slc40a-1

Overview
Nameslc40a-1 (AKN21679.1)
Smed IDSMED30006791
Length (bp)1089
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc40a-1 (SMED30006791) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc40a-1 (SMED30006791) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006791

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30006791h1SMcG0020929 Contig29580uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006791h1SMcG0020929 Contig29580newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30006791h1SMcG0020929 dd_Smed_v4_9732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006791h1SMcG0020929 dd_Smed_v4_9732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006791h1SMcG0020929 dd_Smed_v4_9732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006791h1SMcG0020929 dd_Smed_v4_9732_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc40a-1 vs. Ensembl Human
Match: SLC40A1 (solute carrier family 40 member 1 [Source:HGNC Symbol;Acc:HGNC:10909])

HSP 1 Score: 81.2629 bits (199), Expect = 1.659e-17
Identity = 39/96 (40.62%), Postives = 65/96 (67.71%), Query Frame = 3
Query:   45 DNNAKSRNCLG----FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            D+N + R C G    +LT  K+L Y    +S+W DR W+F + ++LV L  ++L+LTA++G + +G VL++G++IG W D+++RLK A   L+V+N
Sbjct:    6 DHN-RQRGCCGSLADYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQN 100          
BLAST of slc40a-1 vs. Ensembl Human
Match: SLC40A1 (solute carrier family 40 member 1 [Source:HGNC Symbol;Acc:HGNC:10909])

HSP 1 Score: 81.6481 bits (200), Expect = 2.585e-16
Identity = 39/96 (40.62%), Postives = 65/96 (67.71%), Query Frame = 3
Query:   45 DNNAKSRNCLG----FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            D+N + R C G    +LT  K+L Y    +S+W DR W+F + ++LV L  ++L+LTA++G + +G VL++G++IG W D+++RLK A   L+V+N
Sbjct:    6 DHN-RQRGCCGSLADYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQN 100          
BLAST of slc40a-1 vs. Ensembl Zebrafish
Match: si:ch211-254p10.2 (si:ch211-254p10.2 [Source:ZFIN;Acc:ZDB-GENE-100922-17])

HSP 1 Score: 69.707 bits (169), Expect = 1.661e-14
Identity = 33/78 (42.31%), Postives = 50/78 (64.10%), Query Frame = 3
Query:   66 NCLGFLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAV 299
            + L +L   K+L Y    +S W DR W+F + ++L+ L   NL+LTAIFG + +G VLL+G++IG W DR+ R K  +
Sbjct:   15 SALIYLKGPKFLIYVSGALSMWGDRMWHFAISVFLIELYGHNLLLTAIFGLVVAGSVLLLGALIGDWVDRNPRNKGKI 92          
BLAST of slc40a-1 vs. Ensembl Zebrafish
Match: slc40a1 (solute carrier family 40 member 1 [Source:NCBI gene;Acc:58153])

HSP 1 Score: 73.9442 bits (180), Expect = 5.899e-14
Identity = 34/81 (41.98%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   78 FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            F    K+L Y    +S+W DR W F + ++LV L  ++L+LTA++G + +G VLL+G++IG W D++ RLK A   L+V+N
Sbjct:   17 FFKSAKFLIYVGHALSTWGDRMWNFAVAVFLVELYGNSLLLTAVYGLVVAGSVLLLGAIIGDWVDKNPRLKVAQTSLVVQN 97          
BLAST of slc40a-1 vs. Ensembl Zebrafish
Match: si:ch211-254p10.2 (si:ch211-254p10.2 [Source:ZFIN;Acc:ZDB-GENE-100922-17])

