R ++F++ I 
Sbjct:   62 YFDSYAHFGIHEEMLKDEVRTLTYRNSMYHN-KHLFRDKIVLDVGCGTGILSMFAAKAGAKHVYAIEMSSIVDYSKTIIKDNNFDSVITLIKGKVEDVELPVEKVDIIISEWMGYCLFYESMLDTVLYARDKWLKP-DGMLFPDKAKLYVCAIEDRQYKEEKIYWWDRVYGFDMSSIRKVALSEPLVDVVDPKQVVTNSCMVKEVDIQTVKKEDLNFTA-----PFRLYCHRNDYVHALVSFFTIEFTHCHKRTG--FSTAPDCPYTHWKQTVFYLEDYLTVKYGEEITGSIHMEPNARNNRDIDFNIGIQ 363          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Nematostella
Match: EDO39146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAV4])

HSP 1 Score: 186.422 bits (472), Expect = 9.806e-54
Identity = 117/333 (35.14%), Postives = 175/333 (52.55%), Query Frame = 3
Query:  552 LNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAG-AAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVV-------------PSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNG-------VMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLN 1487
            L  +D  YF  Y    IH  M+KDK RTESYR  IE+ G  YF++K+VLD+GCGTGILS+F AR G A+ VY ++ ++I      I+++N L +KIT+I GK+E+ ELP +KVD+++SEWMG FL++E ML+SV+     +L P +GLV+P    L +V         E +  W D +GFD S       +E +   +             P   +  D      +D++  A G            F+    +        ++FD  F   + P+G       V+ STGP    THWKQ + LLD P+ V + + I+G + + R+   +R L+
Sbjct:   62 LAWQDDEYFADYGSLKIHLEMLKDKPRTESYRMAIEQ-GAGYFKDKVVLDVGCGTGILSLFCAREGKASKVYAVEASEIAKLTEEIIKQNNLDDKITVIQGKIEEVELP-EKVDIIVSEWMGTFLVFEFMLESVLTARDIWLKP-NGLVWPSEAKLFLVPCCTKTAYDEVIHIWRDQYGFDYSPAISKAKQEFLSRPIYNHVFNYEDCISTPQPIIKLDTLKTARHDLEHSAHG------------FEFVIEQDSMLYGFCSWFDVLF--GNIPHGEDKRNSAVVLSTGPQCDLTHWKQDLFLLDMPLPVQENDLIKGSICLKRNPDFRRHLS 377          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Nematostella
Match: EDO28377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6M8])

HSP 1 Score: 73.9442 bits (180), Expect = 6.688e-16
Identity = 42/143 (29.37%), Postives = 66/143 (46.15%), Query Frame = 3
Query: 1074 DVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAI 1502
            D+ GF MS MK  V +E  ++ V  D +++  C I+  D+                  F+    K   F  +V+YFD FF   +    V+FST P    THWKQ I     PI V +G+ + G +S  ++ +  R L+  + +
Sbjct:    1 DLAGFKMSCMKKTVSKEAAIETVDVDALISTHCTIKSIDINSCKKEDLNFI-----SSFRFEIKKPDFFTGIVSYFDIFF-EHEAKEKVVFSTSPAHTPTHWKQAIFYFQNPIPVTQGQILTGHISCYKNLKEPRSLDVRIEV 137          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Nematostella
Match: EDO38718 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBZ7])

HSP 1 Score: 62.003 bits (149), Expect = 3.792e-10
Identity = 90/375 (24.00%), Postives = 149/375 (39.73%), Query Frame = 3
Query:  423 NELSICTETIAILRNKITDLLECDVNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIE---ENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYD-AMAIVEKNGLKEKITLIHGKLED----TELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPS-------------------SGLVFPRYFTLNVVGADLSAYRAESVD------CWNDVFGFDMSSMK---GNVMR----------------EVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTI 1391
            NE  +      +L+  +TD   C     I+  +N S       L     A    +     H  M+ D+ R  +Y+K I     NG +     IVLDIG G+GILSMFA +AGA  VY  + +  +Y+ +  ++  N ++  I +IH K  D     +LP  +V +V +E +   L+ E +L ++ +     L                      S +V PR       GA L     ES D      C  +V GF++  +K   G  +                 E +  +      +T+  +I +YD  +    P+ +C +  + Q  +   + G   A+  +FD      D+   +  ST PG     W+Q +
Sbjct:   84 NETLLTNIGATLLKLGLTDEAACMFRRAIQ--LNPSSTIAREGLESVASALVERW-----HFRMLNDRQRNLAYKKAISNAVSNGCD-----IVLDIGSGSGILSMFAVQAGAKKVYACEMSKTMYELSKDVLLGNQMESFIEVIHKKSTDLLIGKDLP-GRVSLVCTETLDCGLLGEGILKTISHAWEALLQEKKSITSTEQQIDGVVRTSGISPMVIPR-------GAKLYGQVIESSDIRHQSYCRPNVAGFNVRIVKVIGGEQLEQENTHLDQEAIEPYTTECLDSLQGGYKPLTEPFVITEYDFTK----PSTLCSER-KPQVIVPVSQPGNMDAIAVWFDLHL---DETTTI--STAPGKGSLCWEQAV 428          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Medaka
Match: prmt3 (protein arginine methyltransferase 3 [Source:NCBI gene;Acc:101174166])

