Argonaute 1

Overview
NameArgonaute 1
Smed IDSMED30006792
Length (bp)2720
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Argonaute 1 (SMED30006792) t-SNE clustered cells

Violin plots show distribution of expression levels for Argonaute 1 (SMED30006792) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Argonaute 1 (SMED30006792) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Argonaute 1 (SMED30006792) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006792

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior region of the whole animalSMED30006792SMESG000050994.1 dd_Smed_v4_2478_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30006792SMESG000050993.1 SMESG000050994.1 SmedASXL_005760SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006792SMESG000050993.1 SMESG000050994.1 SmedASXL_005760SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30006792SMESG000050994.1 dd_Smed_v4_2478_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006792SMESG000050994.1 dd_Smed_v4_2478_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30006792SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30006792SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006792SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006792SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006792SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006792SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006792SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006792SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006792SMESG000050993.1 SMESG000050994.1 dd_Smed_v4_1194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006792SMESG000050993.1 SMESG000050994.1 Contig34181uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006792SMESG000050993.1 SMESG000050994.1 Contig34181newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30006792SMESG000050994.1 dd_Smed_v4_2478_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Argonaute 1 vs. Ensembl Human
Match: AGO2 (argonaute RISC catalytic component 2 [Source:HGNC Symbol;Acc:HGNC:3263])

HSP 1 Score: 413.69 bits (1062), Expect = 3.941e-130
Identity = 265/756 (35.05%), Postives = 402/756 (53.17%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVF-GIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG + ++T   LP      ++      E ++      I +V  + +   +L     +  GR   +P E ++ALD + R   L     T  GR+ F      S PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+  + + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D +++ + I +  ++  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    ++L   + + G+ + G   F    Y           R+ +     L L+V ++      Y EVK+ GD + G+ TQC++    N Q+   Q L N+ LK+N KLGGVN  L P + R   P+    ++F G DVTHP +  +    S+AA+VGS+D +   Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC KLEKDYQP IT+IVVQKRH  R F  ++ + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   92 PVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKD-----RIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTASEGCSNPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQEEISKLMRSASFNT--DPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTEVHLKSFTEQLRKISRDAGMPIQGQPCF--CKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMK--NVQRTTPQTLSNLCLKINVKLGGVNNILLP-QGR--PPVFQQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQE-----IIQDLAAMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 814          
BLAST of Argonaute 1 vs. Ensembl Human
Match: AGO3 (argonaute RISC catalytic component 3 [Source:HGNC Symbol;Acc:HGNC:18421])

HSP 1 Score: 400.593 bits (1028), Expect = 4.018e-125
Identity = 251/684 (36.70%), Postives = 374/684 (54.68%), Query Frame = 3
Query:  495 LRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            + A+D + R +   K   T  GR+ F        PL  G  +   G+  ++RP MWK+  N D +    ++A  +  ++ +++D       P  L  +     T+++K L+V+  H          RKY +   + + A  +     +E   T+E    QYF+++Y ++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  + S       D F+Q ++ ++  ++  V  RVL  P   +GG+   +     G WD+R K+F    + +  WA+    T+R  Q  ++ L    D+L   + + G+ + G   F    Y           R+ +     L L++ ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  +E++AI+ AC  LEKDYQP ITYIVVQKRH  R F  +  + VGRSGN+P+GT VD DITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:  160 VHAVDVVLRHLPSMK--YTPVGRSFFSAPEGYDHPLGGGREVWF-GFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTM-----RRKYRVCNVTRRPASHQTFPLQLENGQTVERTVAQYFREKYTLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLVRSANYET--DPFVQEFQFKVRDEMAHVTGRVLPAPMLQYGGRNRTVATPSHGVWDMRGKQFHTGVE-IKMWAIACFATQR--QCREEILKGFTDQLRKISKDAGMPIQGQPCFCK--YAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVIKTSPQTLSNLCLKINVKLGGINNILVPHQRPSVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQE-----IIQDLASMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKDYQPGITYIVVQKRHHTRLFCADRTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 815          
BLAST of Argonaute 1 vs. Ensembl Human
Match: AGO1 (argonaute RISC component 1 [Source:HGNC Symbol;Acc:HGNC:3262])

HSP 1 Score: 396.356 bits (1017), Expect = 2.158e-124
Identity = 258/756 (34.13%), Postives = 402/756 (53.17%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG + I+T   LP  +           E ++      I +V  + + + +     ++       +P E+++ALD   R   L     T  GR+ F P      PL  G  +   G+  ++RP MWK+  N D +    ++A  + +++ +++D       P  L  +     T+++K L+V+  H          RKY +   + + A  +     +E   T+E    QYF+++YN++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  M +       D ++Q + I++   +  V  RVL  P   +GG+   +     G WD+R K+F    +  V WA+     ++  Q  ++ L +  D+L   + + G+ + G   F    Y           R+ +     L L++ ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R+ +F   +   +  G DVTHP +  +    S+ A+VGS+D + + Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGV EGQ   +  +E++AI+ AC KLEKDYQP ITYIVVQKRH  R F  ++ + +G+SGN+P+GT VD +ITH  EFDFYLCSH GIQGTS+P+HY+VL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYA L AFR R
Sbjct:   15 PVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKD-----RIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRH--LASMRYTPVGRSFFSPPEGYYHPLGGGREVWF-GFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQM-----KRKYRVCNVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLMKNASYNL--DPYIQEFGIKVKDDMTEVTGRVLPAPILQYGGRNRAIATPNQGVWDMRGKQFYNGIEIKV-WAIACFAPQK--QCREEVLKNFTDQLRKISKDAGMPIQGQPCFC--KYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVF---QQPVIFLGADVTHPPAG-DGKKPSITAVVGSMDAHPSRYCATVRVQRPRQE-----IIEDLSYMVRELLIQFYKSTR-FKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRAR 737          
BLAST of Argonaute 1 vs. Ensembl Human
Match: AGO1 (argonaute RISC component 1 [Source:HGNC Symbol;Acc:HGNC:3262])

HSP 1 Score: 395.586 bits (1015), Expect = 2.326e-123
Identity = 258/756 (34.13%), Postives = 402/756 (53.17%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG + I+T   LP  +           E ++      I +V  + + + +     ++       +P E+++ALD   R   L     T  GR+ F P      PL  G  +   G+  ++RP MWK+  N D +    ++A  + +++ +++D       P  L  +     T+++K L+V+  H          RKY +   + + A  +     +E   T+E    QYF+++YN++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  M +       D ++Q + I++   +  V  RVL  P   +GG+   +     G WD+R K+F    +  V WA+     ++  Q  ++ L +  D+L   + + G+ + G   F    Y           R+ +     L L++ ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R+ +F   +   +  G DVTHP +  +    S+ A+VGS+D + + Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGV EGQ   +  +E++AI+ AC KLEKDYQP ITYIVVQKRH  R F  ++ + +G+SGN+P+GT VD +ITH  EFDFYLCSH GIQGTS+P+HY+VL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYA L AFR R
Sbjct:   90 PVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKD-----RIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRH--LASMRYTPVGRSFFSPPEGYYHPLGGGREVWF-GFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQM-----KRKYRVCNVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLMKNASYNL--DPYIQEFGIKVKDDMTEVTGRVLPAPILQYGGRNRAIATPNQGVWDMRGKQFYNGIEIKV-WAIACFAPQK--QCREEVLKNFTDQLRKISKDAGMPIQGQPCFCK--YAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVF---QQPVIFLGADVTHPPAG-DGKKPSITAVVGSMDAHPSRYCATVRVQRPRQE-----IIEDLSYMVRELLIQFYKSTR-FKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRAR 812          
BLAST of Argonaute 1 vs. Ensembl Human
Match: AGO4 (argonaute RISC component 4 [Source:HGNC Symbol;Acc:HGNC:18424])

HSP 1 Score: 391.734 bits (1005), Expect = 8.659e-122
Identity = 256/761 (33.64%), Postives = 402/761 (52.83%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIR-------NLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVEK-------NLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERA-----IIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            P +DG R ++T   LP       +      E ++ T   ++Q V    ++L      +++  G  +++P ++++ALD I R   L     T  GR+ F P      PL  G  +   G+  ++RP MW +  N D +    + A  + +++ +++D   +N  T           T++++ L+V+  H          RKY +   + + A  +    +         T+ QYF+++Y+++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  + S  +    D +L+ + I +  ++  +  RVL  P   +GG+   +     G WD+R K+F    +  V WA+     ++  Q  +  L    D+L   + + G+ + G   F    Y           ++ +     L L+V ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q S++E +       E++ ++ +MV  LL+ FYK+ +  KP R+I+YR GVSEGQ   V   E+IAI+ AC  LE+DY+P ITYIVVQKRH  R F  ++ + VG+SGNVP+GT VD  ITH  EFDFYLCSH GIQGTS+P+HY VL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYA L AFR R
Sbjct:   82 PGYDGKRNMYTAHPLPIGRDRVDMEVTLPGEGKDQTFKVSVQWVSVVSLQL-----LLEALAGHLNEVPDDSVQALDVITRH--LPSMRYTPVGRSFFSPPEGYYHPLGGGREVWF-GFHQSVRPAMWNMMLNIDVSATAFYRAQPIIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQM-----KRKYRVCNVTRRPASHQTFPLQLENGQAMECTVAQYFKQKYSLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLVKSNSMVGGPDPYLKEFGIVVHNEMTELTGRVLPAPMLQYGGRNKTVATPNQGVWDMRGKQFYAGIEIKV-WAVACFAPQK--QCREDLLKSFTDQLRKISKDAGMPIQGQPCFCK--YAQGADSVEPMFKHLKMTYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKINAKLGGINNVLVPHQRPSVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKSTR-FKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQKRHHTRLFCADKTERVGKSGNVPAGTTVDSTITHPSEFDFYLCSHAGIQGTSRPSHYQVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRAR 816          
BLAST of Argonaute 1 vs. Ensembl Celegans
Match: alg-2 (pep chromosome:WBcel235:II:874160:879001:1 gene:WBGene00000106.1 transcript:T07D3.7b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-2)

HSP 1 Score: 399.438 bits (1025), Expect = 8.436e-125
Identity = 264/787 (33.55%), Postives = 417/787 (52.99%), Query Frame = 3
Query:  243 ILFSF*KYIRGM-PVFDGGRIIFTNKLLPYNDGTCKITHNFNYE-----SENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTSTPLRCGPYILME-------------GYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIR-NLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIESDGKI-VQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQR---PELLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSK-SVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            ++ SF KY   + PV+DG R ++T + LP        T   N+E        V   F++       + L  L++ ++   GR   +P EA++++D I R +   K   T  GR+ F P    P    P + M              G+  ++RP  WK+  N D +    + A+ + ++++++++         R   +  R   T++++ L+++  H       A  RKY +   + + A+ +     +E   TIE    +YF  +Y I+LKYP+L  ++     K T++P E+  ++P QR ++    +    +IK  A  A +R  ++   +S  ++    D F   + I I+P +  V+ RVL  P+ ++GG+      L   G WD+R K+F    + +  WA+     +   + ND  ++  +  L   + + G+ + G+  F       +E+V     +  ++    + L+V V+      Y EVK+ GD + GI TQC++    N  +   Q L N+ LK+N KLGGVN  L P +R R+F    +  +  G D+THPA+   D  K S+AA+VGS+D + + Y+A +R Q  ++E     I+ ++  MV  LL+ FY+ N + KP R++ YRDGVSEGQ   V ++E+ AI+ AC  LE  YQP IT+I VQKRH  R F  ++ D VG++ N+P GT VD  ITH  EFDF+LCSH GIQGTS+P+HYHVL+D+N+  +DELQ  TY +CH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   98 LISSFSKYFTNIRPVYDGKRNMYTREPLPIG------TEPMNFEVTLPGDSAVERKFSVTMKWIGQVCLSALDDAME---GRVRQVPHEAVQSIDVILRHLPSLK--YTPVGRSFFTP----PGVMKPGMQMHQESKLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYRAMPVIEFVAEVLELPVQALAERRALSDAQRVKFTKEIRGLKIEITHCG-----AVRRKYRVCNVTRRPAQTQTFPLQLETGQTIECTVAKYFFDKYRIQLKYPHLPCLQVGQEQKHTYLPPEVCDIVPGQRCLKKLTDVQTSTMIKATARSAPEREREICKLVSKAELS--ADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPNQGVWDMRGKQFHTGME-VRTWAIACFAQQSHVKENDLRMFTTQ--LQRISTDAGMPIIGTPMFCKY-ASGVEQVE-PMFKYLKQTYSAIQLIVVVLPGKTPIYAEVKRVGDTVLGIATQCVQAK--NAIRTTPQTLSNLCLKMNVKLGGVNSILLPNVRPRIF---NEPVIFLGCDITHPAA--GDTRKPSIAAVVGSMDAHPSRYAATVRVQQHRQE-----IITDLTYMVRELLVQFYR-NTRFKPARIVVYRDGVSEGQLFNVLQYELRAIREACVMLESGYQPGITFIAVQKRHHTRLFAADKADQVGKAFNIPPGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWDDNDLTADELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAFRAR 844          
BLAST of Argonaute 1 vs. Ensembl Celegans
Match: alg-1 (pep chromosome:WBcel235:X:13951262:13956261:1 gene:WBGene00000105.1 transcript:F48F7.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-1)

HSP 1 Score: 401.364 bits (1030), Expect = 1.825e-124
Identity = 266/800 (33.25%), Postives = 423/800 (52.88%), Query Frame = 3
Query:  243 ILFSF*KYIRGM-PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESEN-VTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKT---------STPLRCGPYI---------------------LMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIR-NLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIESDGKI-VQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQR--PELLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFS--YVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            ++ +F KY   + PV+DG R ++T + LP   G  ++  +     ++ V   F++       + L  L + ++   GR   +P EA++A+D I R +   K   T  GR+ F P           S P +    +                     +  G+  ++RP  WK+  N D +    + ++ + ++I+++++         R   +  R   T++++ L+++  H          RKY +   + + A+ +     +E   TIE    +YF  +Y I+LKYP+L  ++     K T++P E+  ++P QR I+    +    +IK  A  A +R  ++++ +   +     D F   + I I+P +  V+ RVL  P+ ++GG+     L   G WD+R K+F    D  V WA+     ++  + ND  L    ++L   +N+ G+ + G+  F    V  + +E +     +  ++    + L+V V+      Y EVK+ GD + GI TQC++    N  +   Q L N+ LK+N KLGGVN  L P +R R+F    +  + FG D+THP +  +    S+AA+VGS+D + + Y+A +R Q  ++E     I+ ++  MV  LL+ FY+ N + KP R++ YRDGVSEGQF  V ++E+ AI+ AC  LE+ YQP IT+I VQKRH  R F  ++KD VG++ N+P GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+NN  +DELQ  TY +CH Y RCTRSVS PAP YYAHL AFR R
Sbjct:  191 LISAFSKYFTNIRPVYDGKRNMYTREPLPI--GRERMDFDVTLPGDSAVERQFSVSLKWVGQVSLSTLEDAME---GRVRQVPFEAVQAMDVILRHLPSLK--YTPVGRSFFSPPVPNASGVMAGSCPPQASGAVAGGAHSAGQYHAESKLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYRSMPVIEFIAEVLELPVQALAERRALSDAQRVKFTKEIRGLKIEITHCGQ-----MRRKYRVCNVTRRPAQTQTFPLQLETGQTIECTVAKYFYDKYRIQLKYPHLPCLQVGQEQKHTYLPPEVCNIVPGQRCIKKLTDVQTSTMIKATARSAPEREREISNLVRKAEFS--ADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRTRATALPNQGVWDMRGKQFHTGIDVRV-WAIACFAQQQHVKEND--LRMFTNQLQRISNDAGMPIVGNPCFCKYAVGVEQVEPM----FKYLKQNYSGIQLVVVVLPGKTPVYAEVKRVGDTVLGIATQCVQ--AKNAIRTTPQTLSNLCLKMNVKLGGVNSILLPNVRPRIF---NEPVIFFGCDITHPPAG-DSRKPSIAAVVGSMDAHPSRYAATVRVQQHRQE-----IISDLTYMVRELLVQFYR-NTRFKPARIVVYRDGVSEGQFFNVLQYELRAIREACMMLERGYQPGITFIAVQKRHHTRLFAVDKKDQVGKAYNIPPGTTVDVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNLTADELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAFRAR 957          
BLAST of Argonaute 1 vs. Ensembl Celegans
Match: alg-2 (pep chromosome:WBcel235:II:873176:878945:1 gene:WBGene00000106.1 transcript:T07D3.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-2)

HSP 1 Score: 398.667 bits (1023), Expect = 2.010e-124
Identity = 264/787 (33.55%), Postives = 417/787 (52.99%), Query Frame = 3
Query:  243 ILFSF*KYIRGM-PVFDGGRIIFTNKLLPYNDGTCKITHNFNYE-----SENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTSTPLRCGPYILME-------------GYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIR-NLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIESDGKI-VQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQR---PELLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSK-SVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            ++ SF KY   + PV+DG R ++T + LP        T   N+E        V   F++       + L  L++ ++   GR   +P EA++++D I R +   K   T  GR+ F P    P    P + M              G+  ++RP  WK+  N D +    + A+ + ++++++++         R   +  R   T++++ L+++  H       A  RKY +   + + A+ +     +E   TIE    +YF  +Y I+LKYP+L  ++     K T++P E+  ++P QR ++    +    +IK  A  A +R  ++   +S  ++    D F   + I I+P +  V+ RVL  P+ ++GG+      L   G WD+R K+F    + +  WA+     +   + ND  ++  +  L   + + G+ + G+  F       +E+V     +  ++    + L+V V+      Y EVK+ GD + GI TQC++    N  +   Q L N+ LK+N KLGGVN  L P +R R+F    +  +  G D+THPA+   D  K S+AA+VGS+D + + Y+A +R Q  ++E     I+ ++  MV  LL+ FY+ N + KP R++ YRDGVSEGQ   V ++E+ AI+ AC  LE  YQP IT+I VQKRH  R F  ++ D VG++ N+P GT VD  ITH  EFDF+LCSH GIQGTS+P+HYHVL+D+N+  +DELQ  TY +CH Y RCTRSVS PAP YYAHL AFR R
Sbjct:  117 LISSFSKYFTNIRPVYDGKRNMYTREPLPIG------TEPMNFEVTLPGDSAVERKFSVTMKWIGQVCLSALDDAME---GRVRQVPHEAVQSIDVILRHLPSLK--YTPVGRSFFTP----PGVMKPGMQMHQESKLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYRAMPVIEFVAEVLELPVQALAERRALSDAQRVKFTKEIRGLKIEITHCG-----AVRRKYRVCNVTRRPAQTQTFPLQLETGQTIECTVAKYFFDKYRIQLKYPHLPCLQVGQEQKHTYLPPEVCDIVPGQRCLKKLTDVQTSTMIKATARSAPEREREICKLVSKAELS--ADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPNQGVWDMRGKQFHTGME-VRTWAIACFAQQSHVKENDLRMFTTQ--LQRISTDAGMPIIGTPMFCKY-ASGVEQVE-PMFKYLKQTYSAIQLIVVVLPGKTPIYAEVKRVGDTVLGIATQCVQAK--NAIRTTPQTLSNLCLKMNVKLGGVNSILLPNVRPRIF---NEPVIFLGCDITHPAA--GDTRKPSIAAVVGSMDAHPSRYAATVRVQQHRQE-----IITDLTYMVRELLVQFYR-NTRFKPARIVVYRDGVSEGQLFNVLQYELRAIREACVMLESGYQPGITFIAVQKRHHTRLFAADKADQVGKAFNIPPGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWDDNDLTADELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAFRAR 863          
BLAST of Argonaute 1 vs. Ensembl Celegans
Match: alg-1 (pep chromosome:WBcel235:X:13949114:13956261:1 gene:WBGene00000105.1 transcript:F48F7.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-1)