HSP 1 Score: 60.4622 bits (145), Expect = 1.077e-9
Identity = 29/62 (46.77%), Postives = 43/62 (69.35%), Query Frame = 3
Query:  135 DRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            DR W+F + ++L+ L   NL+LTAIFG + +G VLL+G++IG W DR+ R K A   L ++N
Sbjct:    2 DRMWHFAISVFLIELYGHNLLLTAIFGLVVAGSVLLLGALIGDWVDRNPRNKVAHASLFIQN 63          
BLAST of slc40a-1 vs. Ensembl Xenopus
Match: slc40a1 (solute carrier family 40 (iron-regulated transporter), member 1 [Source:NCBI gene;Acc:100036732])

HSP 1 Score: 79.337 bits (194), Expect = 1.311e-15
Identity = 39/95 (41.05%), Postives = 62/95 (65.26%), Query Frame = 3
Query:   48 NNAKSRNCLG----FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
             + ++  C G    +LT  K+L Y    +S+W DR W+F + ++LV L  ++L+LTA++G + +G VLL+G+VIG W D++ RLK A   LIV+N
Sbjct:    5 GDQENAGCCGSIATYLTSAKFLMYLGHALSTWGDRMWHFAVSLFLVELYGNSLLLTAVYGLVVAGSVLLLGAVIGDWVDKNPRLKVAQTSLIVQN 99          
BLAST of slc40a-1 vs. Ensembl Xenopus
Match: ENSXETT00000025368.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:39503522:39523316:1 gene:ENSXETG00000014425.1 transcript:ENSXETT00000025368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 1.804e-12
Identity = 41/125 (32.80%), Postives = 76/125 (60.80%), Query Frame = 3
Query:  126 SWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRNXXXXXXXXXXXXXXFFYDFVILTDKAPTFRIISQSLLVIFGVLAHVAGLVNNNLLSKDWL 500
            S  DR W+F + ++LV L   +L+LTA++GF+ SG +LL+G+VIG W D++ R+KAA   L+++N+S + C + L +V  + D V  T +      +   L+++   +A++       ++ +DW+
Sbjct:   22 SLGDRMWHFAVSVFLVELYGHSLLLTAVYGFVVSGSILLLGAVIGDWVDKNERIKAARTSLVIQNISIMFCGIILMMVFRYKDQV--TTQHKWLLTVCYILVILIATIANIGSTATGIIIERDWI 144          
BLAST of slc40a-1 vs. Ensembl Xenopus
Match: ENSXETT00000025371.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:39503308:39523316:1 gene:ENSXETG00000014425.1 transcript:ENSXETT00000025371.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 2.395e-12
Identity = 40/122 (32.79%), Postives = 75/122 (61.48%), Query Frame = 3
Query:  135 DRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRNXXXXXXXXXXXXXXFFYDFVILTDKAPTFRIISQSLLVIFGVLAHVAGLVNNNLLSKDWL 500
            DR W+F + ++LV L   +L+LTA++GF+ SG +LL+G+VIG W D++ R+KAA   L+++N+S + C + L +V  + D V  T +      +   L+++   +A++       ++ +DW+
Sbjct:   28 DRMWHFAVSVFLVELYGHSLLLTAVYGFVVSGSILLLGAVIGDWVDKNERIKAARTSLVIQNISIMFCGIILMMVFRYKDQV--TTQHKWLLTVCYILVILIATIANIGSTATGIIIERDWI 147          
BLAST of slc40a-1 vs. Ensembl Xenopus
Match: cul4a (cullin 4A [Source:Xenbase;Acc:XB-GENE-1014775])

HSP 1 Score: 67.3958 bits (163), Expect = 1.225e-11
Identity = 32/80 (40.00%), Postives = 48/80 (60.00%), Query Frame = 3
Query:   81 LTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            L   ++L Y    +S W DR W+F + ++L+ L   NL+LTA+FG + +G VL+ G+ IG W DR  R K A   L ++N
Sbjct:   12 LVNPRFLIYVSCALSIWGDRMWHFAVSVFLIELYGHNLLLTAVFGLVVAGSVLVFGAFIGDWIDRKPRNKVAHASLFIQN 91          
BLAST of slc40a-1 vs. Ensembl Xenopus
Match: cul4a (cullin 4A [Source:Xenbase;Acc:XB-GENE-1014775])