HSP 1 Score: 312.383 bits (799), Expect = 4.475e-100
Identity = 183/496 (36.90%), Postives = 276/496 (55.65%), Query Frame = 3
Query:  111 CLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVNC-DEINKGV--WKSDEYLKPVIDDDNLLFIDYENVFQI---CLPENSNRINELENELSICTETIAILRNKITDLLECDVNETIKPPVNE--------------SKITKSSKL-------NEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIE--RQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNN 1511
            CL C+   + +   L H    H  +  ++++   +  +Y +IK+IN+IR      +C   +++G   W+S+++LKP + DD +L  D E +      C+    +   E  N L        +LR +  +   C   E +   + +              +  +KS  L        +ED+AYF+ Y HY IH+ M+KDK+RTESYR F+  N  + FR+K+VLD+GCGTGILSMFAARAGA  V G+D +DI+Y AM I+  N L++KITLI G++ED +LP  KVD++ISEWMGYFL++ESMLDSVVY    YL    G V+P    +++          + V  W+DV+GF+MS MK   + E +V+VV  D V+++  +I+  D  +       VC   +E    F L   K+    A+V YFD FF   D  N VMFSTGP    THWKQT+ LL++PI V  G++++G + V ++ +  R L  ++ + + 
Sbjct:   41 CLFCDRQLSSVPATLQHCTAEHQVSLTEVIRKHGL-EDYGYIKMINFIRLTKCGPSCLTGLSEGPLPWESEDFLKPALQDDLMLQTDPEELLSSDVPCISACPSSRTESYNAL--------LLRAQTAEERACSSEEALSRAMEDLHKLKILSQNLVLNTDTSKSGNLCAVAELREDEDEAYFSSYGHYGIHEEMLKDKVRTESYRDFMYRNP-DVFRDKVVLDVGCGTGILSMFAARAGATQVIGVDQSDIVYQAMDIIRSNQLEDKITLIKGRIEDIKLPVAKVDIIISEWMGYFLLFESMLDSVVYARDLYLS-DGGSVYPDLCNISLAAVGDKHKHHDRVAFWDDVYGFNMSCMKKAALPEALVEVVKMDTVISEPTVIQTIDCNR-------VCLSELEFTTDFCLRMTKTTVCTAIVGYFDIFF-DKDCNNKVMFSTGPQVTKTHWKQTVFLLERPISVQAGDELQGKILVRKNKKDPRALWVTIDLRDR 517          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Medaka
Match: prmt3 (protein arginine methyltransferase 3 [Source:NCBI gene;Acc:101174166])