HSP 1 Score: 401.364 bits (1030), Expect = 2.716e-124
Identity = 266/800 (33.25%), Postives = 423/800 (52.88%), Query Frame = 3
Query:  243 ILFSF*KYIRGM-PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESEN-VTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKT---------STPLRCGPYI---------------------LMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIR-NLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIESDGKI-VQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQR--PELLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFS--YVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            ++ +F KY   + PV+DG R ++T + LP   G  ++  +     ++ V   F++       + L  L + ++   GR   +P EA++A+D I R +   K   T  GR+ F P           S P +    +                     +  G+  ++RP  WK+  N D +    + ++ + ++I+++++         R   +  R   T++++ L+++  H          RKY +   + + A+ +     +E   TIE    +YF  +Y I+LKYP+L  ++     K T++P E+  ++P QR I+    +    +IK  A  A +R  ++++ +   +     D F   + I I+P +  V+ RVL  P+ ++GG+     L   G WD+R K+F    D  V WA+     ++  + ND  L    ++L   +N+ G+ + G+  F    V  + +E +     +  ++    + L+V V+      Y EVK+ GD + GI TQC++    N  +   Q L N+ LK+N KLGGVN  L P +R R+F    +  + FG D+THP +  +    S+AA+VGS+D + + Y+A +R Q  ++E     I+ ++  MV  LL+ FY+ N + KP R++ YRDGVSEGQF  V ++E+ AI+ AC  LE+ YQP IT+I VQKRH  R F  ++KD VG++ N+P GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+NN  +DELQ  TY +CH Y RCTRSVS PAP YYAHL AFR R
Sbjct:  212 LISAFSKYFTNIRPVYDGKRNMYTREPLPI--GRERMDFDVTLPGDSAVERQFSVSLKWVGQVSLSTLEDAME---GRVRQVPFEAVQAMDVILRHLPSLK--YTPVGRSFFSPPVPNASGVMAGSCPPQASGAVAGGAHSAGQYHAESKLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYRSMPVIEFIAEVLELPVQALAERRALSDAQRVKFTKEIRGLKIEITHCGQ-----MRRKYRVCNVTRRPAQTQTFPLQLETGQTIECTVAKYFYDKYRIQLKYPHLPCLQVGQEQKHTYLPPEVCNIVPGQRCIKKLTDVQTSTMIKATARSAPEREREISNLVRKAEFS--ADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRTRATALPNQGVWDMRGKQFHTGIDVRV-WAIACFAQQQHVKEND--LRMFTNQLQRISNDAGMPIVGNPCFCKYAVGVEQVEPM----FKYLKQNYSGIQLVVVVLPGKTPVYAEVKRVGDTVLGIATQCVQ--AKNAIRTTPQTLSNLCLKMNVKLGGVNSILLPNVRPRIF---NEPVIFFGCDITHPPAG-DSRKPSIAAVVGSMDAHPSRYAATVRVQQHRQE-----IISDLTYMVRELLVQFYR-NTRFKPARIVVYRDGVSEGQFFNVLQYELRAIREACMMLERGYQPGITFIAVQKRHHTRLFAVDKKDQVGKAYNIPPGTTVDVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNLTADELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAFRAR 978          
BLAST of Argonaute 1 vs. Ensembl Celegans
Match: alg-4 (pep chromosome:WBcel235:III:9887211:9891358:-1 gene:WBGene00006449.1 transcript:ZK757.3a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-4)

HSP 1 Score: 296.204 bits (757), Expect = 1.469e-85
Identity = 196/540 (36.30%), Postives = 286/540 (52.96%), Query Frame = 3
Query:  915 TIEQYFQKEYNIKLKYPNLSMVKTSP-NKPTFVPIE-LLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQR----PELL-RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPY-QNIEKVAT--DTIRNSEKEKKKLDLLVFVVI---NDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWEL--SPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLS-KSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLI 2486
            ++  YF ++Y   LKYP L  +   P  +  F+P+E  L   P +   +   K    +IK AA+ A  R  ++    +    G   D FL+ + + +  ++I   ARV+  P  +FGG      P +  + G W + N+    P     ++++ A+   RD       L      L   A  +G  M    +   V Y ++ E V T    I +  +    +   + VV+   N + Y  VK+  D++ GI++QC+    ++R         NI+LK+N K+GG+N  +    I N+    +    MV GIDVTHP      ++  SVAA+V ++D     Y A ++ Q  KK R   E V+ + D +   ++TFY+  KQ KP R+I YRDGVSEGQF  V + EI +I++AC  + +D++PPITYIVVQKRH  R F + + D VG++ NVP GT VD  I     FDFYLCSH G+QGTS+PA YHVL DE  + +DE+QS TY +CH Y RCTRSVS P P YYA L A R R  +
Sbjct:  446 SVADYFSEKYG-PLKYPKLPCLHVGPPTRNIFLPMEHCLIDSPQKYNKKMSEKQTSAIIKAAAVDATQREDRIKQLAAQASFGT--DPFLKEFGVAVSSQMIQTTARVIQPPPIMFGGNNRSVNPVVFPKDGSWTMDNQTLYMPA-TCRSYSMIALVDPRD----QTSLQTFCQSLTMKATAMG--MNFPRWPDLVKYGRSKEDVCTLFTEIADEYRVTNTVCDCIIVVLQSKNSDIYMTVKEQSDIVHGIMSQCVLMKNVSRPT--PATCANIVLKLNMKMGGINSRIVADKITNKYL--VDQPTMVVGIDVTHPTQAEMRMNMPSVAAIVANVDLLPQSYGANVKVQ--KKCR---ESVVYLLDAIRERIITFYRHTKQ-KPARIIVYRDGVSEGQFSEVLREEIQSIRTACLAIAEDFRPPITYIVVQKRHHARIFCKYQNDMVGKAKNVPPGTTVDTGIVSPEGFDFYLCSHYGVQGTSRPARYHVLLDECKFTADEIQSITYGMCHTYGRCTRSVSIPTPVYYADLVATRARCHV 965          
BLAST of Argonaute 1 vs. Ensembl Fly
Match: AGO1 (gene:FBgn0262739 transcript:FBtr0305592)

HSP 1 Score: 417.157 bits (1071), Expect = 1.582e-130
Identity = 267/770 (34.68%), Postives = 407/770 (52.86%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLN----PNTIRN---LTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIESDGKI-VQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRG-----------------GKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG   ++T   LP  +   ++      E ++    F +    +  + L NL   ++   GR+  +P +A+ ALD + R   L     T  GR+ F        PL  G  +   G+  ++RP  WK+  N D +    ++A  + D++ +++D   +N    P T       T+++K L+++  H          RKY +   + + A+ +     +E   T+E    +YF  +Y +KL+YP+L  ++    +K T++P+E+  ++  QR I+    +    +IK  A  A DR  ++N+ +      N  D ++Q + + I   ++ V  RVL  P+  +GG+    L G                 G WD+R K+F    +  + WA+     +R  + +   L +   +L   +N+ G+ + G   F    Y           R  +     L L+V V+      Y EVK+ GD + G+ TQC++   +N+     Q L N+ LK+N KLGG+N  L P IR ++F    +  +  G DVTHP +  N    S+AA+VGS+D + + Y+A +R Q  ++E     I+ E+  MV  LL+ FYK+    KP R+I YRDGVSEGQF  V +HE+ AI+ AC KLE +Y+P IT+IVVQKRH  R F   +K+  G+SGN+P+GT VD  ITH  EFDFYLCSH+GIQGTS+P+HYHVL+D+N++ SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:  201 PVFDGRNNLYTRDPLPIGNERLELEVTLPGEGKDRI--FRVTIKWQAQVSLFNLEEALE---GRTRQIPYDAILALDVVMRH--LPSMTYTPVGRSFFSSPEGYYHPLGGGREVWF-GFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGQ-----MRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNN--DSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSTGLTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRI-WAIACFAPQRTVREDA--LRNFTQQLQKISNDAGMPIIGQPCFCK--YATGPDQVEPMFRYLKITFPGLQLVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTS--PQTLSNLCLKINVKLGGINSILVPSIRPKVF---NEPVIFLGADVTHPPAGDNK-KPSIAAVVGSMDAHPSRYAATVRVQQHRQE-----IIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLEPEYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 939          
BLAST of Argonaute 1 vs. Ensembl Fly
Match: AGO1 (gene:FBgn0262739 transcript:FBtr0087612)

HSP 1 Score: 417.157 bits (1071), Expect = 1.582e-130
Identity = 267/770 (34.68%), Postives = 407/770 (52.86%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLN----PNTIRN---LTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIESDGKI-VQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRG-----------------GKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG   ++T   LP  +   ++      E ++    F +    +  + L NL   ++   GR+  +P +A+ ALD + R   L     T  GR+ F        PL  G  +   G+  ++RP  WK+  N D +    ++A  + D++ +++D   +N    P T       T+++K L+++  H          RKY +   + + A+ +     +E   T+E    +YF  +Y +KL+YP+L  ++    +K T++P+E+  ++  QR I+    +    +IK  A  A DR  ++N+ +      N  D ++Q + + I   ++ V  RVL  P+  +GG+    L G                 G WD+R K+F    +  + WA+     +R  + +   L +   +L   +N+ G+ + G   F    Y           R  +     L L+V V+      Y EVK+ GD + G+ TQC++   +N+     Q L N+ LK+N KLGG+N  L P IR ++F    +  +  G DVTHP +  N    S+AA+VGS+D + + Y+A +R Q  ++E     I+ E+  MV  LL+ FYK+    KP R+I YRDGVSEGQF  V +HE+ AI+ AC KLE +Y+P IT+IVVQKRH  R F   +K+  G+SGN+P+GT VD  ITH  EFDFYLCSH+GIQGTS+P+HYHVL+D+N++ SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:  201 PVFDGRNNLYTRDPLPIGNERLELEVTLPGEGKDRI--FRVTIKWQAQVSLFNLEEALE---GRTRQIPYDAILALDVVMRH--LPSMTYTPVGRSFFSSPEGYYHPLGGGREVWF-GFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGQ-----MRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNN--DSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSTGLTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRI-WAIACFAPQRTVREDA--LRNFTQQLQKISNDAGMPIIGQPCFCK--YATGPDQVEPMFRYLKITFPGLQLVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTS--PQTLSNLCLKINVKLGGINSILVPSIRPKVF---NEPVIFLGADVTHPPAGDNK-KPSIAAVVGSMDAHPSRYAATVRVQQHRQE-----IIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLEPEYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 939          
BLAST of Argonaute 1 vs. Ensembl Fly
Match: AGO1 (gene:FBgn0262739 transcript:FBtr0087613)

HSP 1 Score: 417.157 bits (1071), Expect = 1.582e-130
Identity = 267/770 (34.68%), Postives = 407/770 (52.86%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLN----PNTIRN---LTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIESDGKI-VQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRG-----------------GKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG   ++T   LP  +   ++      E ++    F +    +  + L NL   ++   GR+  +P +A+ ALD + R   L     T  GR+ F        PL  G  +   G+  ++RP  WK+  N D +    ++A  + D++ +++D   +N    P T       T+++K L+++  H          RKY +   + + A+ +     +E   T+E    +YF  +Y +KL+YP+L  ++    +K T++P+E+  ++  QR I+    +    +IK  A  A DR  ++N+ +      N  D ++Q + + I   ++ V  RVL  P+  +GG+    L G                 G WD+R K+F    +  + WA+     +R  + +   L +   +L   +N+ G+ + G   F    Y           R  +     L L+V V+      Y EVK+ GD + G+ TQC++   +N+     Q L N+ LK+N KLGG+N  L P IR ++F    +  +  G DVTHP +  N    S+AA+VGS+D + + Y+A +R Q  ++E     I+ E+  MV  LL+ FYK+    KP R+I YRDGVSEGQF  V +HE+ AI+ AC KLE +Y+P IT+IVVQKRH  R F   +K+  G+SGN+P+GT VD  ITH  EFDFYLCSH+GIQGTS+P+HYHVL+D+N++ SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:  201 PVFDGRNNLYTRDPLPIGNERLELEVTLPGEGKDRI--FRVTIKWQAQVSLFNLEEALE---GRTRQIPYDAILALDVVMRH--LPSMTYTPVGRSFFSSPEGYYHPLGGGREVWF-GFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGQ-----MRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNN--DSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSTGLTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRI-WAIACFAPQRTVREDA--LRNFTQQLQKISNDAGMPIIGQPCFCK--YATGPDQVEPMFRYLKITFPGLQLVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTS--PQTLSNLCLKINVKLGGINSILVPSIRPKVF---NEPVIFLGADVTHPPAGDNK-KPSIAAVVGSMDAHPSRYAATVRVQQHRQE-----IIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLEPEYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 939          
BLAST of Argonaute 1 vs. Ensembl Fly
Match: AGO1 (gene:FBgn0262739 transcript:FBtr0087614)

HSP 1 Score: 416.387 bits (1069), Expect = 1.699e-130
Identity = 267/770 (34.68%), Postives = 407/770 (52.86%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLN----PNTIRN---LTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIESDGKI-VQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRG-----------------GKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG   ++T   LP  +   ++      E ++    F +    +  + L NL   ++   GR+  +P +A+ ALD + R   L     T  GR+ F        PL  G  +   G+  ++RP  WK+  N D +    ++A  + D++ +++D   +N    P T       T+++K L+++  H          RKY +   + + A+ +     +E   T+E    +YF  +Y +KL+YP+L  ++    +K T++P+E+  ++  QR I+    +    +IK  A  A DR  ++N+ +      N  D ++Q + + I   ++ V  RVL  P+  +GG+    L G                 G WD+R K+F    +  + WA+     +R  + +   L +   +L   +N+ G+ + G   F    Y           R  +     L L+V V+      Y EVK+ GD + G+ TQC++   +N+     Q L N+ LK+N KLGG+N  L P IR ++F    +  +  G DVTHP +  N    S+AA+VGS+D + + Y+A +R Q  ++E     I+ E+  MV  LL+ FYK+    KP R+I YRDGVSEGQF  V +HE+ AI+ AC KLE +Y+P IT+IVVQKRH  R F   +K+  G+SGN+P+GT VD  ITH  EFDFYLCSH+GIQGTS+P+HYHVL+D+N++ SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:  167 PVFDGRNNLYTRDPLPIGNERLELEVTLPGEGKDRI--FRVTIKWQAQVSLFNLEEALE---GRTRQIPYDAILALDVVMRH--LPSMTYTPVGRSFFSSPEGYYHPLGGGREVWF-GFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGQ-----MRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNN--DSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSTGLTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRI-WAIACFAPQRTVREDA--LRNFTQQLQKISNDAGMPIIGQPCFCK--YATGPDQVEPMFRYLKITFPGLQLVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTS--PQTLSNLCLKINVKLGGINSILVPSIRPKVF---NEPVIFLGADVTHPPAGDNK-KPSIAAVVGSMDAHPSRYAATVRVQQHRQE-----IIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLEPEYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 905          
BLAST of Argonaute 1 vs. Ensembl Fly
Match: AGO2 (gene:FBgn0087035 transcript:FBtr0331933)

HSP 1 Score: 270.396 bits (690), Expect = 7.115e-78
Identity = 220/751 (29.29%), Postives = 351/751 (46.74%), Query Frame = 3
Query:  282 VFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIF---DPKTSTPLRCGPYILMEGYATTI---RPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIRNLTRKL--KTLR-VQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVE--KNLTIEQYFQKEYNIKLKYPNLSMVKT-SPNKPTFVPIELLTMLPNQRVIESDGKI-VQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDE-DYKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLL--MTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLI 2486
             +DG    ++   LP N    ++T   +     +     I+   +  I+L +L  Y+     R  D P  A++ ++ +      NK +    GR+ F   DP     L  G   L+  Y   +   RP +     N D +      ++ + +Y+ +     ++N  T  + +R+     LR +   +      ++  R Y + G S   A  E      K +TI  YF    N  LK+P L  +   S  K   +PIEL ++   Q +   DG   V  +IK+AA     R  K+ + +   Q  +  D  +  + I I    I V  RVL  P+  +  +R  +++ G W +   KF++P  K    A+         + N   L D  + +      V I +      +Y P+ + E+ + DTI  ++ ++ + DL + ++      Y  +K+  ++  GI+TQC+K  T+ R K  +Q +GNI+LK+N KL G+N +   I++    P+  + M  G DVTHP+  + ++  SV  +  S D     Y+   R Q     R  +E   E+EDM    L  +  YK  +   P  +I+YRDGVS+GQF  +   E+  I+ AC K+    +P I  ++V KRH  RFFP  +     +  NV  GTVVD+ I H  E  F++ SH+ IQGT+KP  Y+V+ +  N   D LQ  TY LCH++ RC RSVSYPAP Y AHL A RGR  +
Sbjct:   39 AYDGKASCYSVDKLPLNSQNPEVTVT-DRNGRTLRYTIEIKETGDSTIDLKSLTTYMND---RIFDKPMRAMQCVEVVLASPCHNKAIRV--GRSFFKMSDPNNRHELDDGYEALVGLYQAFMLGDRPFL-----NVDISHKSFPISMPMIEYLERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETFEHDGKKVTIASYFHSR-NYPLKFPQLHCLNVGSSIKSILLPIELCSIEEGQALNRKDGATQVANMIKYAATSTNVRKRKIMNLLQYFQ--HNLDPTISRFGIRIANDFIVVSTRVLSPPQVEYHSKRFTMVKNGSWRMDGMKFLEPKPKAHKCAVLYCDPRSGRKMNYTQLNDFGNLIISQGKAVNISLDSDV--TYRPFTDDER-SLDTIF-ADLKRSQHDLAIVIIPQFRISYDTIKQKAELQHGILTQCIKQFTVER-KCNNQTIGNILLKINSKLNGINHK---IKDDPRLPMMKNTMYIGADVTHPSPDQREIP-SVVGVAASHDPYGASYNMQYRLQ-----RGALE---EIEDMFSITLEHLRVYKEYRNAYPDHIIYYRDGVSDGQFPKIKNEELRCIKQACDKV--GCKPKICCVIVVKRHHTRFFPSGDVTTSNKFNNVDPGTVVDRTIVHPNEMQFFMVSHQAIQGTAKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGRVYL 756          
BLAST of Argonaute 1 vs. Ensembl Zebrafish
Match: ago2 (argonaute RISC catalytic component 2 [Source:ZFIN;Acc:ZDB-GENE-110606-6])

HSP 1 Score: 412.535 bits (1059), Expect = 8.616e-130
Identity = 262/755 (34.70%), Postives = 402/755 (53.25%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG + ++T   LP   G  K+        E     F +       + L  L+  +    GR  ++P E ++ALD + R   L     T  GR+ F P    S PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+ +Y + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D +++ + + +   +  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    D+L   + + G+ + G   F    Y           ++ +   + L L+V ++      Y EVK+ GD + G+ TQC++    N QK   Q L N+ LK+N KLGGVN  L P    L    +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q  +++     I+ ++  MV  LL+ FYK+ +  KP R+I+YRDG+SEGQF+ V +HE++AI+ AC KLEKDYQP IT++VVQKRH  R F  +  + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N++ SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:  106 PVYDGRKNLYTAMPLPI--GRDKVELEVTIPGEGKDRSFKVAIKWMSCVSLQALHEAL---SGRLPNIPFETIQALDVVMRH--LPSMRYTPVGRSFFTPSEGCSNPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFMCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPASHQTFPLQQENGQTIECTVAQYFKDKYKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQDEISKLMRSANFNT--DPYVREFGVMVRDDMTEVNGRVLQAPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTELLLKAFTDQLRKISRDAGMPIQGQPCFCK--YAQGADSVEPMFKHLKYTYQGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQVK--NVQKTTPQTLSNLCLKINVKLGGVNNILLPQGRPLV--FQQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRVQQHRQD-----IIQDLATMVRELLIQFYKSTR-FKPTRIIYYRDGISEGQFNQVLQHELLAIREACIKLEKDYQPGITFVVVQKRHHTRLFCMDRNERVGKSGNIPAGTTVDTKITHPFEFDFYLCSHAGIQGTSRPSHYHVLWDDNHFTSDELQVLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 828          
BLAST of Argonaute 1 vs. Ensembl Zebrafish
Match: ago4 (argonaute RISC component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5357])