HSP 1 Score: 66.2402 bits (160), Expect = 2.735e-11
Identity = 31/76 (40.79%), Postives = 47/76 (61.84%), Query Frame = 3
Query:   93 KYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            ++L Y    +S W DR W+F + ++L+ L   NL+LTA+FG + +G VL+ G+ IG W DR  R K A   L ++N
Sbjct:    2 RFLIYVSCALSIWGDRMWHFAVSVFLIELYGHNLLLTAVFGLVVAGSVLVFGAFIGDWIDRKPRNKVAHASLFIQN 77          
BLAST of slc40a-1 vs. Ensembl Mouse
Match: Slc40a1 (solute carrier family 40 (iron-regulated transporter), member 1 [Source:MGI Symbol;Acc:MGI:1315204])

HSP 1 Score: 78.5666 bits (192), Expect = 2.079e-15
Identity = 36/95 (37.89%), Postives = 61/95 (64.21%), Query Frame = 3
Query:   48 NNAKSRNCLG----FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            +      C G    +LT  K+L Y    +S+W DR W+F + ++LV L  ++L+LTA++G + +G VL++G++IG W D+++RLK A   L+V+N
Sbjct:    6 DQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQN 100          
BLAST of slc40a-1 vs. Ensembl Mouse
Match: Slc40a1 (solute carrier family 40 (iron-regulated transporter), member 1 [Source:MGI Symbol;Acc:MGI:1315204])

HSP 1 Score: 46.595 bits (109), Expect = 1.321e-6
Identity = 20/51 (39.22%), Postives = 35/51 (68.63%), Query Frame = 3
Query:   78 FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSG 230
            +LT  K+L Y    +S+W DR W+F + ++LV L  ++L+LTA++G + +G
Sbjct:   20 YLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAG 70          
BLAST of slc40a-1 vs. Ensembl Mouse
Match: Slc40a1 (solute carrier family 40 (iron-regulated transporter), member 1 [Source:MGI Symbol;Acc:MGI:1315204])

HSP 1 Score: 46.595 bits (109), Expect = 1.321e-6
Identity = 20/51 (39.22%), Postives = 35/51 (68.63%), Query Frame = 3
Query:   78 FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSG 230
            +LT  K+L Y    +S+W DR W+F + ++LV L  ++L+LTA++G + +G
Sbjct:   20 YLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAG 70          
BLAST of slc40a-1 vs. Ensembl Mouse
Match: Slc40a1 (solute carrier family 40 (iron-regulated transporter), member 1 [Source:MGI Symbol;Acc:MGI:1315204])