HSP 1 Score: 311.612 bits (797), Expect = 5.840e-100
Identity = 183/496 (36.90%), Postives = 276/496 (55.65%), Query Frame = 3
Query:  111 CLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVNC-DEINKGV--WKSDEYLKPVIDDDNLLFIDYENVFQI---CLPENSNRINELENELSICTETIAILRNKITDLLECDVNETIKPPVNE--------------SKITKSSKL-------NEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIE--RQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNN 1511
            CL C+   + +   L H    H  +  ++++   +  +Y +IK+IN+IR      +C   +++G   W+S+++LKP + DD +L  D E +      C+    +   E  N L        +LR +  +   C   E +   + +              +  +KS  L        +ED+AYF+ Y HY IH+ M+KDK+RTESYR F+  N  + FR+K+VLD+GCGTGILSMFAARAGA  V G+D +DI+Y AM I+  N L++KITLI G++ED +LP  KVD++ISEWMGYFL++ESMLDSVVY    YL    G V+P    +++          + V  W+DV+GF+MS MK   + E +V+VV  D V+++  +I+  D  +       VC   +E    F L   K+    A+V YFD FF   D  N VMFSTGP    THWKQT+ LL++PI V  G++++G + V ++ +  R L  ++ + + 
Sbjct:   30 CLFCDRQLSSVPATLQHCTAEHQVSLTEVIRKHGL-EDYGYIKMINFIRLTKCGPSCLTGLSEGPLPWESEDFLKPALQDDLMLQTDPEELLSSDVPCISACPSSRTESYNAL--------LLRAQTAEERACSSEEALSRAMEDLHKLKILSQNLVLNTDTSKSGNLCAVAELREDEDEAYFSSYGHYGIHEEMLKDKVRTESYRDFMYRNP-DVFRDKVVLDVGCGTGILSMFAARAGATQVIGVDQSDIVYQAMDIIRSNQLEDKITLIKGRIEDIKLPVAKVDIIISEWMGYFLLFESMLDSVVYARDLYLS-DGGSVYPDLCNISLAAVGDKHKHHDRVAFWDDVYGFNMSCMKKAALPEALVEVVKMDTVISEPTVIQTIDCNR-------VCLSELEFTTDFCLRMTKTTVCTAIVGYFDIFF-DKDCNNKVMFSTGPQVTKTHWKQTVFLLERPISVQAGDELQGKILVRKNKKDPRALWVTIDLRDR 506          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Medaka
Match: prmt3 (protein arginine methyltransferase 3 [Source:NCBI gene;Acc:101174166])

HSP 1 Score: 291.582 bits (745), Expect = 2.651e-92
Identity = 170/494 (34.41%), Postives = 262/494 (53.04%), Query Frame = 3
Query:  111 CLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVNC-DEINKGV--WKSDEYLKPVIDDDNLLFIDYENVFQ---ICLPENSNRINELENELSICTETIAILRNKITDLLECDVNETIKPPVNE--------------SKITKSSKL-------NEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNN 1511
            CL C+   + +   L H    H  +  ++++   +  +Y +IK+IN+IR      +C   +++G   W+S+++LKP + DD +L  D E +      C+    +   E  N L        +LR +  +   C   E +   + +              +  +KS  L        +ED+AYF+ Y HY IH+ M+KDK+RTESYR F+  N  + FR+K+VLD+GCGTGILSMFAARAGA  V G+D +DI+Y AM I+  N L++KITLI G++ED +LP  KVD++ISEWMGYFL++ESMLDSVVY    YL    G V+P    +++          + V  W+DV+GF+MS MK   + E +V+VV  D V+++  +I+  D  ++             R  + T                          VMFSTGP    THWKQT+ LL++PI V  G++++G + V ++ +  R L  ++ + + 
Sbjct:   41 CLFCDRQLSSVPATLQHCTAEHQVSLTEVIRKHGL-EDYGYIKMINFIRLTKCGPSCLTGLSEGPLPWESEDFLKPALQDDLMLQTDPEELLSSDVPCISACPSSRTESYNAL--------LLRAQTAEERACSSEEALSRAMEDLHKLKILSQNLVLNTDTSKSGNLCAVAELREDEDEAYFSSYGHYGIHEEMLKDKVRTESYRDFMYRNP-DVFRDKVVLDVGCGTGILSMFAARAGATQVIGVDQSDIVYQAMDIIRSNQLEDKITLIKGRIEDIKLPVAKVDIIISEWMGYFLLFESMLDSVVYARDLYLS-DGGSVYPDLCNISLAAVGDKHKHHDRVAFWDDVYGFNMSCMKKAALPEALVEVVKMDTVISEPTVIQTIDCNRVCLSELEFTTDFCLRMTKTTVCT-----------------------VMFSTGPQVTKTHWKQTVFLLERPISVQAGDELQGKILVRKNKKDPRALWVTIDLRDR 500          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Medaka
Match: prmt8b (protein arginine N-methyltransferase 8-B [Source:NCBI gene;Acc:101155736])