HSP 1 Score: 402.134 bits (1032), Expect = 7.258e-126
Identity = 258/761 (33.90%), Postives = 403/761 (52.96%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIR-------NLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVEK-------NLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIR-----QQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            P +DG R ++T   LP       +      E ++ T   ++Q V      + +L   +++  G  +++P+++++ALD I R   L     T  GR+ F P      PL  G  +   G+  ++RP MW +  N D +    + A  + +++ +++D   +N  T           T++++ L+V+  H          RKY +   + + A  +    +         T+ QYF+++Y+++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  + S  +    D +L+ + I +   +  V  RVL  P   +GG+   +     G WD+R K+F    +  V WA+     ++  Q  +  L    D+L   + + G+ + G   F    Y           ++ +     L L+V ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R     Q LS+++    E++ ++ +MV  LL+ FYK+ +  KP R+I+YR GVSEGQ   V   E+IAI+ AC  LE+DY+P ITYIVVQKRH  R F  ++ + VG+SGNVP+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYA L AFR R
Sbjct:   84 PGYDGKRNMYTAHPLPIGRDRVDLEVTLPGEGKDQTFKVSLQWV-----SVVSLQMLLEALSGHLNEVPEDSVQALDVITRH--LPSMRYTPVGRSFFSPPEGYYHPLGGGREVWF-GFHQSVRPAMWNMMLNIDVSATAFYRAQPVIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQM-----KRKYRVCNVTRRPASHQTFPLQLENGQAMECTVAQYFKQKYSLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLVKSNSMVGGPDPYLKEFGIVVHNDMTEVTGRVLPAPMLQYGGRNKTVATPNQGVWDMRGKQFYAGIEIKV-WAVACFAPQK--QCREDLLKSFTDQLRKISKDAGMPIQGQPCFCK--YAQGADSVEPMFKHLKMSYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKINAKLGGINNVLVPHQRPSVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDGHPSRYCATVRVQTSRQDLSQEQLFSQEVIQDLTNMVRELLIQFYKSTR-FKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQKRHHTRLFCSDKAERVGKSGNVPAGTTVDSTITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRAR 818          
BLAST of Argonaute 1 vs. Ensembl Zebrafish
Match: ago3b (argonaute RISC catalytic component 3b [Source:NCBI gene;Acc:568159])

HSP 1 Score: 399.823 bits (1026), Expect = 4.410e-125
Identity = 264/764 (34.55%), Postives = 400/764 (52.36%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQE--------ALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG + ++T + LP       +      E         I +V  + + L + +   +   GRS   P E         + A+D + R   L     T  GR+ F        PL  G  +   G+  ++RP MWK+  N D +    ++A  +  ++ +++D       P  L  +     T+++K L+V+  H          RKY +   + + A  +     +E   T+E    QYF+++YN++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  + S    +  D F+Q ++  +  ++  V  RVL  P   +GG+   +     G WD+R K+F    + +  WA+    T+R  Q  ++ L    D+L   + + G+ + G   F    Y           R+ +     L L++ ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q  ++E     ++ ++  MV  LL+ FYK+    KP R+IFYRDGVSEGQF  V  +E++AI+ AC  LEK+YQP ITYIVVQKRH  R F  +  + VGRSGN+P+GT VD DITH  EFDFYLCSH GIQGTS+P+HY+VL+D+N + +DE Q  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   84 PVYDGKKSLYTAQPLPVASAGVDLDVTLPGEGGKD----RIFKVTIKFVSLVSWHMLHEVLTGRSTPDPLELDKPISTNPVHAVDVVLRH--LPSMRYTPVGRSFFSSPEGYDHPLGGGREVWF-GFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTM-----RRKYRVCNVTRRPASHQTFPLQLENGQTVERTVAQYFREKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLVRSANYNS--DPFVQEFQFRVRDEMAEVTGRVLPAPMLQYGGRNRTVATPSHGVWDMRGKQFHTGVE-IKMWAIACFATQR--QCREEVLKGFTDQLRKISKDAGMPIQGQPCFCK--YAQGADNVEPMFRHLKNTYAGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKINVKLGGINNILVPHQRPSVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQE-----VIQDLASMVRELLIQFYKST-HYKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKEYQPGITYIVVQKRHHTRLFCADRAERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYYVLWDDNCFTADEFQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 815          
BLAST of Argonaute 1 vs. Ensembl Zebrafish
Match: ago1 (argonaute RISC component 1 [Source:ZFIN;Acc:ZDB-GENE-110606-3])

HSP 1 Score: 398.282 bits (1022), Expect = 1.712e-124
Identity = 263/765 (34.38%), Postives = 402/765 (52.55%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQ---------RVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG + I+T   LP   G+ K+        E     F +          R+ +E +  G L             +P E+++ALD   R   L     T  GR+ F P      PL  G  +   G+  ++RP MWK+  N D +    ++A  + +++ +++D       P  L  +     T+++K L+V+  H          RKY +   + + A  +     +E   T+E    QYF+++YN++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  M +       D ++Q + I++   +  V  RVL  P   +GG+   +     G WD+R K+F    +  V WA+     ++  Q  ++ L +  D+L   + + G+ + G   F    Y           R+ +     L L++ ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R+ +F   +   +  G DVTHP +  +    S+ A+VGS+D + + Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGV EGQ   +  +E++AI+ AC KLEKDYQP ITYIVVQKRH  R F  ++ + +G+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HY+VL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYA L AFR R
Sbjct:   91 PVYDGKKNIYTVLALPI--GSEKVDFEVTIPGEGKDRIFKVSIRWLAKVSWRLLQETLVSGRLQ------------VPLESVQALDVAMRH--LASMRYTPVGRSFFSPPEGYYHPLGGGREVWF-GFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRNIDEQPKTLTDSQRVRFTKEIKGLKVEVTHCGQM-----KRKYRVCNVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLMKNANFNL--DPYIQEFGIKVKDDMTEVTGRVLPAPILQYGGRNRAIATPNQGVWDMRGKQFYNGIEIKV-WAIACFAPQK--QCREEVLKNFTDQLRKISKDAGMPIQGQPCFCK--YAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVF---QQPVIFLGADVTHPPAG-DGKKPSITAVVGSMDAHPSRYCATVRVQRPRQE-----IIEDLSYMVRELLIQFYKSTR-FKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKSERIGKSGNIPAGTTVDTSITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRAR 813          
BLAST of Argonaute 1 vs. Ensembl Zebrafish
Match: ago3a (argonaute RISC catalytic component 3a [Source:ZFIN;Acc:ZDB-GENE-051107-16])

HSP 1 Score: 395.971 bits (1016), Expect = 1.483e-123
Identity = 264/771 (34.24%), Postives = 399/771 (51.75%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQE--------ALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRP---------ELLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG + ++T   LP       +      E           +V  + + L + +   +   GRS   P E         + A+D + R +   K   T  GR+ F        PL  G  +   G+  ++RP MWK+  N D +    ++A  +  ++ +++D       P  L  +     T+++K L+V+  H          RKY +   + + A  +     +E   T+E    QYF+++YN++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  + S       D F+Q ++ ++  ++  V  RVL  P   +GG+                G WD+R K+F    + +  WA+    T+R  Q  ++ L    D+L   + + G+ + G   F    Y           R+ +     L L++ ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q  ++E     ++ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  +E++AI+ AC  LEK+YQP ITYIVVQKRH  R F  +  + VGRSGN+P+GT VD DITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + +DE Q  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   84 PVYDGKKSLYTANPLPVAPAGVDLDVTLPGEGGKDRPF----KVSIKFVSLVSWHLLHEVLTGRSMPEPLELDKPISTNPVHAVDVVLRHLPSMK--YTPVGRSFFSAPEGYDHPLGGGREVWF-GFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTM-----RRKYRVCNVTRRPASHQTFPLQLENGQTVERTVAQYFREKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLVRSANY--EADPFVQEFQFKVRDEMAHVTGRVLPAPMLQYGGRVSTEHFMNRTVATPSHGVWDMRGKQFHTGVE-IKMWAIACFATQR--QCREEILKGFTDQLRKISKDAGMPIQGQPCFCK--YAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKINVKLGGINNILVPHQRPSVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQE-----VIQDLSSMVRELLIQFYKSTR-YKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKEYQPGITYIVVQKRHHTRLFCADRNERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADEFQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 822          
BLAST of Argonaute 1 vs. Ensembl Xenopus
Match: rbm26 (RNA binding motif protein 26 [Source:Xenbase;Acc:XB-GENE-960053])

HSP 1 Score: 411.379 bits (1056), Expect = 1.099e-129
Identity = 265/756 (35.05%), Postives = 400/756 (52.91%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVF-GIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG + ++T   LP      ++      E ++      I +V  + +   +L     +  GR   +P E ++ALD + R   L     T  GR+ F      + PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+  + + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D F++ + I +   +  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    ++L   + + G+ + G   F    Y           R+ +     L L+V ++      Y EVK+ GD + G+ TQC++    N Q+   Q L N+ LK+N KLGGVN  L P + R   P+    ++F G DVTHP +  +    S+AA+VGS+D +   Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC KLEKDYQP IT+IVVQKRH  R F  +  + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   65 PVFDGRKNLYTAMPLPIARDKVELEVTLPGEGKD-----RIFKVAIKWMACVSLQALHDALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTASEGCANPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFMCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQEEISKLMRSASFNT--DPFVREFGIMVKDDMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTEVHLKTFTEQLRKISRDAGMPIQGQPCF--CKYAQGADSVEPMFRHLKNTYTGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMK--NVQRTTPQTLSNLCLKINVKLGGVNNILLP-QGR--PPVFQQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQE-----IIQDLSAMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDRNERVGKSGNIPAGTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 787          
BLAST of Argonaute 1 vs. Ensembl Xenopus
Match: rbm26 (RNA binding motif protein 26 [Source:Xenbase;Acc:XB-GENE-960053])

HSP 1 Score: 410.994 bits (1055), Expect = 2.533e-129
Identity = 264/756 (34.92%), Postives = 398/756 (52.65%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPI-RNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG + ++T   LP      ++      E ++      I +V  + +   +L     +  GR   +P E ++ALD + R   L     T  GR+ F      + PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+  + + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D F++ + I +   +  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    ++L   + + G+ + G   F    Y           R+ +     L L+V ++      Y EVK+ GD + G+ TQC++    N Q+   Q L N+ LK+N KLGGVN  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D +   Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC KLEKDYQP IT+IVVQKRH  R F  +  + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   75 PVFDGRKNLYTAMPLPIARDKVELEVTLPGEGKD-----RIFKVAIKWMACVSLQALHDALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTASEGCANPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFMCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQEEISKLMRSASFNT--DPFVREFGIMVKDDMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTEVHLKTFTEQLRKISRDAGMPIQGQPCFCK--YAQGADSVEPMFRHLKNTYTGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMK--NVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQE-----IIQDLSAMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDRNERVGKSGNIPAGTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 797          
BLAST of Argonaute 1 vs. Ensembl Xenopus
Match: rbm26 (RNA binding motif protein 26 [Source:Xenbase;Acc:XB-GENE-960053])

HSP 1 Score: 411.379 bits (1056), Expect = 5.708e-129
Identity = 265/756 (35.05%), Postives = 400/756 (52.91%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVF-GIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG + ++T   LP      ++      E ++      I +V  + +   +L     +  GR   +P E ++ALD + R   L     T  GR+ F      + PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+  + + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D F++ + I +   +  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    ++L   + + G+ + G   F    Y           R+ +     L L+V ++      Y EVK+ GD + G+ TQC++    N Q+   Q L N+ LK+N KLGGVN  L P + R   P+    ++F G DVTHP +  +    S+AA+VGS+D +   Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC KLEKDYQP IT+IVVQKRH  R F  +  + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:  127 PVFDGRKNLYTAMPLPIARDKVELEVTLPGEGKD-----RIFKVAIKWMACVSLQALHDALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTASEGCANPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFMCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQM-----KRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQEEISKLMRSASFNT--DPFVREFGIMVKDDMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTEVHLKTFTEQLRKISRDAGMPIQGQPCF--CKYAQGADSVEPMFRHLKNTYTGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMK--NVQRTTPQTLSNLCLKINVKLGGVNNILLP-QGR--PPVFQQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQE-----IIQDLSAMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDRNERVGKSGNIPAGTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 849          
BLAST of Argonaute 1 vs. Ensembl Xenopus
Match: rbm26 (RNA binding motif protein 26 [Source:Xenbase;Acc:XB-GENE-960053])

HSP 1 Score: 407.142 bits (1045), Expect = 8.622e-128
Identity = 265/762 (34.78%), Postives = 398/762 (52.23%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRG--------GKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPI-RNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG + ++T   LP      ++      E ++      I +V  + +   +L     +  GR   +P E ++ALD + R   L     T  GR+ F      + PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+  + + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D F++ + I +   +  V  RVL  P  ++GG+  E            G WD+RNK+F    +  V WA+     +R  Q  +  L    ++L   + + G+ + G   F    Y           R+ +     L L+V ++      Y EVK+ GD + G+ TQC++    N Q+   Q L N+ LK+N KLGGVN  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D +   Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC KLEKDYQP IT+IVVQKRH  R F  +  + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   85 PVFDGRKNLYTAMPLPIARDKVELEVTLPGEGKD-----RIFKVAIKWMACVSLQALHDALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTASEGCANPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFMCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQEEISKLMRSASFNT--DPFVREFGIMVKDDMTDVTGRVLQPPSILYGGRVWEEPNNKAIATPVQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTEVHLKTFTEQLRKISRDAGMPIQGQPCFCK--YAQGADSVEPMFRHLKNTYTGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMK--NVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQE-----IIQDLSAMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDRNERVGKSGNIPAGTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 813          
BLAST of Argonaute 1 vs. Ensembl Xenopus
Match: rbm26 (RNA binding motif protein 26 [Source:Xenbase;Acc:XB-GENE-960053])

HSP 1 Score: 405.986 bits (1042), Expect = 3.439e-127
Identity = 266/766 (34.73%), Postives = 399/766 (52.09%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPY-NDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRG-----------GKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPI-RNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG + ++T   LP   D   ++      E ++      I +V  + +   +L     +  GR   +P E ++ALD + R   L     T  GR+ F      + PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+  + + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D F++ + I +   +  V  RVL  P  ++GG+  E               G WD+RNK+F    +  V WA+     +R  Q  +  L    ++L   + + G+ + G   F    Y           R+ +     L L+V ++      Y EVK+ GD + G+ TQC++    N Q+   Q L N+ LK+N KLGGVN  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D +   Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC KLEKDYQP IT+IVVQKRH  R F  +  + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   94 PVFDGRKNLYTAMPLPIARDKQVELEVTLPGEGKD-----RIFKVAIKWMACVSLQALHDALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTASEGCANPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFMCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQEEISKLMRSASFNT--DPFVREFGIMVKDDMTDVTGRVLQPPSILYGGRVWEEPNAPLNKAIATPVQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTEVHLKTFTEQLRKISRDAGMPIQGQPCFCK--YAQGADSVEPMFRHLKNTYTGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMK--NVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQE-----IIQDLSAMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDRNERVGKSGNIPAGTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 826          
BLAST of Argonaute 1 vs. Ensembl Mouse
Match: Ago2 (argonaute RISC catalytic subunit 2 [Source:MGI Symbol;Acc:MGI:2446632])

HSP 1 Score: 413.69 bits (1062), Expect = 2.925e-130
Identity = 264/756 (34.92%), Postives = 400/756 (52.91%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPI-RNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG + ++T   LP      ++      E ++      I +V  + +   +L     +  GR   +P E ++ALD + R   L     T  GR+ F      S PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+  + + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D +++ + I +  ++  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    ++L   + + G+ + G   F    Y           R+ +     L L+V ++      Y EVK+ GD + G+ TQC++    N Q+   Q L N+ LK+N KLGGVN  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D +   Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC KLEKDYQP IT+IVVQKRH  R F  ++ + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   93 PVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKD-----RIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTASEGCSNPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQEEISKLMRSASFNT--DPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCK--YAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMK--NVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQE-----IIQDLAAMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 815          
BLAST of Argonaute 1 vs. Ensembl Mouse
Match: Ago3 (argonaute RISC catalytic subunit 3 [Source:MGI Symbol;Acc:MGI:2446634])

HSP 1 Score: 404.445 bits (1038), Expect = 9.589e-127
Identity = 270/767 (35.20%), Postives = 404/767 (52.67%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESEN-------VTCHFNIQRVK----EEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG R ++T   LP    T  +  +     E        V+  F + RV      E +  G L   ++  K  S +     + A+D + R +   K   T  GR+ F        PL  G  +   G+  ++RP MWK+  N D +    ++A  +  ++ +++D       P  L  +     T+++K L+V+  H          RKY +   + + A  +     +E   T+E    QYF+++Y ++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  + S       D F+Q ++ ++  ++  V  RVL  P   +GG+   +     G WD+R K+F    + +  WA+    T+R  Q  ++ L    D+L   + + G+ + G   F    Y           R+ +     L L++ ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  +E++AI+ AC  LEKDYQP ITYIVVQKRH  R F  +  + VGRSGN+P+GT VD DITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   84 PVYDGKRSLYTANPLPV--ATTGVDLDVTLPGEGGKDRPFKVSVKF-VSRVSWHLLHEALAGGTLPEPLELDKPVSTN----PVHAVDVVLRHLPSMK--YTPVGRSFFSAPEGYDHPLGGGREVWF-GFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTM-----RRKYRVCNVTRRPASHQTFPLQLENGQTVERTVAQYFREKYTLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLVRSANYET--DPFVQEFQFKVRDEMAHVTGRVLPAPMLQYGGRNRTVATPSHGVWDMRGKQFHTGVE-IKMWAIACFATQR--QCREEILKGFTDQLRKISKDAGMPIQGQPCFCK--YAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVIKTSPQTLSNLCLKINVKLGGINNILVPHQRPSVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQE-----IIQDLASMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKDYQPGITYIVVQKRHHTRLFCADRTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNFFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 815          
BLAST of Argonaute 1 vs. Ensembl Mouse
Match: Ago1 (argonaute RISC catalytic subunit 1 [Source:MGI Symbol;Acc:MGI:2446630])

HSP 1 Score: 395.586 bits (1015), Expect = 1.597e-123
Identity = 258/756 (34.13%), Postives = 402/756 (53.17%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG + I+T   LP  +           E ++      I +V  + + + +     ++       +P E+++ALD   R   L     T  GR+ F P      PL  G  +   G+  ++RP MWK+  N D +    ++A  + +++ +++D       P  L  +     T+++K L+V+  H          RKY +   + + A  +     +E   T+E    QYF+++YN++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  M +       D ++Q + I++   +  V  RVL  P   +GG+   +     G WD+R K+F    +  V WA+     ++  Q  ++ L +  D+L   + + G+ + G   F    Y           R+ +     L L++ ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R+ +F   +   +  G DVTHP +  +    S+ A+VGS+D + + Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGV EGQ   +  +E++AI+ AC KLEKDYQP ITYIVVQKRH  R F  ++ + +G+SGN+P+GT VD +ITH  EFDFYLCSH GIQGTS+P+HY+VL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYA L AFR R
Sbjct:   90 PVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKD-----RIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRH--LASMRYTPVGRSFFSPPEGYYHPLGGGREVWF-GFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQM-----KRKYRVCNVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLMKNASYNL--DPYIQEFGIKVKDDMTEVTGRVLPAPILQYGGRNRAIATPNQGVWDMRGKQFYNGIEIKV-WAIACFAPQK--QCREEVLKNFTDQLRKISKDAGMPIQGQPCFCK--YAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVF---QQPVIFLGADVTHPPAG-DGKKPSITAVVGSMDAHPSRYCATVRVQRPRQE-----IIEDLSYMVRELLIQFYKSTR-FKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRAR 812          
BLAST of Argonaute 1 vs. Ensembl Mouse
Match: Ago4 (argonaute RISC catalytic subunit 4 [Source:MGI Symbol;Acc:MGI:1924100])