HSP 1 Score: 46.595 bits (109), Expect = 1.321e-6
Identity = 20/51 (39.22%), Postives = 35/51 (68.63%), Query Frame = 3
Query:   78 FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSG 230
            +LT  K+L Y    +S+W DR W+F + ++LV L  ++L+LTA++G + +G
Sbjct:   20 YLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAG 70          
BLAST of slc40a-1 vs. UniProt/SwissProt
Match: sp|Q9NP59|S40A1_HUMAN (Solute carrier family 40 member 1 OS=Homo sapiens OX=9606 GN=SLC40A1 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.241e-15
Identity = 39/96 (40.62%), Postives = 65/96 (67.71%), Query Frame = 3
Query:   45 DNNAKSRNCLG----FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            D+N + R C G    +LT  K+L Y    +S+W DR W+F + ++LV L  ++L+LTA++G + +G VL++G++IG W D+++RLK A   L+V+N
Sbjct:    6 DHN-RQRGCCGSLADYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQN 100          
BLAST of slc40a-1 vs. UniProt/SwissProt
Match: sp|Q9JHI9|S40A1_MOUSE (Solute carrier family 40 member 1 OS=Mus musculus OX=10090 GN=Slc40a1 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.454e-14
Identity = 36/95 (37.89%), Postives = 61/95 (64.21%), Query Frame = 3
Query:   48 NNAKSRNCLG----FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            +      C G    +LT  K+L Y    +S+W DR W+F + ++LV L  ++L+LTA++G + +G VL++G++IG W D+++RLK A   L+V+N
Sbjct:    6 DQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQN 100          
BLAST of slc40a-1 vs. UniProt/SwissProt
Match: sp|Q923U9|S40A1_RAT (Solute carrier family 40 member 1 OS=Rattus norvegicus OX=10116 GN=Slc40a1 PE=2 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 1.652e-14
Identity = 36/95 (37.89%), Postives = 60/95 (63.16%), Query Frame = 3
Query:   48 NNAKSRNCLG----FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            +      C G    +LT  K+L Y    +S+W DR W+F + ++LV L  + L+LTA++G + +G VL++G++IG W D+++RLK A   L+V+N
Sbjct:    6 DQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNGLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQN 100          
BLAST of slc40a-1 vs. UniProt/SwissProt
Match: sp|Q9I9R3|S40A1_DANRE (Solute carrier family 40 member 1 OS=Danio rerio OX=7955 GN=slc40a1 PE=2 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 4.494e-13
Identity = 34/81 (41.98%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   78 FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            F    K+L Y    +S+W DR W F + ++LV L  ++L+LTA++G + +G VLL+G++IG W D++ RLK A   L+V+N
Sbjct:   17 FFKSAKFLIYVGHALSTWGDRMWNFAVAVFLVELYGNSLLLTAVYGLVVAGSVLLLGAIIGDWVDKNPRLKVAQTSLVVQN 97          
BLAST of slc40a-1 vs. TrEMBL
Match: A0A0H3YJL2 (Solute carrier family 40 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc40a-1 PE=2 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 1.816e-93
Identity = 165/167 (98.80%), Postives = 165/167 (98.80%), Query Frame = 3
Query:    3 SSMSAYSEIKYSTIDNNAKSRNCLGFLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRNXXXXXXXXXXXXXXFFYDFVILTDKAPTFRIISQSLLVIFGVLAHVAGLVNNNLLSKDWLP 503