HSP 1 Score: 244.588 bits (623), Expect = 2.278e-75
Identity = 132/316 (41.77%), Postives = 195/316 (61.71%), Query Frame = 3
Query:  573 YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDV-----QQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            YF  Y+H+ IH+ M+KD++RT +YR  +  N +  F++KIVLD+G GTGILSMFAA AGA HVYGI+C+ I   +  I++ N +   IT+  GK+E+ ELP +KVD++ISEWMGY L YESML++V++   K+L P  GL+FP    L VV  +   Y+   +  W +V+GFDMS ++   ++E +VDVV    V+T+ CL+++ D+     + ++F  +A C Q+    +           ALV YF+  F    +  G  FST P A  THWKQT+  L+  + V KGE+I G LSV  + +  R L F+L ++
Sbjct:   87 YFDSYAHFGIHEEMLKDEVRTLTYRNAMYHN-KHVFKDKIVLDVGSGTGILSMFAANAGAKHVYGIECSSISEYSEKIIKSNHMHNAITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKP-GGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMSCIRNIAIKEPLVDVVDHKQVVTNSCLLKEVDIYTVKPEDLSFT-SAFCLQIQRNHY---------VHALVTYFNIEFTKCHKKTG--FSTAPDAPSTHWKQTVFYLEDYLTVKKGEEIFGSLSVRPNEKNVRDLEFTLELD 388          
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Medaka
Match: ENSORLT00000020054.2 (protein arginine N-methyltransferase 8-B [Source:NCBI gene;Acc:101162208])

HSP 1 Score: 239.195 bits (609), Expect = 2.636e-73
Identity = 127/313 (40.58%), Postives = 194/313 (61.98%), Query Frame = 3
Query:  573 YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQ--LIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAIN 1505
            YF  Y+H+ IH+ M+KD++RT +YR  +  N +  F++KIVLD+G GTGILSMFAA+AGA HVYGI+C+ I   +  I++ N L   IT+  GK+E+ ELP +KVD++ISEWMGY L YESML++V++   K+L P  GL+FP   +L V+  +   ++   +  W +V+GFDM+ ++   M+E +VDVV    V+T+ CL+++ D+         V P+       F L   ++    ALV YF   F    +  G  FST P A  THWKQT+  L+  + V +GE+I G +S+  + +  R L+F++ ++
Sbjct:   92 YFDSYAHFGIHEEMLKDEVRTLTYRNSMYHN-KHVFKDKIVLDVGSGTGILSMFAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKP-GGLMFPDRASLYVLAIEDRQFKDFKIHWWENVYGFDMTCIRNVAMKEPLVDVVDPKQVVTNSCLVKEVDIY-------TVKPEDLTFSSTFCLQIQRNDYIHALVTYFSVEFTKCHKKTG--FSTAPDAAYTHWKQTVFYLEDYLTVRRGEEISGSISMKPNEKNIRDLDFTVELD 393          
BLAST of protein arginine N-methyltransferase 3 vs. Planmine SMEST
Match: SMESG000016853.1 (SMESG000016853.1)

HSP 1 Score: 1021.92 bits (2641), Expect = 0.000e+0
Identity = 492/497 (98.99%), Postives = 494/497 (99.40%), Query Frame = 3
Query:   45 MDSSDDNSDSYEGDEMQSFNYICLMCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVNCDEINKGVWKSDEYLKPVIDDDNLLFIDYENVFQICLPENSNRINELENELSICTETIAILRNKITDLLECDVNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNAAQKFEFS 1535
            MDSSDDNSDSYEGDEMQSFNYICLMCEASFN+IEEMLTHVFNIHNFNFK ILKTVNISNEYDWIKIINYIRKHNINVNCDEINKGVWKSDEYLKPVIDDDNLLFIDYENVFQICLPENSNRINELENELSICTETIAILRNKITDLLECDVNETIKPPVNESKI KSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVE+NGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSL INNNAAQKFEFS
Sbjct:    1 MDSSDDNSDSYEGDEMQSFNYICLMCEASFNQIEEMLTHVFNIHNFNFKHILKTVNISNEYDWIKIINYIRKHNINVNCDEINKGVWKSDEYLKPVIDDDNLLFIDYENVFQICLPENSNRINELENELSICTETIAILRNKITDLLECDVNETIKPPVNESKIRKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEENGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLTINNNAAQKFEFS 497          
BLAST of protein arginine N-methyltransferase 3 vs. Planmine SMEST
Match: SMESG000016853.1 (SMESG000016853.1)