HSP 1 Score: 386.726 bits (992), Expect = 3.593e-120
Identity = 254/761 (33.38%), Postives = 402/761 (52.83%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIR-------NLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVEK-------NLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKE--RAII---EIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            P +DG R ++T   LP       +      E ++ T   ++Q V    ++L      +++  G  +++P ++++ALD I R   L     T  GR+ F P      PL  G  +   G+  ++RP MW +  N D +    + A  + +++ +++D   +N  T           T++++ L+V+  H          RKY +   + + A  +    +         T+ QYF+++Y+++LK+P+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  + S  +    D +L+ + I +  ++  +  RVL  P   +GG+   +     G WD+R K+F    +  V WA+     ++  Q  +  L    D+L   + + G+ + G   F    Y           ++ +     L L+V ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q S++E  + ++   E+V ++  M   LL+ FYK+ +  KP R+I+YR GVSEGQ   V   E+IAI+ AC  LE+DY+P ITYIVVQKRH  R F  ++ + VG+SGNVP+GT VD  +TH  EFDFYLCSH GIQGTS+P+HY VL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYA L AFR R
Sbjct:   82 PGYDGKRNMYTAHPLPIGRDRIDMEVTLPGEGKDQTFKVSVQWVSVVSLQL-----LLEALAGHLNEVPDDSVQALDVITRH--LPSMRYTPVGRSFFSPPEGYYHPLGGGREVWF-GFHQSVRPAMWNMMLNIDVSATAFYRAQPIIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQ-----MKRKYRVCNVTRRPASHQTFPLQLENGQAMECTVAQYFKQKYSLQLKHPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLVKSNSMVGGPDPYLKEFGIVVHNEMTELTGRVLPAPMLQYGGRNKTVATPSQGVWDMRGKQFYAGIEIKV-WAVACFAPQK--QCREDLLKSFTDQLRKISKDAGMPIQGQPCFCK--YAQGADSVEPMFKHLKMTYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKMNAKLGGINNVLVPHQRPSVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDGHPSRYCATVRVQTSRQEITQELLYSQEVVQDLTSMARELLIQFYKSTR-FKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQKRHHTRLFCADKMERVGKSGNVPAGTTVDSTVTHPSEFDFYLCSHAGIQGTSRPSHYQVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRAR 816          
BLAST of Argonaute 1 vs. Ensembl Mouse
Match: Ago1 (argonaute RISC catalytic subunit 1 [Source:MGI Symbol;Acc:MGI:2446630])

HSP 1 Score: 353.599 bits (906), Expect = 4.689e-111
Identity = 208/528 (39.39%), Postives = 306/528 (57.95%), Query Frame = 3
Query:  924 QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPE-----LLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            QYF+++YN++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  M +       D ++Q + I++   +  V  RVL  P   +GG+            G WD+R K+F    +  V WA+     ++  Q  ++ L +  D+L   + + G+ + G   F    Y           R+ +     L L++ ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R+ +F   +   +  G DVTHP +  +    S+ A+VGS+D + + Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGV EGQ   +  +E++AI+ AC KLEKDYQP ITYIVVQKRH  R F  ++ + +G+SGN+P+GT VD +ITH  EFDFYLCSH GIQGTS+P+HY+VL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYA L AFR R
Sbjct:    1 QYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLMKNASYNL--DPYIQEFGIKVKDDMTEVTGRVLPAPILQYGGRVSRNRAIATPNQGVWDMRGKQFYNGIEIKV-WAIACFAPQK--QCREEVLKNFTDQLRKISKDAGMPIQGQPCF--CKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVF---QQPVIFLGADVTHPPAG-DGKKPSITAVVGSMDAHPSRYCATVRVQRPRQE-----IIEDLSYMVRELLIQFYKSTR-FKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRAR 508          
BLAST of Argonaute 1 vs. UniProt/SwissProt
Match: sp|Q9UKV8|AGO2_HUMAN (Protein argonaute-2 OS=Homo sapiens OX=9606 GN=AGO2 PE=1 SV=3)

HSP 1 Score: 413.69 bits (1062), Expect = 1.893e-129
Identity = 265/756 (35.05%), Postives = 402/756 (53.17%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVF-GIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG + ++T   LP      ++      E ++      I +V  + +   +L     +  GR   +P E ++ALD + R   L     T  GR+ F      S PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+  + + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D +++ + I +  ++  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    ++L   + + G+ + G   F    Y           R+ +     L L+V ++      Y EVK+ GD + G+ TQC++    N Q+   Q L N+ LK+N KLGGVN  L P + R   P+    ++F G DVTHP +  +    S+AA+VGS+D +   Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC KLEKDYQP IT+IVVQKRH  R F  ++ + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   92 PVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKD-----RIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTASEGCSNPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQEEISKLMRSASFNT--DPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTEVHLKSFTEQLRKISRDAGMPIQGQPCF--CKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMK--NVQRTTPQTLSNLCLKINVKLGGVNNILLP-QGR--PPVFQQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQE-----IIQDLAAMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 814          
BLAST of Argonaute 1 vs. UniProt/SwissProt
Match: sp|O77503|AGO2_RABIT (Protein argonaute-2 (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=AGO2 PE=1 SV=2)

HSP 1 Score: 412.92 bits (1060), Expect = 1.916e-129
Identity = 265/756 (35.05%), Postives = 402/756 (53.17%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVF-GIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG + ++T   LP      ++      E ++      I +V  + +   +L     +  GR   +P E ++ALD + R   L     T  GR+ F      S PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+  + + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D +++ + I +  ++  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    ++L   + + G+ + G   F    Y           R+ +     L L+V ++      Y EVK+ GD + G+ TQC++    N Q+   Q L N+ LK+N KLGGVN  L P + R   P+    ++F G DVTHP +  +    S+AA+VGS+D +   Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC KLEKDYQP IT+IVVQKRH  R F  ++ + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   73 PVFDGRKNLYTAMPLPIGREKVELEVTLPGEGKD-----RIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTASEGCSNPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQEEISKLMRSASFNT--DPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCK--YAQGADSVGPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMK--NVQRTTPQTLSNLCLKINVKLGGVNNILLP-QGR--PPVFQQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQE-----IIQDLAAMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 795          
BLAST of Argonaute 1 vs. UniProt/SwissProt
Match: sp|Q8CJG0|AGO2_MOUSE (Protein argonaute-2 OS=Mus musculus OX=10090 GN=Ago2 PE=1 SV=3)

HSP 1 Score: 413.69 bits (1062), Expect = 2.046e-129
Identity = 264/756 (34.92%), Postives = 400/756 (52.91%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPI-RNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG + ++T   LP      ++      E ++      I +V  + +   +L     +  GR   +P E ++ALD + R   L     T  GR+ F      S PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+  + + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D +++ + I +  ++  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    ++L   + + G+ + G   F    Y           R+ +     L L+V ++      Y EVK+ GD + G+ TQC++    N Q+   Q L N+ LK+N KLGGVN  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D +   Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC KLEKDYQP IT+IVVQKRH  R F  ++ + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   93 PVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKD-----RIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTASEGCSNPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQEEISKLMRSASFNT--DPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCK--YAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMK--NVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQE-----IIQDLAAMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 815          
BLAST of Argonaute 1 vs. UniProt/SwissProt
Match: sp|Q6QME8|AGO2_BOVIN (Protein argonaute-2 OS=Bos taurus OX=9913 GN=AGO2 PE=2 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 2.421e-129
Identity = 265/756 (35.05%), Postives = 402/756 (53.17%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVF-GIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG + ++T   LP      ++      E ++      I +V  + +   +L     +  GR   +P E ++ALD + R   L     T  GR+ F      S PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+  + + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D +++ + I +  ++  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    ++L   + + G+ + G   F    Y           R+ +     L L+V ++      Y EVK+ GD + G+ TQC++    N Q+   Q L N+ LK+N KLGGVN  L P + R   P+    ++F G DVTHP +  +    S+AA+VGS+D +   Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC KLEKDYQP IT+IVVQKRH  R F  ++ + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   93 PVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKD-----RIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTASEGCSNPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQEEISKLMRSASFNT--DPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTEVHLKSFTEQLRKISRDAGMPIQGQPCF--CKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMK--NVQRTTPQTLSNLWLKINVKLGGVNNILLP-QGR--PPVFQQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQE-----IIQDLAAMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 815          
BLAST of Argonaute 1 vs. UniProt/SwissProt
Match: sp|Q9QZ81|AGO2_RAT (Protein argonaute-2 OS=Rattus norvegicus OX=10116 GN=Ago2 PE=1 SV=2)

HSP 1 Score: 412.149 bits (1058), Expect = 7.007e-129
Identity = 263/756 (34.79%), Postives = 400/756 (52.91%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPI-RNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG + ++T   LP      ++      E ++      I +V  + +   +L     +  GR   +P E ++ALD + R   L     T  GR+ F      S PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+  + + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D +++ + I +  ++  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    ++L   + + G+ + G   F    Y           R+ +     L L+V ++      Y EVK+ GD + G+ TQC++    N Q+   Q L N+ LK+N KLGGVN  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D +   Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC KLEK+YQP IT+IVVQKRH  R F  ++ + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   93 PVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKD-----RIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTASEGCSNPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQEEISKLMRSASFNT--DPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCK--YAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMK--NVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQE-----IIQDLAAMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKEYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 815          
BLAST of Argonaute 1 vs. TrEMBL
Match: A0A0M5JTQ7 (Argonaute 1 OS=Macrostomum lignano OX=282301 GN=ago1 PE=2 SV=1)

HSP 1 Score: 513.457 bits (1321), Expect = 2.485e-165
Identity = 297/754 (39.39%), Postives = 436/754 (57.82%), Query Frame = 3
Query:  318 LLPYNDGTCKITHN-FNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTSTPL--RCG--PYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIRN---------LTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVE--KNLTIEQYFQKEYNIKLKYPNLSMVKTSPNKPTFVPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPE-GIFGGQRPELLRG-GKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSY-VPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLD-QYLGNIMLKVNGKLGGVNWELSPIRNRLFTP----IKDSFMVFGIDVTHPAST-RNDLSKSVAAMVGSLDNNATMYSALIRQQLSKK---ERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLE--KDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLIG 2489
            LLP + G  +  ++    ES   T HF            G+++ Y+ ++ G +D +P +A+R +D + +  F+ K+++ IG RA+F  + S PL  R G  P+++ +G   ++RP  W VR N D TQV C+ + NL D + +I    R   +             L + +K  RV+A+H K  +G  ++RK+TIF      A     ++    LT++QYF+K+Y   LKYP +   K S N+ T +P+EL TM+P Q+  + +G+IV  +I+ AA+PA  R  ++   +  L +   G  +L  +K+ ID +++ +  RVL  P  G    Q  +L RG GKWD RN  F +   ++  WA   +    D  RND P +++  +  G  N + +R     Y     P  ++        R  +K+K +  + V    + E YK +K  GD+ +GI+TQ +    +   +    Q +GNI+LK+NGKLGG+NW L  +   L       +K+  +VFG DVTHPA T  N + KS+AA+V S+D N T YSA  R+Q+S+K     A+ E++ +M+  V  LL+ FYK N   KP  ++FYRDGVSEGQF  V +HE+ AIQ AC ++    +Y+P IT+I+V KRH  R FP + +D VG+SGN P+GTVVD DI H REF+FYL SHEGIQGTSKP+ YHVL+D+N W SD+LQ FTY+LCH+Y RCTRSVS P+P YYAHL AFR RT  G
Sbjct:   78 LLPKDSGEGENEYSVLVVESRTPTRHF------------GDISTYLTTEMGTAD-IPIDAIRVVDVLLKATFIEKSMVPIGSRALFFER-SVPLGQREGDLPWVMHQGLFASLRPQ-WSVRLNVDNTQVACYPSKNLADLLYEIGKSKRWRDDVWNRELSDRDRIILGKLVKMCRVEASHYKTKEGHNFTRKHTIFDLKRSPAASTITLDDGSQLTVQQYFKKQYGRDLKYPYMPCAKVSSNRNTLLPVELCTMMPYQKPPDKEGEIVSAIIRKAAVPAEQRKAEIEDRLKRLDLNRSG--YLAEFKVNIDVRMLQLWGRVLGSPAIGYAKNQSVKLDRGPGKWDARNAVFFET-GQVQRWAFVNLD---DRVRNDMPFFNMLTQQAGQ-NGIPLREDNCKYVKEGRPNHDL---IDRMFREFQKDKIEFAMFVVNAFDKESYKTIKSLGDLKYGIITQAVLSKNVEGPRAPSPQTVGNILLKINGKLGGINWRLDQLARDLNAEGRAIVKEPMIVFGADVTHPAPTGDNSIRKSIAAVVASMDVNFTRYSAEFREQVSRKGTETNAVKEVIDDMKGAVKALLLKFYKRNG-FKPTSIMFYRDGVSEGQFTEVLRHEVAAIQQACTEMATGNEYEPRITFIIVGKRHHTRLFPASRQDAVGKSGNCPAGTVVDTDIVHKREFNFYLLSHEGIQGTSKPSLYHVLWDDNKWSSDDLQLFTYYLCHVYMRCTRSVSIPSPVYYAHLCAFRARTWQG 805          
BLAST of Argonaute 1 vs. TrEMBL
Match: A0A267DZ88 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029800g1 PE=4 SV=1)

HSP 1 Score: 516.153 bits (1328), Expect = 1.287e-163
Identity = 297/754 (39.39%), Postives = 441/754 (58.49%), Query Frame = 3
Query:  318 LLPYNDGTCKITHN-FNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTSTPL--RCG--PYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTI-RNLTRK--------LKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVE--KNLTIEQYFQKEYNIKLKYPNLSMVKTSPNKPTFVPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPE-GIFGGQRPELLRG-GKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSY-VPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLD-QYLGNIMLKVNGKLGGVNWELSPIRNRLFTP----IKDSFMVFGIDVTHPAST-RNDLSKSVAAMVGSLDNNATMYSALIRQQLSKK---ERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLE--KDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLIG 2489
            LLP + G  +  ++    ES   T HF            G+++ Y+ ++ G +D +P +A+R +D + +  F+ K+++ IG RA+F  + S PL  R G  P+++ +G   ++RP  W VR N D TQV C+ + NL D + +I    R   +   R L+ K        +K  RV+A+H K  +G+ ++RK+TIF      A     ++    LT++QYF+K+Y   L+YP++   K S N+ T +P+EL TM+P Q+  + +G+IV  +I+ AA+PA  R  ++   +  L++     ++L  +K+ ID +++ +  RVL  P  G    Q  +L RG GKWD RN  F +   ++  WA   +    D  RND P +++  +  G  N + +R     Y     P  ++        R  +K+K +  + V    + E YK +K  GD+ +GI+TQ +    +   +    Q +GNI+LK+NGKLGG+NW L  +   L       +K+  +VFG DVTHPA T  N + KS+AA+V S+D N T YSA  R+Q+S+K     A+ E++ +M+  V  LL+ FYK N   KP  ++FYRDGVSEGQF  V +HE+ AIQ AC ++    +Y+P IT+I+V KRH  R FP + +D VG+SGN P+GTVVD DI H REF+FYL SHEGIQGTSKP+ YHVL+D+N W SD+LQ FTY+LCH+Y RCTRSVS P+P YYAHL AFR RT  G
Sbjct:  321 LLPKDSGEGENEYSVLVVESRTPTRHF------------GDISTYLTTEMGTAD-IPIDAIRVVDVLLKATFIEKSMVPIGSRALFFER-SVPLGQREGELPWVMHQGLFASLRPQ-WSVRLNVDNTQVACYPSKNLADLLYEIGKSKRWRDDVWNRELSDKDRIILGKLVKMCRVEASHYKTKEGRNFTRKHTIFDLKRSPAASTITLDDGSTLTVQQYFKKQYGRDLQYPHMPCAKVSSNRNTLLPVELCTMMPYQKPPDKEGEIVSAIIRKAAVPAEQRKAEIEDRLKRLELNK--SRYLAEFKVNIDVRMLQLWGRVLGSPAIGYAKNQSVKLDRGPGKWDARNAVFFET-GQVQRWAFVNLD---DRVRNDMPFFNMLTQQAGQ-NGIPLREDNCKYVKEGRPNHDL---IDRMFREFQKDKIEFAMFVVNAFDKESYKTIKSLGDLKYGIITQAVLSKNVEGPRAPSPQTVGNILLKINGKLGGINWRLDQLARDLNAEGRAIVKEPMIVFGADVTHPAPTGDNSIRKSIAAVVASMDVNFTRYSAEFREQVSRKGTETNAVKEVIDDMKGAVKALLLKFYKRNG-FKPTSIMFYRDGVSEGQFTEVLRHEVAAIQQACTEMATGNEYEPRITFIIVGKRHHTRLFPASRQDAVGKSGNCPAGTVVDTDIVHKREFNFYLLSHEGIQGTSKPSLYHVLWDDNKWSSDDLQLFTYYLCHVYMRCTRSVSIPSPVYYAHLCAFRARTWQG 1048          
BLAST of Argonaute 1 vs. TrEMBL
Match: A0A267GJP1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027596g1 PE=4 SV=1)