            SSMSAYSEIKYSTIDNNAKSRNCLGFLTETK LFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFL SGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRNLSTLVCSVSLCVVLFFYDFVILTDKAPTFRIISQSLLVIFGVLAHVAGLVNNNLLSKDWLP
Sbjct:    9 SSMSAYSEIKYSTIDNNAKSRNCLGFLTETKSLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLASGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRNLSTLVCSVSLCVVLFFYDFVILTDKAPTFRIISQSLLVIFGVLAHVAGLVNNNLLSKDWLP 175          
BLAST of slc40a-1 vs. TrEMBL
Match: A0A2D4GFZ1 (Solute carrier family 40 protein OS=Micrurus corallinus OX=54390 PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.646e-15
Identity = 38/92 (41.30%), Postives = 63/92 (68.48%), Query Frame = 3
Query:   45 DNNAKSRNCLGFLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            ++     +C+ +LT  K L Y+   +S+W DR W+F + ++LV L  ++L+LTA++G + +G VLL+G++IG W D++SRLK A   LIV+N
Sbjct:   10 NSRGCCESCMNYLTSAKVLLYFGHALSTWGDRMWHFAVSLFLVELYGNSLLLTAVYGLVVAGSVLLLGAIIGDWVDKNSRLKVAQTSLIVQN 101          
BLAST of slc40a-1 vs. TrEMBL
Match: A0A0B8RQ38 (Solute carrier family 40 protein OS=Boiga irregularis OX=92519 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 9.583e-15
Identity = 40/99 (40.40%), Postives = 68/99 (68.69%), Query Frame = 3
Query:   30 KYSTIDNNAKS--RNCLGFLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            + +T   N++    +C+ +LT  K L Y+   +S+W DR W+F + ++LV L  ++L+LTA++G + +G VLL+G++IG W D++SRLK A + LIV+N
Sbjct:    3 RSATEQQNSRGCCESCINYLTSAKVLLYFGHALSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAGSVLLLGAIIGDWVDKNSRLKVAQMSLIVQN 101          
BLAST of slc40a-1 vs. TrEMBL
Match: C3Y4G3 (Solute carrier family 40 protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_125612 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.260e-14
Identity = 51/141 (36.17%), Postives = 79/141 (56.03%), Query Frame = 3
Query:   78 FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRNXXXXXXXXXXXXXXFFYDFVILTDKAPTFRIISQSLLVIFGVLAHVAGLVNNNLLSKDWL 500
            F+  T +L Y  A +S+W DR W F + ++L+ L P +L LTA++GF  S  VLL+G+VIG W DR++RL A  I L+V+N  ++V    +  +   Y   I   +        Q +L+   V+A +AG      L+KDW+
Sbjct:   41 FVQSTTFLVYTEATLSTWGDRMWSFAVALFLIELSPGSLRLTAVYGFSKSCAVLLLGAVIGDWVDRTARLTAVRIALVVQN-GSVVLCSVVLALTLIYRAEIENLQGGWLMTFCQVVLITLAVVAILAGQATRICLNKDWV 180          
BLAST of slc40a-1 vs. TrEMBL
Match: A0A2J8PRY4 (Solute carrier family 40 protein (Fragment) OS=Pan troglodytes OX=9598 GN=CK820_G0001737 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.361e-14
Identity = 39/96 (40.62%), Postives = 65/96 (67.71%), Query Frame = 3
Query:   45 DNNAKSRNCLG----FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            D+N + R C G    +LT  K+L Y    +S+W DR W+F + ++LV L  ++L+LTA++G + +G VL++G++IG W D+++RLK A   L+V+N
Sbjct:    6 DHN-RQRGCCGSLADYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQN 100          
BLAST of slc40a-1 vs. Ensembl Cavefish
Match: slc40a1 (solute carrier family 40 member 1 [Source:NCBI gene;Acc:103025312])