HSP 1 Score: 971.844 bits (2511), Expect = 0.000e+0
Identity = 468/473 (98.94%), Postives = 470/473 (99.37%), Query Frame = 3
Query:  117 MCEASFNEIEEMLTHVFNIHNFNFKQILKTVNISNEYDWIKIINYIRKHNINVNCDEINKGVWKSDEYLKPVIDDDNLLFIDYENVFQICLPENSNRINELENELSICTETIAILRNKITDLLECDVNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNAAQKFEFS 1535
            MCEASFN+IEEMLTHVFNIHNFNFK ILKTVNISNEYDWIKIINYIRKHNINVNCDEINKGVWKSDEYLKPVIDDDNLLFIDYENVFQICLPENSNRINELENELSICTETIAILRNKITDLLECDVNETIKPPVNESKI KSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVE+NGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSL INNNAAQKFEFS
Sbjct:    1 MCEASFNQIEEMLTHVFNIHNFNFKHILKTVNISNEYDWIKIINYIRKHNINVNCDEINKGVWKSDEYLKPVIDDDNLLFIDYENVFQICLPENSNRINELENELSICTETIAILRNKITDLLECDVNETIKPPVNESKIRKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEENGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTILLLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLTINNNAAQKFEFS 473          
BLAST of protein arginine N-methyltransferase 3 vs. Planmine SMEST
Match: SMESG000038790.1 (SMESG000038790.1)

HSP 1 Score: 236.113 bits (601), Expect = 4.982e-73
Identity = 131/315 (41.59%), Postives = 194/315 (61.59%), Query Frame = 3
Query:  573 YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCD--KVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVD-THWKQTILLLDQPID----VVKGEKIRGFLSVGRHSQGKRGLNFSL 1496
            YF  Y+H+ IH+ M+KD+IRT SYR  +  N     ++K+VLD+GCGTGIL MFA RAGA  V GIDC++II  A  IV+ N +  KITLI GK+E+ ELP D  KVDV+ISEWMGY L+YESML++V++   K+L P  G++ P   TL++V  +   Y+ E ++ W +V+GFDMS ++     E +VDVV  D +++D CL+++ ++  +      V        F L+ +++    A+V YF+  F S  +P  + FST P     THWKQ++  LD   D    V +GE+I G  S+  ++   R ++ S+
Sbjct:   19 YFDSYAHFGIHEEMLKDEIRTISYRNALYHN-EHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAP-GGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDI-----TVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKP--ITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNAVNNRAIDVSI 324          
BLAST of protein arginine N-methyltransferase 3 vs. Planmine SMEST
Match: SMESG000038790.1 (SMESG000038790.1)

HSP 1 Score: 235.343 bits (599), Expect = 6.331e-73
Identity = 131/315 (41.59%), Postives = 194/315 (61.59%), Query Frame = 3
Query:  573 YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCD--KVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVD-THWKQTILLLDQPID----VVKGEKIRGFLSVGRHSQGKRGLNFSL 1496
            YF  Y+H+ IH+ M+KD+IRT SYR  +  N     ++K+VLD+GCGTGIL MFA RAGA  V GIDC++II  A  IV+ N +  KITLI GK+E+ ELP D  KVDV+ISEWMGY L+YESML++V++   K+L P  G++ P   TL++V  +   Y+ E ++ W +V+GFDMS ++     E +VDVV  D +++D CL+++ ++  +      V        F L+ +++    A+V YF+  F S  +P  + FST P     THWKQ++  LD   D    V +GE+I G  S+  ++   R ++ S+
Sbjct:   12 YFDSYAHFGIHEEMLKDEIRTISYRNALYHN-EHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAP-GGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDI-----TVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKP--ITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNAVNNRAIDVSI 317          
BLAST of protein arginine N-methyltransferase 3 vs. Planmine SMEST
Match: SMESG000038790.1 (SMESG000038790.1)