HSP 1 Score: 515.768 bits (1327), Expect = 1.947e-163
Identity = 296/754 (39.26%), Postives = 442/754 (58.62%), Query Frame = 3
Query:  318 LLPYNDGTCKITHN-FNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTSTPL--RCG--PYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTI-RNLTRK--------LKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVE--KNLTIEQYFQKEYNIKLKYPNLSMVKTSPNKPTFVPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPE-GIFGGQRPELLRG-GKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSY-VPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLD-QYLGNIMLKVNGKLGGVNWELSPIRNRLFTP----IKDSFMVFGIDVTHPAST-RNDLSKSVAAMVGSLDNNATMYSALIRQQLSKK---ERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLE--KDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLIG 2489
            LLP + G  +  ++    ES   T HF            G+++ Y+ ++ G +D +P +A+R +D + +  F+ K+++ IG RA+F  + S PL  R G  P+++ +G   ++RP  W VR N D TQV C+ + NL D + +I    R   +   R L+ K        +K  RV+A+H K  +G+ ++RK+TIF      A     ++    LT++QYF+K+Y   L+YP++   K S N+ T +P+EL TM+P Q+  + +G+IV  +I+ AA+PA  R  ++   +  L++     ++L  +K+ ID +++ +  RVL  P  G    Q  +L RG GKWD RN  F +   ++  WA   +    D  RND P +++  +  G  N + +R     Y     P  ++        R  +K+K +  + V    + E YK +K  GD+ +GI+TQ +    +   +    Q +GNI+LK+NGKLGG+NW L  +   L       +K+  +VFG DVTHPA T  N + KS+AA+V S+D N T YSA  R+Q+S+K     A+ E++ +M+  V  LL+ FYK N   KP  ++FYRDGVSEGQF  V +HE+ AIQ AC ++    +Y+P IT+I+V KRH  R FP +++D +G+SGN P+GTVVD DI H REF+FYL SHEGIQGTSKP+ YHVL+D+N W SD+LQ FTY+LCH+Y RCTRSVS P+P YYAHL AFR RT  G
Sbjct:  313 LLPKDSGEGENEYSVLVVESRTPTRHF------------GDISTYLTTEMGTAD-IPIDAIRVVDVLLKATFIEKSMVPIGSRALFFER-SVPLGQREGDLPWVMHQGLFASLRPQ-WSVRLNVDNTQVACYPSKNLADLLYEIGKSKRWRDDVWNRELSDKDRIILGKLVKMCRVEASHYKTKEGRNFTRKHTIFDLKRSPAASTITLDDGSTLTVQQYFKKQYGRDLQYPHMPCAKVSSNRNTLLPVELCTMMPYQKPPDKEGEIVSAIIRKAAVPAEQRKAEIEDRLKRLELNK--SRYLAEFKVNIDVRMLQLWGRVLGSPAIGYAKNQSVKLDRGPGKWDARNAVFFET-GQVQRWAFVNLD---DRVRNDMPFFNMLTQQAGQ-NGIPLREDNCKYVKEGRPNHDL---IDRMFREFQKDKIEFAMFVVNAFDKESYKTIKSLGDLKYGIITQAVLSKNVEGPRAPSPQTVGNILLKINGKLGGINWRLDQLARDLNAEGRAIVKEPMIVFGADVTHPAPTGDNSIRKSIAAVVASMDVNFTRYSAEFREQVSRKGTETNAVKEVIDDMKGAVKALLLKFYKRNG-FKPTSIMFYRDGVSEGQFTEVLRHEVAAIQQACTEMATGNEYEPRITFIIVGKRHHTRLFPASKQDAIGKSGNCPAGTVVDTDIVHKREFNFYLLSHEGIQGTSKPSLYHVLWDDNKWSSDDLQLFTYYLCHVYMRCTRSVSIPSPVYYAHLCAFRARTWQG 1040          
BLAST of Argonaute 1 vs. TrEMBL
Match: A0A267GY18 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013602g1 PE=4 SV=1)

HSP 1 Score: 514.612 bits (1324), Expect = 6.762e-163
Identity = 297/754 (39.39%), Postives = 436/754 (57.82%), Query Frame = 3
Query:  318 LLPYNDGTCKITHN-FNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTSTPL--RCG--PYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIRN---------LTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVE--KNLTIEQYFQKEYNIKLKYPNLSMVKTSPNKPTFVPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPE-GIFGGQRPELLRG-GKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSY-VPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLD-QYLGNIMLKVNGKLGGVNWELSPIRNRLFTP----IKDSFMVFGIDVTHPAST-RNDLSKSVAAMVGSLDNNATMYSALIRQQLSKK---ERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLE--KDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLIG 2489
            LLP + G  +  ++    ES   T HF            G+++ Y+ ++ G +D +P +A+R +D + +  F+ K+++ IG RA+F  + S PL  R G  P+++ +G   ++RP  W VR N D TQV C+ + NL D + +I    R   +             L + +K  RV+A+H K  +G  ++RK+TIF      A     ++    LT++QYF+K+Y   LKYP +   K S N+ T +P+EL TM+P Q+  + +G+IV  +I+ AA+PA  R  ++   +  L +   G  +L  +K+ ID +++ +  RVL  P  G    Q  +L RG GKWD RN  F +   ++  WA   +    D  RND P +++  +  G  N + +R     Y     P  ++        R  +K+K +  + V    + E YK +K  GD+ +GI+TQ +    +   +    Q +GNI+LK+NGKLGG+NW L  +   L       +K+  +VFG DVTHPA T  N + KS+AA+V S+D N T YSA  R+Q+S+K     A+ E++ +M+  V  LL+ FYK N   KP  ++FYRDGVSEGQF  V +HE+ AIQ AC ++    +Y+P IT+I+V KRH  R FP + +D VG+SGN P+GTVVD DI H REF+FYL SHEGIQGTSKP+ YHVL+D+N W SD+LQ FTY+LCH+Y RCTRSVS P+P YYAHL AFR RT  G
Sbjct:  331 LLPKDSGEGENEYSVLVVESRTPTRHF------------GDISTYLTTEMGTAD-IPIDAIRVVDVLLKATFIEKSMVPIGSRALFFER-SVPLGQREGDLPWVMHQGLFASLRPQ-WSVRLNVDNTQVACYPSKNLADLLYEIGKSKRWRDDVWNRELSDRDRIILGKLVKMCRVEASHYKTKEGHNFTRKHTIFDLKRSPAASTITLDDGSQLTVQQYFKKQYGRDLKYPYMPCAKVSSNRNTLLPVELCTMMPYQKPPDKEGEIVSAIIRKAAVPAEQRKAEIEDRLKRLDLNRSG--YLAEFKVNIDVRMLQLWGRVLGSPAIGYAKNQSVKLDRGPGKWDARNAVFFEA-GQVQRWAFVNLD---DRVRNDMPFFNMLTQQAGQ-NGIPLREDNCKYVKEGRPNHDL---IDRMFREFQKDKIEFAMFVVNAFDKESYKTIKSLGDLKYGIITQAVLSKNVEGPRAPSPQTVGNILLKINGKLGGINWRLDQLARDLNAEGRAIVKEPMIVFGADVTHPAPTGDNSIRKSIAAVVASMDVNFTRYSAEFREQVSRKGTETNAVKEVIDDMKGAVKALLLKFYKRNG-FKPTSIMFYRDGVSEGQFTEVLRHEVAAIQQACTEMATGNEYEPRITFIIVGKRHHTRLFPASRQDAVGKSGNCPAGTVVDTDIVHKREFNFYLLSHEGIQGTSKPSLYHVLWDDNKWSSDDLQLFTYYLCHVYMRCTRSVSIPSPVYYAHLCAFRARTWQG 1058          
BLAST of Argonaute 1 vs. TrEMBL
Match: A0A0X3NYE9 (Protein argonaute-3 (Fragment) OS=Schistocephalus solidus OX=70667 GN=AGO3 PE=4 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 3.878e-161
Identity = 306/753 (40.64%), Postives = 427/753 (56.71%), Query Frame = 3
Query:  267 IRGMP---VFDGGRIIFTNKLLPYNDGTCKITHNFN-----YESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTSPNKPTFVPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRGGKWDIRNKKFIKPYD-KLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRND-LSKSVAAMVGSLDNNATMYSALIRQQ--LSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLIG 2489
            ++ MP   V+DGGRII+  KL P    T    H         + + +   + I+ V+E     G+L  Y+++ +  +  MPQE++R +D IF+ +  +K   + G  AIF P     L    + +  G+ T++RP  WKVR N D T        NL D +      +  NP    ++   +K LRV+A   KN DGK++SR++T+F  S  SA+   I +KN ++ +YF++ +NI LKYP+L  VK S  +  F+P+ELL +LP Q        +  E+I+ AA+   +R  +L+  +       +     ++Y+I +  +   V ARVL  P   FGG+  EL RG KW I N  F++P   + + WA+  +      QRN   L     +LP AA   G R     +   +    +E +        +   +++ L+V V+ ++  Y  +K   D+  GI TQC+K  TL +         N+MLK+NGKLGG+NW +S        PIK++ MVFG DVTHPA T+ND L KSVAA++GS+  +   Y+A++R+Q    +  +   EI+  ME++V +LL  +Y  N    P RLIFYRDGVSEGQFDIV   E+ AIQ AC  L   Y+P ITYIVVQKRH IRF P +      R+ NV  GTVVD  ITH REFDFYLCS EGIQGTSKPAHYHVL+D++NW SD LQ FTYFLCH Y RC RSVSYPAPTYY+HLAAFR R  + 
Sbjct:  220 VKRMPSDTVYDGGRIIY--KLNPLPGVTEMGIHKEEPVPDPTDRDELVLKYRIKLVQE--TSTGDLARYVENPRASTLAMPQESIRMIDCIFKSINEDK-FFSSGRAAIFYPTPIRKLADKLFDIHMGFITSVRPQ-WKVRVNVDMTCKAFFPPGNLADVLYYKYGDDIENPACWNSVLADIKRLRVEARFYKNQDGKSFSRRFTVFSLSTTSAQRLIIEDKNESVFEYFKEHHNITLKYPDLPCVKVSNKRDVFIPMELLHVLPFQNPTARKADVASEIIRCAAVKPQERFRELDRYVGDFM--RQQHALFKHYEINVQTQRGTVSARVLPQPWASFGGRDVELGRG-KW-IANT-FLQPATVEPLKWAVVNIPPHNAAQRNQAQLVQ---RLPQAATQFGFRFDPRPFCKTITPSELEGLM------RQLHSQRVTLVVLVLYDNFTYPSIKVISDIKLGIRTQCVKGVTLTKPNVFP----NLMLKINGKLGGINWRVSNY------PIKEAVMVFGADVTHPAPTQNDELRKSVAAVLGSITPDLMRYAAVVRRQDTTERGNKTTREIIDNMEEIVSDLLKAYYVNNNDRFPDRLIFYRDGVSEGQFDIVLTGELPAIQRACAGLRAGYEPAITYIVVQKRHHIRFEPLDP-----RAKNVAPGTVVDTVITHRREFDFYLCSQEGIQGTSKPAHYHVLYDDSNWTSDSLQMFTYFLCHAYMRCPRSVSYPAPTYYSHLAAFRARDWLA 937          
BLAST of Argonaute 1 vs. Ensembl Cavefish
Match: ago2 (argonaute RISC catalytic component 2 [Source:NCBI gene;Acc:103030212])

HSP 1 Score: 414.846 bits (1065), Expect = 7.719e-131
Identity = 260/755 (34.44%), Postives = 404/755 (53.51%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSA-------REEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG + ++T   LP      ++      E ++ +    I+ V        +L    ++  GR   +P E ++ALD + R   L     T  GR+ F P    S PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A       ++E       T+ QYF+ +Y + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D +++ + + +  ++  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    D+L   + + G+ + G   F    Y           ++ +   + L L+V ++      Y EVK+ GD + G+ TQC++    N QK   Q L N+ LK+N KLGGVN  L P    L    +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q  +++     I+ ++  MV  LL+ FYK+ +  KP R+I+YRDG+SEGQF+ V +HE++AI+ AC KLEKDYQP IT++VVQKRH  R F  +  + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N++ SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   89 PVYDGRKNLYTAMPLPIGRDKVELEVTIPGEGKDRSFKVAIKWV-----SCVSLQALHEALSGRLPSIPFETIQALDVVMRH--LPSMRYTPVGRSFFTPSEGCSNPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFMCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQM-----KRKYRVCNVTRRPASHQTFPLQQENGQTIECTVAQYFKDKYKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQDEISKLMRSANFNT--DPYVREFGVMVRDEMTEVNGRVLQAPSILYGGRNKAIATPIQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTELLLKAFTDQLRKISRDAGMPIQGQPCFCK--YAQGADSVEPMFKHLKYTYQGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQVK--NVQKTTPQTLSNLCLKINVKLGGVNNILLPQGRPLV--FQQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRVQQHRQD-----IIQDLAAMVRELLIQFYKSTR-FKPTRIIYYRDGISEGQFNQVLQHELLAIREACIKLEKDYQPGITFVVVQKRHHTRLFCMDRNERVGKSGNIPAGTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNHFTSDELQVLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 811          
BLAST of Argonaute 1 vs. Ensembl Cavefish
Match: ago2 (argonaute RISC catalytic component 2 [Source:NCBI gene;Acc:103030212])

HSP 1 Score: 415.231 bits (1066), Expect = 7.989e-131
Identity = 260/755 (34.44%), Postives = 406/755 (53.77%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEK--IVEKN-----LTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG + ++T   LP      ++      E ++ +    I+ V        +L    ++  GR   +P E ++ALD + R   L     T  GR+ F P    S PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A  +   + ++N      T+ QYF+ +Y + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D +++ + + +  ++  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    D+L   + + G+ + G   F    Y           ++ +   + L L+V ++      Y EVK+ GD + G+ TQC++    N QK   Q L N+ LK+N KLGGVN  L P    L    +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q  +++     I+ ++  MV  LL+ FYK+ +  KP R+I+YRDG+SEGQF+ V +HE++AI+ AC KLEKDYQP IT++VVQKRH  R F  +  + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N++ SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:  105 PVYDGRKNLYTAMPLPIGRDKVELEVTIPGEGKDRSFKVAIKWV-----SCVSLQALHEALSGRLPSIPFETIQALDVVMRH--LPSMRYTPVGRSFFTPSEGCSNPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFMCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPASHQTFPLQQENGQTIECTVAQYFKDKYKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQDEISKLMRSANFNT--DPYVREFGVMVRDEMTEVNGRVLQAPSILYGGRNKAIATPIQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTELLLKAFTDQLRKISRDAGMPIQGQPCF--CKYAQGADSVEPMFKHLKYTYQGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQVK--NVQKTTPQTLSNLCLKINVKLGGVNNILLPQGRPLV--FQQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRVQQHRQD-----IIQDLAAMVRELLIQFYKSTR-FKPTRIIYYRDGISEGQFNQVLQHELLAIREACIKLEKDYQPGITFVVVQKRHHTRLFCMDRNERVGKSGNIPAGTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNHFTSDELQVLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 827          
BLAST of Argonaute 1 vs. Ensembl Cavefish
Match: ago4 (protein argonaute-4 [Source:NCBI gene;Acc:103043810])

HSP 1 Score: 399.053 bits (1024), Expect = 1.242e-125
Identity = 260/759 (34.26%), Postives = 401/759 (52.83%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIR-------NLTRKLKTLRVQANHLKNADGKAYSRKYTIFG-----FSNKSAREEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIR-----QQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            P +DG R ++T   LP       +      E ++ T   ++Q V      + +L   +++  G  +++P+++++ALD I R   L     T  GR+ F P      PL  G  +   G+  ++RP MW +  N D +    + A  + +++ +++D   +N  T           T++++ L+V+  H          RKY +         N  A E        T+ QYF+++Y+++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  + S  +    D +L+ + I +   +  V  RVL  P   +GG+   +     G WD+R K+F    +  V WA+     ++  Q  +  L    D+L   + + G+ + G   F    Y           ++ +     L L+V ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R     Q LS+++    E++ ++ +MV  LL+ FYK+ +  KP R+I+YR GVSEGQ   V   E+IAI+ AC  LE+DY+P ITYIVVQKRH  R F  ++ + VG+SGNVP+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYA L AFR R
Sbjct:   15 PGYDGKRNMYTAHPLPIGRDRVDLEVTLPGEGKDQTFKVSLQWV-----SVVSLQMLLEALSGHLNEVPEDSVQALDVITRH--LPSMRYTPVGRSFFSPPEGYYHPLGGGREVWF-GFHQSVRPAMWNMMLNIDVSATAFYRAQPVIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQM-----KRKYRVSSKFFPLLENGQAME-------CTVAQYFKQKYSLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLVKSNSMVGGPDPYLKEFGIVVHNDMTEVTGRVLPAPMLQYGGRNKTVATPNQGVWDMRGKQFYAGIEIKV-WAVACFAPQK--QCREDLLKSFTDQLRKISKDAGMPIQGQPCF--CKYAQGADSVEPMFKHLKMSYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKINAKLGGINNVLVPHQRPSVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDGHPSRYCATVRVQTSRQDLSQEQLYSQEVIQDLTNMVRELLIQFYKSTR-FKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQKRHHTRLFCSDKAERVGKSGNVPAGTTVDSTITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRAR 740          
BLAST of Argonaute 1 vs. Ensembl Cavefish
Match: ago4 (protein argonaute-4 [Source:NCBI gene;Acc:103043810])

HSP 1 Score: 396.356 bits (1017), Expect = 1.207e-123
Identity = 260/773 (33.64%), Postives = 403/773 (52.13%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIR-------NLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVEK-------NLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRG--------------GKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIR-----QQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            P +DG R ++T   LP       +      E ++ T   ++Q V      + +L   +++  G  +++P+++++ALD I R   L     T  GR+ F P      PL  G  +   G+  ++RP MW +  N D +    + A  + +++ +++D   +N  T           T++++ L+V+  H          RKY +   + + A  +    +         T+ QYF+++Y+++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  + S  +    D +L+ + I +   +  V  RVL  P   +GG R     G              G WD+R K+F    +  V WA+     ++  Q  +  L    D+L   + + G+ + G   F    Y           ++ +     L L+V ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R     Q LS+++    E++ ++ +MV  LL+ FYK+ +  KP R+I+YR GVSEGQ   V   E+IAI+ AC  LE+DY+P ITYIVVQKRH  R F  ++ + VG+SGNVP+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYA L AFR R
Sbjct:   84 PGYDGKRNMYTAHPLPIGRDRVDLEVTLPGEGKDQTFKVSLQWV-----SVVSLQMLLEALSGHLNEVPEDSVQALDVITRH--LPSMRYTPVGRSFFSPPEGYYHPLGGGREVWF-GFHQSVRPAMWNMMLNIDVSATAFYRAQPVIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQM-----KRKYRVCNVTRRPASHQTFPLQLENGQAMECTVAQYFKQKYSLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLVKSNSMVGGPDPYLKEFGIVVHNDMTEVTGRVLPAPMLQYGG-RVSTDTGRDCGRNKTVATPNQGVWDMRGKQFYAGIEIKV-WAVACFAPQK--QCREDLLKSFTDQLRKISKDAGMPIQGQPCFCK--YAQGADSVEPMFKHLKMSYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKINAKLGGINNVLVPHQRPSVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDGHPSRYCATVRVQTSRQDLSQEQLYSQEVIQDLTNMVRELLIQFYKSTR-FKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQKRHHTRLFCSDKAERVGKSGNVPAGTTVDSTITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRAR 829          
BLAST of Argonaute 1 vs. Ensembl Cavefish
Match: ago3b (argonaute RISC catalytic component 3b [Source:NCBI gene;Acc:568159])

HSP 1 Score: 391.734 bits (1005), Expect = 4.395e-123
Identity = 260/763 (34.08%), Postives = 391/763 (51.25%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMP--------QEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG R ++T   LP   G   +      E           +V  + + L + +   +   GR+   P           + A+D + R   L     T  GR+ F        PL  G  +   G+  ++RP MWK+  N D +    ++A  +  ++ +++D       P  L  +     T+++K L+V+  H          RKY +   + + A  +     +E   T+E    QYF+++YN++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  + S       D F+Q ++  +  ++  V  RVL  P   +GG+   +     G WD+R K+F    + +  WA+    T+R  Q  ++ L    D+L   + + G+ + G   F    Y           R+ +     L L++ ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N             R  LF P+    +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP RLIFYRDGVSEGQF  V  +E++AI+ AC  LE++YQP ITYIVVQKRH  R F  +  + VGRSGN+P+GT VD DITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + +DE Q  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   15 PVYDGKRSLYTAHPLPVATGGVDLDVTLPGEGGKD----RPFKVSIKFVSLVSWHMLHEVLTGRTMPEPIDLDKPISTNPVHAVDVVLRH--LPSMRYTPVGRSFFSSPEGYDHPLGGGREVWF-GFHQSVRPAMWKMMLNIDVSATAFYKAQQVIQFMCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTM-----RRKYRVCNVTRRPASHQTFPLQLENGQTVERTVAQYFREKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLVRSANY--EADPFVQEFQFRVRDEMAEVTGRVLPAPMLQYGGRNRTVATPSHGVWDMRGKQFHTGVE-IKMWAIACFATQR--QCREEILKSFTDQLRKISKDAGMPIQGQPCF--CKYAQGADSVEPMFRHLKNTYAGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKIN-------------RCALFQPV----IFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQE-----IIQDLASMVRELLIQFYKSTR-YKPTRLIFYRDGVSEGQFRQVLYYELLAIREACISLEREYQPGITYIVVQKRHHTRLFCADRNERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADEFQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 731          
BLAST of Argonaute 1 vs. Ensembl Sea Lamprey
Match: ago2 (argonaute RISC catalytic component 2 [Source:ZFIN;Acc:ZDB-GENE-110606-6])