HSP 1 Score: 77.0258 bits (188), Expect = 4.757e-15
Identity = 37/97 (38.14%), Postives = 58/97 (59.79%), Query Frame = 3
Query:   42 IDNNAKSRNCL----GFLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            ++N    + C      F    K+L Y    +S+W DR W F + ++LV L   NL+LTA++G + +G VLL+G++IG W D++ RLK A   L+V+N
Sbjct:    1 MENGKPKKPCCETVRDFFASAKFLIYLGHALSTWGDRMWNFAVAVFLVELYGDNLLLTAVYGLVVAGSVLLLGAIIGDWVDKNPRLKVAQTSLLVQN 97          
BLAST of slc40a-1 vs. Ensembl Sea Lamprey
Match: slc40a1 (solute carrier family 40 member 1 [Source:NCBI gene;Acc:58153])

HSP 1 Score: 72.7886 bits (177), Expect = 2.141e-14
Identity = 35/85 (41.18%), Postives = 56/85 (65.88%), Query Frame = 3
Query:   66 NCLGFLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            N L FL  ++ L Y C  +S+W DR W+F + ++LV L  ++L+LTA +G + +  VLL G++IG W D +SR+K A   L+++N
Sbjct:   14 NTLRFLRSSRCLIYICHALSTWGDRMWHFAVALFLVELYGNSLLLTAAYGLVVAFSVLLCGALIGHWVDTNSRIKVAQTSLVIQN 98          
BLAST of slc40a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008571.1 (pep scaffold:Pmarinus_7.0:GL483357:10330:15319:1 gene:ENSPMAG00000007762.1 transcript:ENSPMAT00000008571.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 1.073e-12
Identity = 42/159 (26.42%), Postives = 80/159 (50.31%), Query Frame = 3
Query:   45 DNNAKSRNC---LGFLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRNXXXXXXXXXXXXXXFFYDFVILTDKAPTFR----IISQSLLVIFGVLAHVAGLVNNNLLSKDWL 500
            D   K   C     F+   ++  +    +S+W DR W+F M ++LV L   +L L A++G   SG  +L+G+++G W D++ R++   + L V+N      SV LC ++    F+     +P +     ++   +++  GV+A +AG      + +DW+
Sbjct:    4 DPREKEPRCSSIRKFVKSPRFYIFLSHSMSTWGDRMWHFAMSLFLVELYDKSLFLAAVYGLTASGSHILLGALVGDWVDKNPRMRVVRLSLSVQN-----SSVILCALVLLTIFLCKVQISPVWNGWLMVMCYVVVITIGVVAQLAGTAMTIAIQRDWI 157          
BLAST of slc40a-1 vs. Ensembl Nematostella
Match: EDO43654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY83])

HSP 1 Score: 53.5286 bits (127), Expect = 6.502e-8
Identity = 26/62 (41.94%), Postives = 37/62 (59.68%), Query Frame = 3
Query:  135 DRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            DR W F + +YLV L P +L LTAIF    +   +L+G  +G+W D + RLK A   L+ +N
Sbjct:    2 DRMWEFAVALYLVELTPGSLRLTAIFQLTRTLCTILLGPYVGAWVDANPRLKVAQRSLVAQN 63          
BLAST of slc40a-1 vs. Ensembl Medaka
Match: slc40a1 (solute carrier family 40 member 1 [Source:NCBI gene;Acc:101158734])

HSP 1 Score: 75.485 bits (184), Expect = 1.690e-14
Identity = 39/97 (40.21%), Postives = 61/97 (62.89%), Query Frame = 3
Query:   42 IDNNA-KSRNCLG---FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRN 320
            +DN+  K   C     F T  K+L Y    +S+W DR W F + ++LV L  ++L+LTA++G + +G VLL+G++IG W D++ RLK A   L+V+N
Sbjct:    1 MDNSGHKKTRCESIRDFFTSAKFLIYMGHALSTWGDRMWNFAVSVFLVELYGNSLLLTAVYGLVVAGSVLLLGAIIGDWVDKNPRLKVAQTSLLVQN 97          
BLAST of slc40a-1 vs. Ensembl Medaka
Match: ENSORLT00000042491.1 (pep primary_assembly:ASM223467v1:16:15833896:15834366:1 gene:ENSORLG00000021856.1 transcript:ENSORLT00000042491.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 2.934e-14
Identity = 32/80 (40.00%), Postives = 49/80 (61.25%), Query Frame = 3
Query:   78 FLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVR 317
            +L   K+L Y    +S W DR W+F + ++L+ L   NL+LTA+FG + +G VLL G++IG W DR+ R K   + +  R
Sbjct:   10 YLKGPKFLIYVSGALSMWGDRMWHFAISVFLIELYGHNLLLTAVFGLVVAGSVLLFGALIGDWVDRNPRNKGTQMFITCR 89          
BLAST of slc40a-1 vs. Planmine SMEST
Match: SMESG000016854.1 (SMESG000016854.1)