HSP 1 Score: 232.261 bits (591), Expect = 1.263e-71
Identity = 129/307 (42.02%), Postives = 190/307 (61.89%), Query Frame = 3
Query:  573 YFTGYSHYSIHDIMIKDKIRTESYRKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYDAMAIVEKNGLKEKITLIHGKLEDTELPCD--KVDVVISEWMGYFLIYESMLDSVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDMSSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIERQFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVD-THWKQTILLLDQPID----VVKGEKIRGFLSVGRHSQG 1472
            YF  Y+H+ IH+ M+KD+IRT SYR  +  N     ++K+VLD+GCGTGIL MFA RAGA  V GIDC++II  A  IV+ N +  KITLI GK+E+ ELP D  KVDV+ISEWMGY L+YESML++V++   K+L P  G++ P   TL++V  +   Y+ E ++ W +V+GFDMS ++     E +VDVV  D +++D CL+++ ++  +      V        F L+ +++    A+V YF+  F S  +P  + FST P     THWKQ++  LD   D    V +GE+I G  S+  +++ 
Sbjct:   19 YFDSYAHFGIHEEMLKDEIRTISYRNALYHN-EHLVKDKVVLDVGCGTGILCMFAVRAGAKRVIGIDCSNIIDYAKEIVKANKMDTKITLIKGKVEEVELPADVLKVDVIISEWMGYCLLYESMLNTVLFARDKWLAP-GGIIMPDKATLHMVAIEDREYKDEKINWWQNVYGFDMSCIRKFATSEPLVDVVNPDQIVSDICLVKEINMYDI-----TVDDLTFSTPFTLSMLRNDYVHAMVTYFNIEFTSSLKP--ITFSTAPTKRRATHWKQSVFYLDDGKDDTVPVKRGEEINGVFSLKPNARA 316          
The following BLAST results are available for this feature:
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRMT32.925e-10237.57protein arginine methyltransferase 3 [Source:HGNC ... [more]
PRMT33.939e-9439.38protein arginine methyltransferase 3 [Source:HGNC ... [more]
PRMT14.134e-7439.59protein arginine methyltransferase 1 [Source:HGNC ... [more]
PRMT11.106e-7240.62protein arginine methyltransferase 1 [Source:HGNC ... [more]
PRMT82.929e-7238.97protein arginine methyltransferase 8 [Source:HGNC ... [more]
back to top
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prmt-15.011e-6436.31Protein arginine N-methyltransferase 1 [Source:Un... [more]
prmt-15.011e-6436.31Protein arginine N-methyltransferase 1 [Source:Un... [more]
prmt-92.302e-630.14PRotein arginine MethylTransferase [Source:UniPro... [more]
back to top
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Art32.203e-9235.89gene:FBgn0038306 transcript:FBtr0083135[more]
Art31.075e-9035.88gene:FBgn0038306 transcript:FBtr0083134[more]
Art11.242e-7040.19gene:FBgn0037834 transcript:FBtr0082304[more]
Art67.851e-6135.94gene:FBgn0038189 transcript:FBtr0082878[more]
Art22.611e-5533.53gene:FBgn0031592 transcript:FBtr0077476[more]
back to top
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prmt31.664e-9737.21protein arginine methyltransferase 3 [Source:ZFIN;... [more]
prmt31.810e-9737.21protein arginine methyltransferase 3 [Source:ZFIN;... [more]
prmt31.379e-9035.14protein arginine methyltransferase 3 [Source:ZFIN;... [more]
prmt8b5.584e-7741.14protein arginine methyltransferase 8b [Source:NCBI... [more]
PRMT85.050e-7641.36protein arginine N-methyltransferase 8-B-like [Sou... [more]
back to top
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
il1rap8.486e-7539.59interleukin 1 receptor accessory protein [Source:X... [more]
il1rap1.090e-7439.59interleukin 1 receptor accessory protein [Source:X... [more]
il1rap2.606e-7440.92interleukin 1 receptor accessory protein [Source:X... [more]
il1rap2.665e-7440.92interleukin 1 receptor accessory protein [Source:X... [more]
il1rap3.109e-7440.92interleukin 1 receptor accessory protein [Source:X... [more]
back to top
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prmt31.061e-10038.02protein arginine N-methyltransferase 3 [Source:MGI... [more]
Prmt11.401e-7339.30protein arginine N-methyltransferase 1 [Source:MGI... [more]
Prmt81.867e-7238.97protein arginine N-methyltransferase 8 [Source:MGI... [more]
Prmt13.953e-7240.31protein arginine N-methyltransferase 1 [Source:MGI... [more]
Prmt11.183e-6540.27protein arginine N-methyltransferase 1 [Source:MGI... [more]
back to top
BLAST of protein arginine N-methyltransferase 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60678|ANM3_HUMAN1.405e-10137.57Protein arginine N-methyltransferase 3 OS=Homo sap... [more]
sp|O70467|ANM3_RAT7.406e-10138.64Protein arginine N-methyltransferase 3 OS=Rattus n... [more]
sp|Q922H1|ANM3_MOUSE7.960e-10038.02Protein arginine N-methyltransferase 3 OS=Mus musc... [more]
sp|P38074|HMT1_YEAST1.139e-8343.61Protein arginine N-methyltransferase 1 OS=Saccharo... [more]
sp|Q9URX7|ANM1_SCHPO5.458e-8242.60Protein arginine N-methyltransferase 1 OS=Schizosa... [more]
back to top