HSP 1 Score: 263.462 bits (672), Expect = 1.549e-81
Identity = 128/231 (55.41%), Postives = 163/231 (70.56%), Query Frame = 3
Query: 1788 MVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTV-VDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            +  G +VTHP +  +    S+AA+VGS+D + + Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC KLEKDYQP ITY+ VQKRH  R F  +  + +G+SGN+P+GT  VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYA L AFR R
Sbjct:   11 IFLGAEVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRVQHHRQE-----IIQDLGTMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLFHELLAIRDACIKLEKDYQPGITYVAVQKRHHTRLFCADRNERIGKSGNIPAGTTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSADELQVLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRAR 234          
BLAST of Argonaute 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009610.1 (pep scaffold:Pmarinus_7.0:GL477777:44890:66775:1 gene:ENSPMAG00000008651.1 transcript:ENSPMAT00000009610.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 272.322 bits (695), Expect = 1.093e-79
Identity = 203/674 (30.12%), Postives = 338/674 (50.15%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKT--STPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPS 2231
            PVFDG + ++T   LP      ++      E +       I+ +    ++L +     ++  GR   +P E+++ LD + R   L     T  GR+ F P    S PL  G  +   G+  ++RP MWK+  N D +    ++A  + +++ +++D       P  L+ +     T+++K L+V+  H          RKY +   + + A ++     +E   T+E    QYF+ +Y + LKY +L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  M S    +  D +++ + I +   +  V+ RVL+ P   +GG+   +     G WD+R K+F    +  V WA+     +R  Q  ++ L +  D+L   + + G+ + G   F    Y    +      R+ +     L L+V ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGGVN  L P IR  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  HE++AI+ AC +LEK+Y+P IT+IVVQKRH  R F  +  + V  +   P+
Sbjct:   93 PVFDGRKNLYTVTPLPIGRDRVELEVTLPGEGKERVFKVTIKWMANVSLQLLH-----EALSGRLAQIPYESIQGLDVVMRH--LPSMRYTPVGRSFFTPPEGYSQPLGGGREVWF-GFHQSVRPCMWKMMLNIDVSATAFYKAQPVIEFMCEVLDLRTVEEQPRPLSDSQRVKFTKEIKGLKVEITHCGQ-----MKRKYRVCNVTRRPAAQQTFPLQLESGQTVECTVAQYFRDKYKLHLKYAHLPCLQVGQEEKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLMKSASFNS--DPYVREFGIMVKDDMADVQGRVLNPPMLQYGGRTRAVATPNQGVWDMRGKQFFTGIEIKV-WAIACFAPQR--QCREEVLKNFTDQLRKISKDAGMPIQGQPCFCK--YAQGAENVEPMFRHLKNAYMGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVLKTSPQTLSNLCLKINVKLGGVNNILVPHIRPAVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRVQQHRQE-----IIHDLSSMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFQQVLYHELLAIREACIRLEKEYRPGITFIVVQKRHHTRLFCADRNERVSDACKSPA 733          
BLAST of Argonaute 1 vs. Ensembl Sea Lamprey
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:572134])

HSP 1 Score: 155.221 bits (391), Expect = 3.277e-39
Identity = 106/333 (31.83%), Postives = 167/333 (50.15%), Query Frame = 3
Query: 1500 KVATDTIRN--SEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELS-PIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNAT-MYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGRTL 2483
            K   D IR   S  +  ++ + +F  + D+ Y  VK+   V   + +Q ++  T+++QK L      ++L++N KLGG  W L  P++N          MV G+DV H         +SV   V S++ + +  YS ++RQ  S+      E+V  +   + + +  +Y+ N  L P+++I YRDGVS+ Q  IV   E++ + +  +  +  YQP +  +VVQKR     F  N     G   N PSG+V+D   T    FDF+L S    QGT  P HY V+F+     +D +Q  TY + H+Y   + +V  PAP  YAH LA+  G  L
Sbjct:  451 KTYIDCIRKNYSYSQGVQMVMCIFPTLRDDRYSTVKQVCCVELAVPSQVVQTRTISQQKRLRSVAQKVVLQMNCKLGGELWILDIPLKN---------LMVVGVDVFHNVVLGK---QSVVGFVASMNRSVSRWYSRVVRQSTSQ------ELVDGLNLCMTSAIKKYYELNHYL-PEKIIMYRDGVSDNQLAIVRDFEVMQLTNGFRTFDLSYQPKMLVVVVQKRISTNIFLNNS----GAMENAPSGSVLDTVATSQEWFDFFLVSQHVRQGTVSPTHYVVIFNSLKLSADHVQRLTYKMTHLYYNWSGTVRVPAPCQYAHKLASLVGENL 760          
BLAST of Argonaute 1 vs. Ensembl Sea Lamprey
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:368200])

HSP 1 Score: 111.694 bits (278), Expect = 2.063e-25
Identity = 107/401 (26.68%), Postives = 167/401 (41.65%), Query Frame = 3
Query: 1281 RGGKW--DIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNAT-MYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSG--NVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAF 2468
            R   W  + RN K + P   L  W L       +  R       I D L      +G+ +     F  +   +  +    T++ +     ++ + V   I+   Y  +K+F  V     +QC+   TL++ + +      I L++N KLGG  W +         PIK   MV G+D  H + TR    +SV   V SL+   T  YS  I Q  +++    +++ M+ ++                      F    ++    D++    II   S         +P +T +VV+KR   RFF        GRSG  N   GTV+D + T    +DFYL S    QGT  P HY+V++D +N   D +Q   Y +CH+Y      +  PAP +YAH  AF
Sbjct:  493 RQADWSRESRNMKLMTPIS-LEEWMLLFTHNNSNEARA------IVDNLMQVGPPMGMHINKPEMFEVL---DRAQSFVQTLQQNLNHHTQMVMCVLPTIHKGKYDSIKQFLCVERPFPSQCVLARTLSKPQMIRSVATKIALQMNCKLGGELWSVE-------IPIKQ-LMVVGVDSYHDSITRG---QSVCGFVASLNQTLTRWYSRCIFQHAAQEMIDGLKVCMQCKN----------------------FISLQIASHSNDVMINVVIIYFLSFLNSYCCGSRPKVTVVVVKKRGIARFFE------FGRSGLQNPSPGTVIDTEATRHEWYDFYLVSQSVRQGTVTPTHYNVVYDTSNMKPDHMQRLAYKMCHLYYNWPGVIRVPAPCHYAHKLAF 844          
BLAST of Argonaute 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009140.1 (pep scaffold:Pmarinus_7.0:GL477723:307292:327713:-1 gene:ENSPMAG00000008265.1 transcript:ENSPMAT00000009140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 4.975e-14
Identity = 59/248 (23.79%), Postives = 117/248 (47.18%), Query Frame = 3
Query:  588 TPLRCGPYILMEGYATTIR-----PHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLN----PNTIRN---LTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTSP-NKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQ 1265
             P  C  ++L +G+   +R     P ++K       +    ++A  + +++ +I+  + L+    P T       T+++  L+V+  H          RKY +   S KSA  +     +E   T+E     YF++++ ++L+YP+L  ++     K T++P+E+  ++P QR I   +D +    +IK  A  A DR  +++  M +     +GD F++ ++I +   +  V  RVL  P   +GG 
Sbjct:  157 CPAGCEYFVLSQGWQCPVRGKAVCPCLFKRMLAMAVSATAFYKAQPVVEFLCEILGVHSLDDQRKPLTDSQRVAFTKEITGLKVEITHCGQ-----MKRKYRVCSVSRKSASHQTFPLQLESGQTVECSVAHYFREKHKLQLRYPHLPCLQVGQKEKHTYLPLEVCNIVPGQRCIRRLTDSQ-TSTMIKATARSAPDRQEEISKLMKNANF--KGDPFMREFEIRVRDDMTEVTGRVLPAPMLQYGGH 396          
BLAST of Argonaute 1 vs. Ensembl Nematostella
Match: EDO46431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ46])

HSP 1 Score: 406.757 bits (1044), Expect = 3.052e-128
Identity = 268/783 (34.23%), Postives = 418/783 (53.38%), Query Frame = 3
Query:  243 ILFSF*KYIRGM-PVFDGGRIIFTNKLLPYNDGTCKI-----THNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTST--PLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNR--------LNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSARE-------EKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQ-RPELLR---GGKWDIRNKKFIKPYDKLVNWALFA-----VGTERDYQRNDKPLYDI--EDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            ++ ++ K   GM PVFDG + ++T   LP      +      T N   +   VT  +  Q      + L  L   ++   G  + +P E ++ALD + R +   K   T  GR+ F P      PL  G  +   G+  +IRP  WK+  N D +    ++  ++ +++ +++   +        LN       TR++K L+V+  H          RKY +   + + A+        E      +T+ +YFQ ++  +L+YP+L  ++     + T++P+E+  ++P QR ++  +D +   ++I+  A  A DR  ++   +         D +++++ I I   ++ ++ RVL  P+ ++GG+ R E +     G WD+R ++     + +  WA+       + TE   +R    L  I  E  +P +   V        +F Y   +N ++V     R  E       +LV +      Y EVK+ GD + G++TQC++   + +     Q L N+ LK+N KLGGVN  L+P IR  +F   ++  +  G DVTHPA+  +D   SVAA+VGS+D + + Y A +R Q  ++E     I+ E+  MV  LL+ FY++ +  KP+R++FYRDGVSEGQF  V  HE+ AI+ AC KLE  YQP I++IVVQKRH  R F Q ++D  G+SGNVP GT VD+ ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+NN+ +DELQ+ TY LCH Y RCTR+VS PAP YYAHL AFR R
Sbjct:   69 MVLNYHKVFGGMKPVFDGRKNLYTRDPLPIGKTPTEFEVVLPTDNSQDKKFKVTLKWVSQ------VSLYALEKALE---GTCNQIPFETIQALDVVLRHLPSMK--YTPVGRSFFSPPDGYDFPLERGREVWF-GFHQSIRPSQWKMLLNIDVSATAFYKCQSVVEFMCEVLRIRKDDLEKHAPLNDADRLRFTREIKGLKVEITHCG-----PMKRKYRVINVTKQPAQALQFPLTLESGQTAQITVARYFQDKHKQRLRYPHLPCLQVGQEQRHTYLPLEVCNIVPGQRCVKKLTDTQ-TSKMIRATARSAPDREREIRGLVKKANFDE--DAYVKDFSISIGKNMVELQGRVLPPPKLVYGGKVRIEKIIHSFSGVWDMRGRQLFHGIE-IRTWAIACFVKQQMCTEDSLRRFSNQLMKISVEQGMPISCPPV--------FFRYA--RNPDEVERMFRRLKEAHPDLQMILVVLPGKTPVYAEVKRVGDTMLGVITQCIQGKNVTKPS--PQTLSNLCLKINAKLGGVNNILAPEIRPPVF---REPVIFLGADVTHPAAG-DDKRPSVAAVVGSMDAHPSRYYASVRVQTHRQE-----IIAELAAMVRELLVQFYRSTRH-KPQRIVFYRDGVSEGQFRQVLVHELKAIREACIKLEVGYQPGISFIVVQKRHHTRLFCQRDQDKCGKSGNVPPGTTVDRGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNFSADELQALTYQLCHTYVRCTRAVSIPAPAYYAHLVAFRAR 808          
BLAST of Argonaute 1 vs. Ensembl Nematostella
Match: EDO38583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCI6])

HSP 1 Score: 282.337 bits (721), Expect = 6.420e-83
Identity = 221/717 (30.82%), Postives = 350/717 (48.81%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSK-KGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTSTPLRC----GPYILMEGYATTIRPHMWKVRF-NFDKTQVVCHEAINLYDYISKIM--DPNR-------LNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVEKNL--TIEQYFQKEYNIKLKYPNLSMVKTSPNKPTFVPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQN-YKIEIDPKLIGVEARVLDGPEGIFGG--QRPELL-RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVG-------IRMGG----SFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVI---NDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDS------FMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQ 2306
            P FDG R ++  + LP       +              F ++  +   + +  L+ ++  + +G+   +PQ+A++ +D + R+M   K   T  GR  F P       C    G   L  G+  ++RP  WK    N D +     +++ + D++ +I+  D NR       ++    + LT ++K LRV+  H+K        RK+T+ G S+ +      +E N   T+E YF+ +YNI L+YP+L  +     K + VP+E+  M+P QR   +D +    +I+  A PA +R   +N  +  L   +  D++L+N Y + I+ +++ +E RVL  PE   GG  Q   L    G WD+R K F +     V WAL              P +  ++KL G A  +G       +RM      + Y S V  Q +E +    + +       L L+V  +    N + Y EVK+ GD + GI TQC++       K   Q   NI +K+NGKLGG N  ++       T  K +       ++FG DVTHPA   N +  S+AA+V SL+ NA+ Y A +R Q   K +   EI++++ DM  ++ +  ++   +    + +F R       F ++ + E+ A+Q AC  LEKDYQP IT++VVQKRH  R F +  +D  G+S NVP+GT VD  I H  EFDFYLCSH GIQ
Sbjct:   75 PAFDGRRNLYCREPLPLKSEEASLKVTLPGTDGGKERKFTLKIKEAGLVSIKELDQFLNGEFRGK---VPQDAIQGMDIVLRQMPSMK--FTAVGRCFFPPPNG---HCHDLGGGCELWTGFYQSVRPSQWKTMLLNIDVSSKGFQKSMPVIDFMLEILRQDRNRVLDTRWVMDERDKKKLTTEIKGLRVETTHIK--------RKFTVMGLSHPAFNNRFRLEDNTETTVEAYFRNKYNISLRYPHLPCLLVGQKKNS-VPMEVCNMIPTQRKRLTDEQTA-AMIRKTAKPANERQRDINQWVDELATAS--DQYLKNEYGMRINKQMVAIEGRVLPAPELTLGGNPQGSALTPSDGAWDMRGKSFFEARTVEV-WALVCF---------SHPKWCPKEKLEGFARQMGNVCRSEGMRMNPVPCRAEYASRV--QEVEGIFGKLLHDF----NSLQLIVVALPDRGNKDVYNEVKRVGDTVLGIPTQCVQMKQFTMAK--PQVCSNIAMKINGKLGGTNHVIADSLKATITDDKGNGIFNSPVIIFGADVTHPAPGDNGIP-SIAAVVASLNRNASRYCARVRPQTHMKCKQAQEIIVDLADMDVHIYIRLWR-KLESHDTQTMFRR-------FQVLLE-EVRAVQQACAMLEKDYQPLITFVVVQKRHHARLFAEEGRDARGKSRNVPAGTTVDTVICHPFEFDFYLCSHAGIQ 743          
BLAST of Argonaute 1 vs. Ensembl Nematostella
Match: EDO34027 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQI3])

HSP 1 Score: 154.836 bits (390), Expect = 7.327e-39
Identity = 164/670 (24.48%), Postives = 281/670 (41.94%), Query Frame = 3
Query:  558 GRAIFDPKTSTPLRCGPYILMEGYATTIRPH------MWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTSPNKPTFV---PIELLTMLPN-------QRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRGGKW--DIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQN-IEKVATDTIRNSEKEKKKLDLLVFVVI----NDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELS-PIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNAT-MYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFR-GRTLIG 2489
            GR  ++PKT   +     +L  GY T+++ +      +  V     +T       +N++   SK+ D  R      + L   +          +  D     R  + F F N          + +T  +Y++K Y I+++  +  M+   P K        IE++ ++P           +  D ++++++     +    R   +   + S+       + L  + + +D   +  E R     + I+G           W  D   +K I   + L NW +F   T+RD  + +    D    +   A  +GI++         P  N +    T+T   S +E     + V VVI     D+ Y  VKK   V   + +Q +   T++    L   +  I L++N KLGG  W L  P R         S MV GIDV H  +      +SV  +V S++ + T  YS +  Q   +      E++  ++ ++   +  ++  N  L P+R+I YRDGV +GQ  +V  +E+   +       + Y+P +  +VVQKR   R F         R GN   G+V+D  +T     DF+L S    QGT  P HY V++D +NW  D +Q  +Y L H+Y     +V  PAP  YAH  A++ G+++ G
Sbjct:  117 GRYFYNPKTPAHIPQHNLVLWPGYITSLQHYEGGLMLLCDVHHRLLRTDSCLDYMLNMH---SKVGD--RFRDEVSKELIGSVVLTTYNNKTYRVDDIDWNKRPTSTFTFHNG---------EQMTFVEYYKKSYEIEIRDLDQPMIVNRPKKTEQKRGGVIEVILLIPELCKLTGLNDAMRKDFRVMKDIAAHTRVNPMQRQEAMKKFVMSINSTPEALEQLTAWNLRLDTSTLMTEGRQFPPEKIIYGNTTGSAGDQADWGRDATREKVISAVN-LNNWMVFF--TQRDSGKAN----DFVQTMNKCAPAMGIQVNQ-------PKMNQLRDDRTETYLRSIRENLHPQVQVVVVIFPTSRDDRYAAVKKLCCVESPVPSQVIISKTISNPTKLRSVVQKIALQINVKLGGELWALDIPSR---------SLMVCGIDVYHDKARG---GRSVGGLVCSMNRSLTRWYSDVCFQSPGQ------ELIDGLKMLLIKGIRKWHDVNNAL-PERIIVYRDGVGDGQLKVVAGYEVQQFEECFASFGESYKPKLAVLVVQKRINTRIFSAEP-----RLGNPGPGSVLDHTVTRKDWNDFFLVSQHVRQGTVTPTHYVVVYDTSNWKPDIMQKLSYKLTHLYYNWPGTVRVPAPCQYAHKLAYQVGQSIHG 734          
BLAST of Argonaute 1 vs. Ensembl Nematostella
Match: EDO49931 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFC2])

HSP 1 Score: 147.132 bits (370), Expect = 3.580e-36
Identity = 140/544 (25.74%), Postives = 233/544 (42.83%), Query Frame = 3
Query:  912 LTIEQYFQKEYNIKLKYPNLSMVKTSPNK------PTFVPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRGGKWDIRNKKFIK-----PYDKLVN---WALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVI----NDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELS-PIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNAT----MYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRS-GNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAF 2468
            ++   Y++K Y+  +      ++ + P K      P  +  EL  +      + +D  +++++     +    R   LN  +S +         L  + +     L+  + R+L G E IF     +  +G  +D ++  + +     P    VN   W +  V T RD         D +  L      +GI          VP  +     TD+   +   + + D    VV     N +D Y  +KK   +  G+ +Q +   TL++++ L      I +++N KLGG  W +  P++N          M+ GID  H +S +    +SV   V SL+   T     YS    Q   +      E+V  ++  +   L  + + N  L P ++I +RDGV +GQ   V +HE+  I S  ++ +  Y P   + VV+KR + R F +  +D   R+  N P GTVVDK++T    FDF++ S    QGT  P HY+V+ D      D  Q  +Y L H+Y     +V  PAP  YAH  AF
Sbjct:  344 ISFNDYYKKNYDFTITDQEQPLLFSKPKKRKGADDPVLLLPELCFLTGLSDDMRADFSVMKDLAVHTRLDPKARSKDLNKLISEINNNPDASGELSGWGLRFGRNLLDFDGRILPG-EKIF-----QKNKGSNYDPKSADWSREIRGAPLHSTVNLENWVI--VHTNRD----SGVATDFQQTLARVCGPMGINTTKP---RMVPLNDDR---TDSYLKALSNEIQADFPQIVVTIVPSNRKDRYDSIKKLCCLEKGVPSQVVVSRTLSKKQMLMSVCTKIGIQLNCKLGGEAWAVDIPLKN---------LMIVGIDTYHDSSQK---GRSVGGFVASLNKPCTRQREYYSRCTFQHSGQ------ELVDGLKVCMTAALRQWQQINGVL-PDKIIVFRDGVGDGQLRAVIEHEVPQILSTFKQFQDGYDPKFGFTVVKKRIQTRLFMREARDPDMRNLMNPPPGTVVDKEVTRSEWFDFFIVSQSVRQGTVSPTHYNVIHDTTGLRPDHWQQLSYKLTHLYYNWPGTVRVPAPCQYAHKLAF 850          
BLAST of Argonaute 1 vs. Ensembl Nematostella
Match: EDO28124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7C9])