HSP 1 Score: 301.982 bits (772), Expect = 1.345e-98
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = 3
Query:    9 MSAYSEIKYSTIDNNAKSRNCLGFLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRNXXXXXXXXXXXXXXFFYDFVILTDKAPTFRIISQSLLVIFGVLAHVAGLVNNNLLSKDWLP 503
            MSAYSEIKYSTIDNNAKSRNCLGFLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRNLSTLVCSVSLCVVLFFYDFVILTDKAPTFRIISQSLLVIFGVLAHVAGLVNNNLLSKDWLP
Sbjct:    1 MSAYSEIKYSTIDNNAKSRNCLGFLTETKYLFYYCALISSWDDRSWYFLMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVIVLIVRNLSTLVCSVSLCVVLFFYDFVILTDKAPTFRIISQSLLVIFGVLAHVAGLVNNNLLSKDWLP 165          
The following BLAST results are available for this feature:
BLAST of slc40a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SLC40A11.659e-1740.63solute carrier family 40 member 1 [Source:HGNC Sym... [more]
SLC40A12.585e-1640.63solute carrier family 40 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of slc40a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc40a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc40a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-254p10.21.661e-1442.31si:ch211-254p10.2 [Source:ZFIN;Acc:ZDB-GENE-100922... [more]
slc40a15.899e-1441.98solute carrier family 40 member 1 [Source:NCBI gen... [more]
si:ch211-254p10.21.077e-946.77si:ch211-254p10.2 [Source:ZFIN;Acc:ZDB-GENE-100922... [more]
back to top
BLAST of slc40a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc40a11.311e-1541.05solute carrier family 40 (iron-regulated transport... [more]
ENSXETT00000025368.11.804e-1232.80pep primary_assembly:Xenopus_tropicalis_v9.1:9:395... [more]
ENSXETT00000025371.12.395e-1232.79pep primary_assembly:Xenopus_tropicalis_v9.1:9:395... [more]
cul4a1.225e-1140.00cullin 4A [Source:Xenbase;Acc:XB-GENE-1014775][more]
cul4a2.735e-1140.79cullin 4A [Source:Xenbase;Acc:XB-GENE-1014775][more]
back to top
BLAST of slc40a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Slc40a12.079e-1537.89solute carrier family 40 (iron-regulated transport... [more]
Slc40a11.321e-639.22solute carrier family 40 (iron-regulated transport... [more]
Slc40a11.321e-639.22solute carrier family 40 (iron-regulated transport... [more]
Slc40a11.321e-639.22solute carrier family 40 (iron-regulated transport... [more]
back to top
BLAST of slc40a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9NP59|S40A1_HUMAN1.241e-1540.63Solute carrier family 40 member 1 OS=Homo sapiens ... [more]
sp|Q9JHI9|S40A1_MOUSE1.454e-1437.89Solute carrier family 40 member 1 OS=Mus musculus ... [more]
sp|Q923U9|S40A1_RAT1.652e-1437.89Solute carrier family 40 member 1 OS=Rattus norveg... [more]
sp|Q9I9R3|S40A1_DANRE4.494e-1341.98Solute carrier family 40 member 1 OS=Danio rerio O... [more]
back to top
BLAST of slc40a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJL21.816e-9398.80Solute carrier family 40 protein (Fragment) OS=Sch... [more]
A0A2D4GFZ12.646e-1541.30Solute carrier family 40 protein OS=Micrurus coral... [more]
A0A0B8RQ389.583e-1540.40Solute carrier family 40 protein OS=Boiga irregula... [more]
C3Y4G31.260e-1436.17Solute carrier family 40 protein OS=Branchiostoma ... [more]
A0A2J8PRY42.361e-1440.63Solute carrier family 40 protein (Fragment) OS=Pan... [more]
back to top
BLAST of slc40a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc40a14.757e-1538.14solute carrier family 40 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc40a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc40a12.141e-1441.18solute carrier family 40 member 1 [Source:NCBI gen... [more]
ENSPMAT00000008571.11.073e-1226.42pep scaffold:Pmarinus_7.0:GL483357:10330:15319:1 g... [more]
back to top
BLAST of slc40a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc40a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO436546.502e-841.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc40a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc40a11.690e-1440.21solute carrier family 40 member 1 [Source:NCBI gen... [more]
ENSORLT00000042491.12.934e-1440.00pep primary_assembly:ASM223467v1:16:15833896:15834... [more]
back to top
BLAST of slc40a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000016854.11.345e-98100.00SMESG000016854.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006791
GenBankAKN21679.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006791 ID=SMED30006791|Name=slc40a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1089bp
TATCATCAATGTCTGCCTATTCTGAGATAAAATATTCAACAATAGACAAT
AATGCAAAAAGTAGAAATTGTCTAGGATTTCTCACAGAAACAAAATATCT
CTTTTATTATTGTGCTTTAATTTCATCCTGGGATGATCGAAGCTGGTATT
TCTTAATGGGAATTTATCTGGTTGTTTTGGATCCATCAAATCTCATATTG
ACGGCAATCTTTGGATTTTTAGGATCTGGAATTGTTTTATTAGTTGGATC
TGTGATCGGTTCATGGACTGATCGATCTTCAAGGCTTAAAGCTGCTGTGA
TTGTCCTGATAGTCCGTAACCTTAGTACCTTGGTTTGTTCTGTTTCTCTG
TGTGTTGTTTTGTTTTTCTATGATTTTGTCATTTTAACCGATAAAGCTCC
AACTTTCCGTATTATATCCCAATCTCTACTGGTCATTTTTGGCGTCCTGG
CACATGTAGCTGGACTGGTAAACAATAATCTTCTCAGCAAAGATTGGCTG
CCAATTTTATGTCTCAATGACAGCTCATTGTTATCAAGTAATATTTTATT
GTCATTTATCCATATCACATAATCTACGTAGTCATCATGTTAAATAAAAA
TAGTTACTAACAAAAGCAGTAAGGGGGATGTTTTTATAATTGAAATATAT
AAGTCATGTTTGAAAGGAAAAGTTTAAAAGATAAGTCGTTAAAGGGATAT
AAAGGCAAGTAATGTCATTATTAAGAGCTTTTGTATAAGAAAGTAAGGGT
TTGAGTTCAATGTAATTAAAAGGGACTGAAACAATGATTTTTCGTGGTTC
ATAGTTTAAAGAACTATAACTCAACAGTTTGTTGTTCAAGCTTGGGGACT
GTCACCAAGTGTTTTTAATCACATTTAAAATTACAGTGGAGGTTAAATTT
ATTCTCTGAAGGCAAAACTAAGACAGTTCATTTGTTTTTATTATTTTAAT
GAAATAAAAAGACGAATTTAACAGAACTTAAAAGTCTGTAGGAATGCGCA
AAACTAAAAGCAAATCACAGAAGAGTCTTTAGAATTTTCGTACTATTCAG
ATAAAAACTGGAGTCTAGTTTCGAAGAATTTCATATCAG
back to top