BLAST of protein arginine N-methyltransferase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IYY71.201e-10539.84protein arginine N-methyltransferase 3 isoform X2 ... [more]
A0A1S3IZH72.288e-10539.84protein arginine N-methyltransferase 3 isoform X1 ... [more]
A0A383ZIG03.746e-10239.22protein arginine N-methyltransferase 3 isoform X1 ... [more]
A0A4X1T3B75.415e-10238.22Protein arginine methyltransferase 3 OS=Sus scrofa... [more]
I3LPU57.183e-10238.22Protein arginine methyltransferase 3 OS=Sus scrofa... [more]
back to top
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prmt8b6.139e-7640.98protein arginine N-methyltransferase 8-B [Source:N... [more]
prmt11.187e-7238.66protein arginine methyltransferase 1 [Source:NCBI ... [more]
prmt33.499e-7037.80protein arginine methyltransferase 3 [Source:ZFIN;... [more]
prmt17.236e-6640.27protein arginine methyltransferase 1 [Source:NCBI ... [more]
prmt69.957e-5235.28protein arginine methyltransferase 6 [Source:NCBI ... [more]
back to top
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prmt11.899e-7138.62protein arginine methyltransferase 1 [Source:ZFIN;... [more]
prmt25.938e-4627.93protein arginine methyltransferase 2 [Source:ZFIN;... [more]
carm12.418e-3831.87coactivator-associated arginine methyltransferase ... [more]
back to top
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HMT11.640e-8543.61Nuclear SAM-dependent mono- and asymmetric methylt... [more]
back to top
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO499618.933e-9334.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476115.631e-7541.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391469.806e-5435.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283776.688e-1629.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387183.792e-1024.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protein arginine N-methyltransferase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prmt34.475e-10036.90protein arginine methyltransferase 3 [Source:NCBI ... [more]
prmt35.840e-10036.90protein arginine methyltransferase 3 [Source:NCBI ... [more]
prmt32.651e-9234.41protein arginine methyltransferase 3 [Source:NCBI ... [more]
prmt8b2.278e-7541.77protein arginine N-methyltransferase 8-B [Source:N... [more]
ENSORLT00000020054.22.636e-7340.58protein arginine N-methyltransferase 8-B [Source:N... [more]
back to top
BLAST of protein arginine N-methyltransferase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016853.10.000e+098.99SMESG000016853.1[more]
SMESG000016853.10.000e+098.94SMESG000016853.1[more]
SMESG000038790.14.982e-7341.59SMESG000038790.1[more]
SMESG000038790.16.331e-7341.59SMESG000038790.1[more]
SMESG000038790.11.263e-7142.02SMESG000038790.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006795 ID=SMED30006795|Name=protein arginine N-methyltransferase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1576bp
CATTTATATAAATTTGAACGTGTATATATTAAATAATTTATTTTATGGAT
TCATCTGACGATAACTCTGATTCTTACGAAGGGGATGAAATGCAAAGTTT
CAATTATATATGTTTGATGTGTGAAGCAAGTTTTAACGAAATCGAAGAAA
TGCTTACTCACGTTTTTAATATTCATAATTTTAATTTTAAACAAATTCTA
AAAACTGTTAATATTTCCAATGAATATGACTGGATTAAAATTATTAATTA
TATTCGAAAACACAATATAAATGTCAACTGTGATGAAATTAATAAAGGAG
TTTGGAAATCAGACGAATATTTAAAACCAGTTATCGATGATGATAATTTA
TTATTTATTGATTATGAAAATGTTTTTCAAATATGTTTGCCAGAAAACAG
TAATAGAATTAATGAATTAGAAAACGAATTGTCGATATGCACGGAAACAA
TTGCTATATTGAGAAATAAAATTACCGATTTACTTGAATGCGATGTTAAC
GAAACAATAAAACCGCCAGTTAACGAATCAAAAATTACAAAATCCTCGAA
ATTAAACGAAGAAGATCAAGCATATTTTACCGGATATTCCCATTATTCGA
TTCATGATATCATGATAAAGGACAAAATTCGAACGGAATCCTATCGGAAA
TTCATCGAGGAAAATGGACGAGAATATTTCCGAAACAAAATCGTATTGGA
TATCGGCTGTGGCACTGGGATATTAAGCATGTTTGCAGCAAGGGCTGGAG
CGGCTCATGTTTATGGAATCGATTGTGCTGATATCATTTACGATGCTATG
GCAATTGTTGAGAAAAACGGACTGAAGGAAAAAATCACTCTGATCCACGG
CAAACTCGAGGACACTGAGTTGCCATGCGATAAAGTCGATGTCGTCATTT
CCGAATGGATGGGATATTTCCTGATCTACGAATCGATGCTGGATTCGGTG
GTTTACGGCTGTCGGAAATATCTCGATCCGTCAAGTGGATTGGTTTTCCC
GAGATATTTCACACTGAATGTTGTCGGGGCCGATTTGTCGGCATATCGGG
CAGAATCTGTCGACTGTTGGAATGACGTGTTCGGGTTTGACATGAGCTCC
ATGAAAGGCAACGTGATGCGAGAGGTCATTGTCGATGTGGTGCCGAGTGA
TGACGTCATGACCGATTGGTGTTTGATTAGGGATTACGATGTGCAGCAGA
TGGCATTTGGGCCGGCTGCTGTTTGTCCGCAATTGATTGAGAGGCAATTT
CAATTGACTGCAGTCAAGTCCGGTAAGTTTGGCGCTCTTGTTGCTTATTT
CGATACGTTCTTTATCTCACCTGACCAACCGAATGGGGTGATGTTTTCCA
CGGGGCCCGGCGCCGTTGATACGCATTGGAAACAGACGATCCTCTTGTTG
GATCAGCCTATAGATGTCGTCAAAGGAGAGAAGATCCGAGGCTTTCTCAG
TGTTGGTCGTCATAGTCAAGGCAAGCGGGGCCTGAATTTCTCTCTCGCCA
TCAATAATAATGCCGCTCAGAAATTTGAGTTTTCTTGAGCCCTTTATAAT
ATCAATATATTTAATTTCATATTAAA
back to top