HSP 1 Score: 49.2914 bits (116), Expect = 1.271e-6
Identity = 23/65 (35.38%), Postives = 36/65 (55.38%), Query Frame = 3
Query: 1989 FYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFF 2183
            ++  N  L P+R+I YRDGV +GQ  +V  +E+   +       + Y+P +  +VVQKR   R F
Sbjct:  114 WHDVNNAL-PERIIVYRDGVGDGQLKVVAGYEVQQFEECFASFGESYKPKLAVLVVQKRINTRIF 177          
BLAST of Argonaute 1 vs. Ensembl Medaka
Match: AGO2 (protein argonaute-2 [Source:NCBI gene;Acc:101156100])

HSP 1 Score: 416.001 bits (1068), Expect = 2.105e-131
Identity = 262/756 (34.66%), Postives = 409/756 (54.10%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEK--IVEKN-----LTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPI-RNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG + ++T   LP      ++      E ++ +    I+ V        +L    ++  GR   +P E ++ALD + R   L     T  GR+ F P    S PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A  +   + ++N      T+ QYF+ +Y + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D +++ + + +  ++  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    D+L   + + G+ + G   F    Y           R+ +   + L L+V ++      Y EVK+ GD + G+ TQC++    N QK   Q L N+ LK+N KLGGVN  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q  +++     I+ ++ +MV  LL+ FYK+ +  KP R+I+YRDG+SEGQF+ V +HE++AI+ AC KLEKDYQP IT++VVQKRH  R F  +  + VG+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N++ SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   87 PVYDGRKNLYTAMALPIGREKVELEVTIPGEGKDRSFKVAIKWV-----SCVSLQALHEALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTPSEACSNPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFMCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQM-----KRKYRVCNVTRRPASHQTFPLQQENGQTIECTVAQYFKDKYKLILRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQDEISKLMRSANFNT--DPYVREFGVMVRDEMTEVNGRVLQAPSILYGGRNKAIATPIQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTELLLKAFTDQLRKISRDAGMPIQGQPCF--CKYAQGADSVEPMFRHLKYTYQGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQVK--NVQKTTPQTLSNLCLKINVKLGGVNNILLPQGRPMVF---QQPVIFLGSDVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRVQQHRQD-----IIQDLANMVRELLIQFYKSTR-FKPTRIIYYRDGISEGQFNQVLQHELLAIREACIKLEKDYQPGITFVVVQKRHHTRLFCMDRNERVGKSGNIPAGTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNHFSSDELQVLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 809          
BLAST of Argonaute 1 vs. Ensembl Medaka
Match: ago3a (protein argonaute-3 [Source:NCBI gene;Acc:101157320])

HSP 1 Score: 400.593 bits (1028), Expect = 2.851e-126
Identity = 265/764 (34.69%), Postives = 399/764 (52.23%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQE--------ALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG R ++T   LP       +      E           +V  + + L + +   +   GRS   P E         + A+D + R +   K   T  GR+ F        PL  G  +   G+  ++RP MWK+  N D +    ++A  +  ++ +++D       P  L  +     T+++K L+V+  H          RKY +   + + A  +     +E   T+E    QYF+++YN++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  + S       D F+Q ++  +  ++  V  RVL  P   +GG+   +     G WD+R K+F    + +  WA+    T+R  Q  ++ L    D+L   + + G+ + G   F    Y           R+ +     L L++ ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q  ++E     ++ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  +E++AI+ AC  LEK+YQP ITYIVVQKRH  R F  +  + VGRSGN+P+GT VD DITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + +DE Q  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   15 PVYDGKRSLYTANPLPVAPTGVDLDVTLPGEGGKD----RPFKVSIKFVSLVSWHMLHEVLTGRSMPEPLELDKPISTNPVHAVDVVLRHLPSMK--YTPVGRSFFSAPEGYDHPLGGGREVWF-GFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTM-----RRKYRVCNVTRRPASHQTFPLQLENGQTVERTVAQYFREKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLVRSANY--EADPFVQEFQFRVRDEMAHVTGRVLPAPMLQYGGRNRTVATPSHGVWDMRGKQFHTGVE-IKMWAIACFATQR--QCREEILKGFTDQLRKISKDAGMPIQGQPCF--CKYAQGADSVEPMFRHLKNTYAGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKINVKLGGINNILVPHQRPSVF---QQPVIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQE-----VIQDLASMVRELLIQFYKSTR-YKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKEYQPGITYIVVQKRHHTRLFCADRNERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADEFQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 746          
BLAST of Argonaute 1 vs. Ensembl Medaka
Match: ENSORLT00000011404.2 (protein argonaute-3 [Source:NCBI gene;Acc:101165653])

HSP 1 Score: 400.593 bits (1028), Expect = 1.801e-125
Identity = 265/764 (34.69%), Postives = 404/764 (52.88%), Query Frame = 3
Query:  276 MPVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQE--------ALRALDTIFREMFLNKNLITIGGRAIFD-PKTSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            +PV+DG + ++T   LP   G   +      E           +V  + + L + +      KGRS   P +         + A+D + R +   K   T  GR+ F  PK +     G   +  G+  ++RP MWK+  N D +    ++A ++  ++ +++D       P  L  +     T+++K L+V+  H          RKY +   + + A  +     +E   T+E    QYF+++YN++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  + +   G   D F+Q ++  +  ++  V  RVL  P   +GG+   +     G WD+R K+F    +  V WA+    T+R  Q  ++ L    D+L   + + G+ + G   F    Y           R+ +     L L++ ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGVSEGQF  V  +E++AI+ AC  LEK+YQP IT+IVVQKRH  R F  +  + VGRSGN+P+GT VD DITH  EFDFYLCSH GIQGTS+P+HYH+L+D+N + +DE Q  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:   83 LPVYDGKKNLYTASPLPVASGGVDLDVTLPGEGGKDRPF----KVSLKFVSLVSWHLLHDILKGRSTPEPVDLDKPLSTNPVHAVDVVLRHLPSMK--YTPVGRSFFSSPKDNDYTLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQSVIQFMCEVLDIHNIDEQPRPLADSHRVKFTKEIKGLKVEVTHCGTM-----RRKYRVCNVTRRPASLQTFPLQLENGQTVERTVAQYFREKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVVGQRCIKKLTDNQ-TSIMIKATARSAPDRQEEISRLVRNANYG--ADPFVQEFQFRLCDEMAQVTGRVLPAPMLQYGGRNRTVATPSHGVWDMRGKQFHTGVEIKV-WAIACFATQR--QCREEILKSFTDQLRKISKDAGMPIQGQPCF--CKYAQGADSVEPMFRHLKNTYTGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQMK--NVVKTSPQTLSNLCLKINVKLGGINNILVPHQRPSVF---QQPIIFLGADVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRIQKPRQE-----IIQDLASMVRELLIQFYKSTR-YKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKEYQPGITFIVVQKRHHTRLFCADRNERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHILWDDNCFTADEFQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 815          
BLAST of Argonaute 1 vs. Ensembl Medaka
Match: ago1 (protein argonaute-1 [Source:NCBI gene;Acc:101169483])

HSP 1 Score: 396.741 bits (1018), Expect = 4.292e-124
Identity = 262/765 (34.25%), Postives = 402/765 (52.55%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQ---------RVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG + I+T   LP   G+ K+        E     F +          R+ +E +  G L             +P ++++ALD   R   L     T  GR+ F P      PL  G  +   G+  ++RP MWK+  N D +    ++A  + +++ +++D       P  L  +     T+++K L+V+  H          RKY +   + + A  +     +E   T+E    QYF+++YN++LKYP+L  ++     K T++P+E+  ++  QR I+  +D +    +IK  A  A DR  +++  M +       D ++Q + I++   +  V  RVL  P   +GG+   +     G WD+R K+F    +  V WA+     ++  Q  ++ L +  D+L   + + G+ + G   F    Y           R+ +     L L++ ++      Y EVK+ GD L G+ TQC++    N  K   Q L N+ LK+N KLGG+N  L P  R+ +F   +   +  G DVTHP +  +    S+ A+VGS+D + + Y A +R Q  ++E     I+ ++  MV  LL+ FYK+ +  KP R+IFYRDGV EGQ   +  +E++AI+ AC KLEKDYQP ITYIVVQKRH  R F  ++ + +G+SGN+P+GT VD  ITH  EFDFYLCSH GIQGTS+P+HY+VL+D+N + +DELQ  TY LCH Y RCTRSVS PAP YYA L AFR R
Sbjct:   91 PVYDGKKNIYTVLALPI--GSEKVDFEVTIPGEGKDRIFKVSIRWLAKVSWRLLQETLVSGRLQ------------VPLDSVQALDVAMRH--LASMRYTPVGRSFFSPPEGYYHPLGGGREVWF-GFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRNIDEQPKTLTDSQRVRFTKEIKGLKVEVTHCGQM-----KRKYRVCNVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIKATARSAPDRQEEISRLMKNANFNL--DPYIQEFGIKVKDDMAEVTGRVLPAPILQYGGRNRAIATPNQGVWDMRGKQFYNGIEIKV-WAIACFAPQK--QCREEVLKNFTDQLRKISKDAGMPIQGQPCFCK--YAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVK--NVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVF---QQPVIFLGADVTHPPAG-DGKKPSITAVVGSMDAHPSRYCATVRVQRPRQE-----IIEDLSYMVRELLIQFYKSTR-FKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKSERIGKSGNIPAGTTVDTSITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRAR 813          
BLAST of Argonaute 1 vs. Ensembl Medaka
Match: AGO2 (protein argonaute-2 [Source:NCBI gene;Acc:101156100])

HSP 1 Score: 397.512 bits (1020), Expect = 1.666e-123
Identity = 262/793 (33.04%), Postives = 409/793 (51.58%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPK--TSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMD-------PNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEK--IVEKN-----LTIEQYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIE--SDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLR--GGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPI-RNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGI-------------------------------------QGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PV+DG + ++T   LP      ++      E ++ +    I+ V        +L    ++  GR   +P E ++ALD + R   L     T  GR+ F P    S PL  G  +   G+  ++RP +WK+  N D +    ++A  + +++ +++D          L  +     T+++K L+V+  H          RKY +   + + A  +   + ++N      T+ QYF+ +Y + L+YP+L  ++     K T++P+E+  ++  QR I+  +D +    +I+  A  A DR  +++  M S       D +++ + + +  ++  V  RVL  P  ++GG+   +     G WD+RNK+F    +  V WA+     +R  Q  +  L    D+L   + + G+ + G   F    Y           R+ +   + L L+V ++      Y EVK+ GD + G+ TQC++    N QK   Q L N+ LK+N KLGGVN  L P  R  +F   +   +  G DVTHP +  +    S+AA+VGS+D + + Y A +R Q  +++     I+ ++ +MV  LL+ FYK+ +  KP R+I+YRDG+SEGQF+ V +HE++AI+ AC KLEKDYQP IT++VVQKRH  R F  +  + VG+SGN+P+GT VD  ITH  EFDFYLCSH GI                                     QGTS+P+HYHVL+D+N++ SDELQ  TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:  143 PVYDGRKNLYTAMALPIGREKVELEVTIPGEGKDRSFKVAIKWV-----SCVSLQALHEALSGRLPSVPFETIQALDVVMRH--LPSMRYTPVGRSFFTPSEACSNPLGGGREVWF-GFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFMCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQM-----KRKYRVCNVTRRPASHQTFPLQQENGQTIECTVAQYFKDKYKLILRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ-TSTMIRATARSAPDRQDEISKLMRSANFNT--DPYVREFGVMVRDEMTEVNGRVLQAPSILYGGRNKAIATPIQGVWDMRNKQFHTGIEIKV-WAIACFAPQR--QCTELLLKAFTDQLRKISRDAGMPIQGQPCF--CKYAQGADSVEPMFRHLKYTYQGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQVK--NVQKTTPQTLSNLCLKINVKLGGVNNILLPQGRPMVF---QQPVIFLGSDVTHPPAG-DGKKPSIAAVVGSMDAHPSRYCATVRVQQHRQD-----IIQDLANMVRELLIQFYKSTR-FKPTRIIYYRDGISEGQFNQVLQHELLAIREACIKLEKDYQPGITFVVVQKRHHTRLFCMDRNERVGKSGNIPAGTTVDTKITHPSEFDFYLCSHAGIQVRDQRKMAELNESPSCALSVSAWFDGGKAFINALYLQGTSRPSHYHVLWDDNHFSSDELQVLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 902          
BLAST of Argonaute 1 vs. Planmine SMEST
Match: SMESG000050994.1 (SMESG000050994.1)

HSP 1 Score: 1590.47 bits (4117), Expect = 0.000e+0
Identity = 776/793 (97.86%), Postives = 779/793 (98.23%), Query Frame = 3
Query:  222 VFSNLVYILFSF*KYIRGMPVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTSPNKPTFVPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLIGLXXXXXXXXXXXXXXXXXXXESQILINEFHHDKLFFI 2600
            V  N+V  L    +   GMPVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVEKNLTIEQYFQKEYNIKLKYPNL MVKTSPNKPTFVPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGV+ARVLDGPEGIFGGQR E LRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLIGLSDDDSSSTTSGHSTRTDTSESQILINEFHHDKLFFI
Sbjct:  467 VIRNIVKELL---QKAEGMPVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVEKNLTIEQYFQKEYNIKLKYPNLPMVKTSPNKPTFVPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVDARVLDGPEGIFGGQRTEPLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLIGLSDDDSSSTTSGHSTRTDTSESQILINEFHHDKLFFI 1256          
BLAST of Argonaute 1 vs. Planmine SMEST
Match: SMESG000051000.1 (SMESG000051000.1)

HSP 1 Score: 763.066 bits (1969), Expect = 0.000e+0
Identity = 397/776 (51.16%), Postives = 523/776 (67.40%), Query Frame = 3
Query:  273 GMPVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTSPNKPTFVPIELLTMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLIGLXXXXXXXXXXXXXXXXXXXESQILINEFHHDKLFFI 2600
            G+P+FDGGRIIF N+LLPY +   K+   +NYE++N+ CH N+Q V  +       + YI S KGRS+++PQE +R LD I REM L+ +LI IG + +F+P+TS PL   PY ++ GY +TIRPHM  +RFN D TQ+VCH+AIN+ DYI K+   N  N    +++  ++  ++V+A+H KN  G+ Y+R +T+ G   K+A  E I     ++ +YF   + I LKYP L +++T+ N   F P ELLT+LPNQ+V+ +D  IV+EVIK +AIP  +R   L  ++ + + G R +K+LQ+Y I I P++I V+ R+LD P  +FG  + E L   K++I NKKF  P+   + WALFA G  R+Y  N+  LY IE +LP AA  V +++     F YV   +I+K       + EK K+ LDLLV VV ND +YK VK  GD+  GIVTQC+ Y  L RQK L QY+GN+MLKVN KLGGVNWE   I+N  + PIK  FMVFG+DVTHP S  + LSKSVAA+VGS++  AT+YSA+I++QLSK  +  +E V+EMEDMV+ L+  FY  N+   P  LIFYRDGVSEGQF+IVF HEI AIQ AC+K +K+Y+P ITYI+VQKRH IRF P   +D VGR  NV  G V+D DITH REFDFYLCSHEGIQGTSKP HY+V+ DEN W S++LQ FTYFLC++  RCTRS+SYPAPT+YAHLAAFRGR L      D     S  S         I INEFH +K+FFI
Sbjct:  193 GLPIFDGGRIIFNNQLLPYTETINKLNFIYNYENQNINCHLNLQLVNSDIDLDLIDD-YIHSGKGRSNNIPQETIRVLDIIIREMLLDCDLILIGNKGLFNPRTSKPLDRDPYTILSGYFSTIRPHMSNIRFNLDTTQIVCHQAINMKDYIQKVFTLNNFNIQNKKHINSRIYNIKVKASHYKNDQGENYTRIFTVKGVYQKNAHNEIIENLGKSVNEYFLSTHGINLKYPELLLIETT-NYNKF-PAELLTILPNQKVMGNDPNIVREVIKHSAIPCTERFDNLKKSVVAFK-GFRNNKYLQSYNITIIPQMINVKGRILDEPTALFG-DKEEKLPKSKFNIMNKKFKDPFHDPIKWALFAFGERREYG-NENELYAIEIELPKAAIKVNVKILKDNTFCYVSNDDIKK-------SIEKIKEDLDLLVVVVRNDVEYKLVKDIGDIELGIVTQCICYENLCRQKNLSQYMGNLMLKVNAKLGGVNWE---IKNIEYAPIKGLFMVFGVDVTHP-SNNDGLSKSVAAVVGSINKTATIYSAVIKKQLSKDGKDAVETVVEMEDMVHRLIKVFYDLNQSKLPDHLIFYRDGVSEGQFEIVFNHEIAAIQYACEKFKKNYKPKITYIIVQKRHNIRFCPITLEDSVGRCKNVLPGVVIDNDITHSREFDFYLCSHEGIQGTSKPVHYYVILDENRWNSNDLQEFTYFLCYVCFRCTRSISYPAPTHYAHLAAFRGRIL-----KDDEDNISLSSENESIGLPDISINEFHQNKMFFI 946          
BLAST of Argonaute 1 vs. Planmine SMEST
Match: SMESG000047591.1 (SMESG000047591.1)

HSP 1 Score: 410.994 bits (1055), Expect = 9.636e-129
Identity = 261/753 (34.66%), Postives = 405/753 (53.78%), Query Frame = 3
Query:  279 PVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDIELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFDPKTS--TPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYISKIMDPNR-----LNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSNKSAREEKI---VEKNLTIE----QYFQKEYNIKLKYPNLSMVKTS-PNKPTFVPIELLTMLPNQRVIESDGKI-VQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKFLQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELL--RGGKWDIRNKKFIKPYDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFSYVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDED-YKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSP-IRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGR 2477
            PVFDG R ++T +  P + G  K+        E     F +      ++ L  L   +Q   GR   +P E + ALD I R   L     T  GR+ F        PL  G  +   G+  ++RP  WK+  N D +    ++  ++ +++ ++++ ++     L  +     T+++K L+V+ NH          RKY +   + +SA+ +      E+  TIE    +YFQ  Y +KL++P+L  ++     K T++P+E+  ++  QR I+    +    +IK  A  A DR  ++N+ +         D  LQ + + ++ ++  ++ RV+  P+  +GG+       + G WD+R K+F    +  V WA+     +R  + +   L     +L   +N+ G+ + G   F    Y   +       R  +     L L+V V+      Y EVK+ GD++FG+ TQC++   +N+     Q L N+ LK+N KLGG+N  L P +R  +F   K+  +  G D THP +  +    S+AA+VGS+D + + Y+A +  Q  ++E      + ++  MV  LL+ FYK+ +  KP R+I+YRDGVSEGQF  V  HE+ AI+ AC KLE  YQP IT++VVQKRH  R F  ++KD +GRSGN+P+GT VD+ ITH  EFDFYLCSH GIQGTS+P+HYHVL+D+N + +DE+Q+ TY LCH Y RCTRSVS PAP YYAHL AFR R
Sbjct:  163 PVFDGRRNMYTRE--PLSIGKEKLELEVILPGEGKDRVFKVCLKHVSEVSLFALEEALQ---GRRQTIPAETVTALDVIMRH--LPSMTYTPVGRSFFHNTGDYDNPLGGGREVWF-GFHQSVRPSQWKMMLNIDVSATAFYKEQSVINFMFEVLEIDKDQKRPLTDSQRVKFTKEIKGLKVEINHCG-----PIKRKYRVCNVTRRSAQSQTFPLQSEQGQTIECTVTKYFQDRYGMKLQHPHLPCLQVGQEQKHTYLPLEVCNIVSGQRCIKKLTDMQTSTMIKATARSAPDREKEINNLVRRSNFN--ADPHLQIFGVSVNTRMADIQGRVIPAPKIQYGGRTKAQATPQQGVWDMRGKQFFSGIEIKV-WAIACFAPQRTVREDS--LRTFTQQLQKISNDAGMPIVGQPCFCK--YATGQDQVEPMFRYLKNSFTGLQLIVVVLPGKTPVYAEVKRVGDIIFGLATQCVQAKNVNKPS--PQTLSNLCLKINVKLGGINSILVPSVRPAVF---KEPVIFLGADFTHPPAG-DKTKPSIAAVVGSMDAHPSRYAATVSVQPHRQE-----TIQDLAAMVKELLIQFYKSTR-FKPTRIIYYRDGVSEGQFLNVLNHELKAIREACIKLEMSYQPGITFVVVQKRHHTRLFCSDKKDQMGRSGNIPAGTTVDQIITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSADEIQTLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRAR 883          
BLAST of Argonaute 1 vs. Planmine SMEST
Match: SMESG000081970.1 (SMESG000081970.1)