protein sequence of SMED30006791-orf-1

>SMED30006791-orf-1 ID=SMED30006791-orf-1|Name=SMED30006791-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=190bp
SSMSAYSEIKYSTIDNNAKSRNCLGFLTETKYLFYYCALISSWDDRSWYF
LMGIYLVVLDPSNLILTAIFGFLGSGIVLLVGSVIGSWTDRSSRLKAAVI
VLIVRNLSTLVCSVSLCVVLFFYDFVILTDKAPTFRIISQSLLVIFGVLA
HVAGLVNNNLLSKDWLPILCLNDSSLLSSNILLSFIHIT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034755iron ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0005381iron ion transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: INTERPRO
TermDefinition
IPR009716Ferroportin-1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009716Ferroportin-1PFAMPF06963FPN1coord: 30..175
e-value: 2.6E-21
score: 75.7
IPR009716Ferroportin-1PANTHERPTHR11660FAMILY NOT NAMEDcoord: 34..178
NoneNo IPR availablePANTHERPTHR11660:SF57FERROPORTINcoord: 34..178
NoneNo IPR availableCDDcd17480MFS_SLC40A1_likecoord: 33..170
e-value: 2.28606E-21
score: 87.6544
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 137..156
NoneNo IPR availableTMHMMTMhelixcoord: 100..122