protein sequence of SMED30006795-orf-1

>SMED30006795-orf-1 ID=SMED30006795-orf-1|Name=SMED30006795-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=498bp
MDSSDDNSDSYEGDEMQSFNYICLMCEASFNEIEEMLTHVFNIHNFNFKQ
ILKTVNISNEYDWIKIINYIRKHNINVNCDEINKGVWKSDEYLKPVIDDD
NLLFIDYENVFQICLPENSNRINELENELSICTETIAILRNKITDLLECD
VNETIKPPVNESKITKSSKLNEEDQAYFTGYSHYSIHDIMIKDKIRTESY
RKFIEENGREYFRNKIVLDIGCGTGILSMFAARAGAAHVYGIDCADIIYD
AMAIVEKNGLKEKITLIHGKLEDTELPCDKVDVVISEWMGYFLIYESMLD
SVVYGCRKYLDPSSGLVFPRYFTLNVVGADLSAYRAESVDCWNDVFGFDM
SSMKGNVMREVIVDVVPSDDVMTDWCLIRDYDVQQMAFGPAAVCPQLIER
QFQLTAVKSGKFGALVAYFDTFFISPDQPNGVMFSTGPGAVDTHWKQTIL
LLDQPIDVVKGEKIRGFLSVGRHSQGKRGLNFSLAINNNAAQKFEFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0018216peptidyl-arginine methylation
GO:0006479protein methylation
GO:0031397negative regulation of protein ubiquitination
GO:0032259methylation
GO:0035246peptidyl-arginine N-methylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR041698Methyltransf_25
IPR013087Znf_C2H2_type
IPR036236Znf_C2H2_sf
IPR029063SAM-dependent_MTases
IPR007087Znf_C2H2
IPR025799Arg_MeTrfase
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0008168methyltransferase activity
GO:0005515protein binding
GO:0016274protein-arginine N-methyltransferase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005840ribosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 122..142
NoneNo IPR availableGENE3DG3DSA:3.40.50.150coord: 165..319
e-value: 4.8E-53
score: 181.1
NoneNo IPR availableGENE3DG3DSA:2.70.160.11coord: 323..495
e-value: 4.7E-42
score: 145.8
NoneNo IPR availablePANTHERPTHR11006:SF74PROTEIN ARGININE N-METHYLTRANSFERASE 3coord: 10..490
NoneNo IPR availablePANTHERPTHR11006PROTEIN ARGININE N-METHYLTRANSFERASEcoord: 10..490
NoneNo IPR availableCDDcd02440AdoMet_MTasescoord: 217..286
e-value: 3.94912E-14
score: 66.2994
IPR041698Methyltransferase domain 25PFAMPF13649Methyltransf_25coord: 217..312
e-value: 5.0E-11
score: 43.2
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 23..44
IPR025799Protein arginine N-methyltransferasePROSITEPS51678SAM_MT_PRMTcoord: 174..487
score: 68.66
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 5..108
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 181..488