HSP 1 Score: 157.918 bits (398), Expect = 3.625e-39
Identity = 107/314 (34.08%), Postives = 157/314 (50.00%), Query Frame = 3
Query: 1545 KLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGRTL 2483
            +L + +   + ++ Y  +KKF  V   + +Q +   TL     L+    NI L++N KLGG  W +         PIK  FMV G+DV H    R   S+SV A+VGS   NA       +  L ++++   EI+  ++  + +LL  +++ N  L P+ +  YRDGVS+GQ   V K EI       +    DY+P + Y VVQKR   R +  + K+  G+  N   GT+VD  +T    +DF+L S    QGT  P HY VL D + +   ++Q   Y  CHIY     +V  PAP  YAH LA   G+ L
Sbjct:  664 QLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVLAQTLKEGPKLNSVAVNIALQINAKLGGELWAVK-------IPIK-KFMVVGLDVWHDTKGR---SRSVGAVVGS--TNALCTRWFSKSHLQEQDK---EIMYVLQSCMLSLLKAYFEENNFL-PETIFMYRDGVSDGQLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNK-GQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNL 959          
BLAST of Argonaute 1 vs. Planmine SMEST
Match: SMESG000036375.1 (SMESG000036375.1)

HSP 1 Score: 117.857 bits (294), Expect = 9.569e-27
Identity = 102/353 (28.90%), Postives = 161/353 (45.61%), Query Frame = 3
Query: 1494 IEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYAT------LNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLL--MTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKL-EKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE--NNWGSDE--------LQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGRTLIGL 2492
            +E   TD IR S     K+ + +  + +D+ Y +VK F  +  G++TQC+            R+   D+ +  +  K+     G+N +++P             M+ G+D  H  + +    +SV A V S+    + Y + +     K E          E++  N L  +T ++      P RLI YRDGV + Q     K E  A+    +K+ E    P I Y+VV+KR  ++FF    KDG     N   GTVVD+ I     ++FYL S +  +GT+ P +Y+VL D    N  ++E        LQ  TY L H+Y     ++  P PT+YAH LA   G+   G+
Sbjct:  478 VEDALTDFIRVS-----KVHMALVFIPDDKVYAKVKNF-TMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPT------------MIVGLDTFHSKTGK----RSVQASVFSISAKFSQYISFVNSSKGKNEFH--------ENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF----KDG----ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGV 792          
The following BLAST results are available for this feature:
BLAST of Argonaute 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AGO23.941e-13035.05argonaute RISC catalytic component 2 [Source:HGNC ... [more]
AGO34.018e-12536.70argonaute RISC catalytic component 3 [Source:HGNC ... [more]
AGO12.158e-12434.13argonaute RISC component 1 [Source:HGNC Symbol;Acc... [more]
AGO12.326e-12334.13argonaute RISC component 1 [Source:HGNC Symbol;Acc... [more]
AGO48.659e-12233.64argonaute RISC component 4 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Argonaute 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alg-28.436e-12533.55pep chromosome:WBcel235:II:874160:879001:1 gene:WB... [more]
alg-11.825e-12433.25pep chromosome:WBcel235:X:13951262:13956261:1 gene... [more]
alg-22.010e-12433.55pep chromosome:WBcel235:II:873176:878945:1 gene:WB... [more]
alg-12.716e-12433.25pep chromosome:WBcel235:X:13949114:13956261:1 gene... [more]
alg-41.469e-8536.30pep chromosome:WBcel235:III:9887211:9891358:-1 gen... [more]
back to top
BLAST of Argonaute 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AGO11.582e-13034.68gene:FBgn0262739 transcript:FBtr0305592[more]
AGO11.582e-13034.68gene:FBgn0262739 transcript:FBtr0087612[more]
AGO11.582e-13034.68gene:FBgn0262739 transcript:FBtr0087613[more]
AGO11.699e-13034.68gene:FBgn0262739 transcript:FBtr0087614[more]
AGO27.115e-7829.29gene:FBgn0087035 transcript:FBtr0331933[more]
back to top
BLAST of Argonaute 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ago28.616e-13034.70argonaute RISC catalytic component 2 [Source:ZFIN;... [more]
ago47.258e-12633.90argonaute RISC component 4 [Source:ZFIN;Acc:ZDB-GE... [more]
ago3b4.410e-12534.55argonaute RISC catalytic component 3b [Source:NCBI... [more]
ago11.712e-12434.38argonaute RISC component 1 [Source:ZFIN;Acc:ZDB-GE... [more]
ago3a1.483e-12334.24argonaute RISC catalytic component 3a [Source:ZFIN... [more]
back to top
BLAST of Argonaute 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm261.099e-12935.05RNA binding motif protein 26 [Source:Xenbase;Acc:X... [more]
rbm262.533e-12934.92RNA binding motif protein 26 [Source:Xenbase;Acc:X... [more]
rbm265.708e-12935.05RNA binding motif protein 26 [Source:Xenbase;Acc:X... [more]
rbm268.622e-12834.78RNA binding motif protein 26 [Source:Xenbase;Acc:X... [more]
rbm263.439e-12734.73RNA binding motif protein 26 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Argonaute 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ago22.925e-13034.92argonaute RISC catalytic subunit 2 [Source:MGI Sym... [more]
Ago39.589e-12735.20argonaute RISC catalytic subunit 3 [Source:MGI Sym... [more]
Ago11.597e-12334.13argonaute RISC catalytic subunit 1 [Source:MGI Sym... [more]
Ago43.593e-12033.38argonaute RISC catalytic subunit 4 [Source:MGI Sym... [more]
Ago14.689e-11139.39argonaute RISC catalytic subunit 1 [Source:MGI Sym... [more]
back to top
BLAST of Argonaute 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UKV8|AGO2_HUMAN1.893e-12935.05Protein argonaute-2 OS=Homo sapiens OX=9606 GN=AGO... [more]
sp|O77503|AGO2_RABIT1.916e-12935.05Protein argonaute-2 (Fragment) OS=Oryctolagus cuni... [more]
sp|Q8CJG0|AGO2_MOUSE2.046e-12934.92Protein argonaute-2 OS=Mus musculus OX=10090 GN=Ag... [more]
sp|Q6QME8|AGO2_BOVIN2.421e-12935.05Protein argonaute-2 OS=Bos taurus OX=9913 GN=AGO2 ... [more]
sp|Q9QZ81|AGO2_RAT7.007e-12934.79Protein argonaute-2 OS=Rattus norvegicus OX=10116 ... [more]
back to top
BLAST of Argonaute 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0M5JTQ72.485e-16539.39Argonaute 1 OS=Macrostomum lignano OX=282301 GN=ag... [more]
A0A267DZ881.287e-16339.39Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GJP11.947e-16339.26Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GY186.762e-16339.39Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A0X3NYE93.878e-16140.64Protein argonaute-3 (Fragment) OS=Schistocephalus ... [more]
back to top
BLAST of Argonaute 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ago27.719e-13134.44argonaute RISC catalytic component 2 [Source:NCBI ... [more]
ago27.989e-13134.44argonaute RISC catalytic component 2 [Source:NCBI ... [more]
ago41.242e-12534.26protein argonaute-4 [Source:NCBI gene;Acc:10304381... [more]
ago41.207e-12333.64protein argonaute-4 [Source:NCBI gene;Acc:10304381... [more]
ago3b4.395e-12334.08argonaute RISC catalytic component 3b [Source:NCBI... [more]
back to top
BLAST of Argonaute 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ago21.549e-8155.41argonaute RISC catalytic component 2 [Source:ZFIN;... [more]
ENSPMAT00000009610.11.093e-7930.12pep scaffold:Pmarinus_7.0:GL477777:44890:66775:1 g... [more]
piwil23.277e-3931.83piwi-like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil12.063e-2526.68piwi-like RNA-mediated gene silencing 1 [Source:NC... [more]
ENSPMAT00000009140.14.975e-1423.79pep scaffold:Pmarinus_7.0:GL477723:307292:327713:-... [more]
back to top
BLAST of Argonaute 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Argonaute 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO464313.052e-12834.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385836.420e-8330.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340277.327e-3924.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499313.580e-3625.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281241.271e-635.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Argonaute 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AGO22.105e-13134.66protein argonaute-2 [Source:NCBI gene;Acc:10115610... [more]
ago3a2.851e-12634.69protein argonaute-3 [Source:NCBI gene;Acc:10115732... [more]
ENSORLT00000011404.21.801e-12534.69protein argonaute-3 [Source:NCBI gene;Acc:10116565... [more]
ago14.292e-12434.25protein argonaute-1 [Source:NCBI gene;Acc:10116948... [more]
AGO21.666e-12333.04protein argonaute-2 [Source:NCBI gene;Acc:10115610... [more]
back to top
BLAST of Argonaute 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050994.10.000e+097.86SMESG000050994.1[more]
SMESG000051000.10.000e+051.16SMESG000051000.1[more]
SMESG000047591.19.636e-12934.66SMESG000047591.1[more]
SMESG000081970.13.625e-3934.08SMESG000081970.1[more]
SMESG000036375.19.569e-2728.90SMESG000036375.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006792 ID=SMED30006792|Name=Argonaute 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2720bp
TTTTTATCATATTTTTATTGTATGATTCGTTGTATATTCATATAAAAAGT
ACAAAATAATAACTGGAAATGCATTTTTTAAGTCGTAAAGTGGAGTAAAG
TGGATAAACACACTTTCAATACACTCTAGAATTTCTAATGTTGACGAAAA
ATAAAATTTAACAGTAATAATGTTATATATACAAGAAGGTTAAAGTATTT
ATAAAACTTCATTTCTAATGCGTTTTTTCAAATTTGGTTTATATTTTATT
TAGTTTTTAAAAATATATTAGAGGAATGCCGGTATTTGATGGAGGAAGAA
TTATATTCACTAATAAATTACTGCCATATAATGACGGTACTTGTAAAATA
ACTCATAATTTCAATTATGAATCCGAAAATGTTACTTGTCATTTTAATAT
TCAACGAGTAAAAGAAGAAGATATTGAACTAGGTAACTTGAATAATTATA
TACAATCTAAAAAAGGTAGAAGTGATGATATGCCACAAGAAGCTTTACGT
GCATTAGACACAATATTTAGAGAAATGTTTTTAAATAAAAATTTAATAAC
TATTGGAGGTCGAGCAATTTTTGATCCCAAAACATCAACACCGTTGAGGT
GTGGTCCATATATTTTAATGGAAGGTTATGCTACTACTATTCGCCCTCAT
ATGTGGAAAGTTCGTTTCAACTTTGACAAAACTCAAGTTGTCTGTCATGA
AGCCATCAATCTTTACGATTATATTTCAAAGATTATGGACCCAAATAGAT
TAAATCCGAATACGATACGCAATTTAACTAGAAAGCTTAAAACACTTCGA
GTTCAAGCAAATCATTTAAAAAATGCAGACGGTAAAGCATATTCACGAAA
GTACACAATTTTTGGATTTTCTAATAAAAGCGCTAGAGAAGAAAAAATTG
TTGAAAAAAATTTAACTATTGAACAATATTTTCAAAAGGAATATAATATA
AAGTTGAAATACCCAAATCTTTCTATGGTTAAGACAAGTCCAAATAAGCC
AACATTTGTCCCAATAGAGCTGTTAACTATGCTTCCTAATCAGAGAGTAA
TTGAATCAGATGGCAAAATCGTTCAAGAAGTTATTAAATTTGCTGCCATA
CCAGCCGCTGACAGGCTATATAAACTAAATAGCGCGATGTCATCTTTACA
AATTGGAAATCGTGGTGATAAATTCCTGCAAAATTATAAGATAGAAATAG
ATCCTAAGCTTATTGGTGTGGAAGCTAGAGTTCTTGATGGGCCAGAGGGT
ATATTTGGTGGTCAACGACCAGAGCTTTTGCGTGGTGGCAAATGGGACAT
AAGAAATAAAAAGTTTATAAAGCCATATGACAAATTAGTAAATTGGGCAC
TTTTTGCAGTTGGAACTGAAAGAGACTATCAAAGAAACGACAAGCCCCTC
TATGATATTGAAGATAAATTACCAGGTGCAGCTAACAATGTTGGGATACG
TATGGGAGGATCTTTTTATTTTTCATATGTTCCTTATCAGAATATAGAAA
AAGTTGCGACTGACACAATTAGAAATTCAGAAAAAGAAAAAAAGAAGCTC
GATTTGTTGGTATTTGTGGTTATTAATGATGAAGATTATAAAGAGGTGAA
GAAGTTTGGAGATGTTCTATTCGGAATTGTAACTCAGTGCATGAAATATG
CAACTTTAAATAGGCAGAAATTCTTAGATCAGTATCTTGGAAACATAATG
TTGAAGGTTAATGGTAAATTAGGAGGGGTAAATTGGGAATTAAGTCCAAT
AAGAAATAGATTGTTCACACCTATTAAAGATTCCTTTATGGTATTTGGAA
TTGACGTTACACATCCTGCTTCCACCAGAAATGATTTATCAAAAAGTGTT
GCTGCGATGGTCGGTAGTTTGGATAATAATGCAACAATGTATAGTGCTCT
TATTCGTCAACAGTTATCGAAAAAAGAAAGAGCGATAATTGAAATTGTTA
TGGAAATGGAGGACATGGTTTATAATCTATTAATGACATTCTACAAAGCT
AATAAGCAATTAAAACCCAAGCGCTTGATATTTTACCGAGATGGCGTTTC
TGAAGGACAATTTGACATTGTATTCAAGCATGAAATAATTGCTATTCAAA
GTGCATGCCAAAAATTAGAAAAGGACTATCAACCTCCTATAACGTATATT
GTTGTTCAAAAAAGACACAAAATCCGATTTTTTCCTCAAAATGAAAAAGA
TGGAGTAGGGCGAAGCGGGAATGTTCCTTCAGGAACTGTAGTCGATAAAG
ATATAACACATTGTAGGGAATTTGATTTTTACCTTTGTTCACACGAAGGC
ATACAAGGAACTTCAAAACCTGCGCATTACCATGTTCTTTTTGATGAAAA
TAATTGGGGATCAGACGAGTTGCAGAGCTTTACTTACTTTTTATGCCATA
TTTATGCGAGATGTACCAGAAGCGTTTCATATCCAGCTCCCACTTACTAT
GCCCACTTGGCAGCCTTCAGAGGAAGAACTTTGATCGGACTGTCCGATGA
TGACAGCAGCAGTACTACATCTGGTCATAGCACAAGAACCGATACCAGTG
AATCACAAATTCTGATCAACGAATTTCATCATGACAAATTATTTTTTATT
TAAATAAAAATGTATCACTTGTTATTTATTAATAACTAACAATCGTAACC
CTATGCTTTAATTAATAAAATACTAAATTCTTAGGCACCTTTATTTCAAT
AAAAAATAACAAACATTAAA
back to top

protein sequence of SMED30006792-orf-1

>SMED30006792-orf-1 ID=SMED30006792-orf-1|Name=SMED30006792-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=776bp
MPVFDGGRIIFTNKLLPYNDGTCKITHNFNYESENVTCHFNIQRVKEEDI
ELGNLNNYIQSKKGRSDDMPQEALRALDTIFREMFLNKNLITIGGRAIFD
PKTSTPLRCGPYILMEGYATTIRPHMWKVRFNFDKTQVVCHEAINLYDYI
SKIMDPNRLNPNTIRNLTRKLKTLRVQANHLKNADGKAYSRKYTIFGFSN
KSAREEKIVEKNLTIEQYFQKEYNIKLKYPNLSMVKTSPNKPTFVPIELL
TMLPNQRVIESDGKIVQEVIKFAAIPAADRLYKLNSAMSSLQIGNRGDKF
LQNYKIEIDPKLIGVEARVLDGPEGIFGGQRPELLRGGKWDIRNKKFIKP
YDKLVNWALFAVGTERDYQRNDKPLYDIEDKLPGAANNVGIRMGGSFYFS
YVPYQNIEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFG
IVTQCMKYATLNRQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPI
KDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKK
ERAIIEIVMEMEDMVYNLLMTFYKANKQLKPKRLIFYRDGVSEGQFDIVF
KHEIIAIQSACQKLEKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNV
PSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDENNWGSDELQ
SFTYFLCHIYARCTRSVSYPAPTYYAHLAAFRGRTLIGLSDDDSSSTTSG
HSTRTDTSESQILINEFHHDKLFFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0031047gene silencing by RNA
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036397RNaseH_sf
IPR036085PAZ_dom_sf
IPR003165Piwi
IPR003100PAZ_dom
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 164..184
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 319..492
e-value: 1.5E-29
score: 104.8
NoneNo IPR availableGENE3DG3DSA:2.170.260.10coord: 139..259
e-value: 1.6E-27
score: 98.2
NoneNo IPR availablePANTHERPTHR22891EUKARYOTIC TRANSLATION INITIATION FACTOR 2Ccoord: 2..739
NoneNo IPR availableCDDcd02846PAZ_argonaute_likecoord: 143..253
e-value: 5.17955E-23
score: 92.3801
NoneNo IPR availableCDDcd04657Piwi_ago-likecoord: 299..737
e-value: 2.3534E-171
score: 497.906
IPR003165Piwi domainSMARTSM00950Piwi_a_2coord: 427..738
e-value: 1.4E-111
score: 386.6
IPR003165Piwi domainPFAMPF02171Piwicoord: 433..736
e-value: 2.9E-96
score: 322.3
IPR003165Piwi domainPROSITEPS50822PIWIcoord: 427..738
score: 46.046
IPR003100PAZ domainSMARTSM00949PAZ_2_a_3coord: 144..275
e-value: 2.2E-4
score: 18.2
IPR003100PAZ domainPFAMPF02170PAZcoord: 148..258
e-value: 3.6E-13
score: 49.5
IPR003100PAZ domainPROSITEPS50821PAZcoord: 141..254
score: 14.326
IPR036397Ribonuclease H superfamilyGENE3DG3DSA:3.30.420.10coord: 498..775
e-value: 1.4E-108
score: 364.2
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 428..736
IPR036085PAZ domain superfamilySUPERFAMILYSSF101690PAZ domaincoord: 140..292