Collagen alpha-1(XV) chain

Overview
NameCollagen alpha-1(XV) chain
Smed IDSMED30006777
Length (bp)2903
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Collagen alpha-1(XV) chain (SMED30006777) t-SNE clustered cells

Violin plots show distribution of expression levels for Collagen alpha-1(XV) chain (SMED30006777) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Collagen alpha-1(XV) chain (SMED30006777) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Collagen alpha-1(XV) chain (SMED30006777) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006777

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30006777SMESG000081921.1 Contig2280newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30006777SMESG000081921.1 dd_Smed_v4_3516_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006777SMESG000081921.1 dd_Smed_v4_3516_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006777SMESG000081921.1 dd_Smed_v4_3516_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006777SMESG000081921.1 dd_Smed_v4_3516_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006777SMESG000081921.1 dd_Smed_v4_3516_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006777SMESG000081921.1 dd_Smed_v4_3516_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006777SMESG000081921.1 dd_Smed_v4_3516_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30006777SMESG000081921.1 dd_Smed_v4_3516_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006777SMESG000081921.1 dd_Smed_v4_3516_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006777SMESG000081921.1 Contig4116newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006777SMESG000081921.1 Contig4116uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006777SMESG000060198.1 Contig4116newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006777SMESG000060198.1 Contig4116uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30006777SMESG000081921.1 dd_Smed_v6_3516_1_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 3 cellSMED30006777SMESG000081921.1 dd_Smed_v4_3516_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006777SMESG000081921.1 dd_Smed_v4_3516_1_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Collagen alpha-1(XV) chain vs. TrEMBL
Match: A0A4D6FZH8 (Mp-3 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=mp-3 PE=2 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 7.722e-130
Identity = 194/194 (100.00%), Postives = 194/194 (100.00%), Query Frame = 1
Query: 2236 SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEDKSPTEEGLCLNWMSKSSKNSATVTFLKSDKALLNSGQVKSRPCNSMCYILCMQIYPLMSEVR 2817
            SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEDKSPTEEGLCLNWMSKSSKNSATVTFLKSDKALLNSGQVKSRPCNSMCYILCMQIYPLMSEVR
Sbjct:  113 SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEDKSPTEEGLCLNWMSKSSKNSATVTFLKSDKALLNSGQVKSRPCNSMCYILCMQIYPLMSEVR 306          

HSP 2 Score: 217.238 bits (552), Expect = 9.160e-60
Identity = 104/106 (98.11%), Postives = 105/106 (99.06%), Query Frame = 1
Query:  718 IKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDGRTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLL 1035
            IK SIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDGRTLKSLSFNMPVGQMVFLIVENILLVKIDDV+NRWRIVKLESAESDWYFATETQNHQTLL
Sbjct:    1 IKXSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDGRTLKSLSFNMPVGQMVFLIVENILLVKIDDVRNRWRIVKLESAESDWYFATETQNHQTLL 106          
BLAST of Collagen alpha-1(XV) chain vs. TrEMBL
Match: A0A183LC57 (Endostatin domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS1382 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.232e-33
Identity = 78/184 (42.39%), Postives = 105/184 (57.07%), Query Frame = 1
Query: 2260 KLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKP-SLYEDKSPTEEGLCLNWMSK-SSKNSATVTFLKSDKA--LLNSGQVKSRPCNSMCYILCMQIYP 2799
            KL LIA  KP  GDL+ +    GA++GS + CQ+ A   GLGRAFYPLL+TDMF+ +Y++P  YRYGVP+VN   E +   F  L++   + QA +LDF G  I  +I  PC+WIG+KP  L  D     +  C NW S    +N   V+    D A  L +    K   C+  C +LC+QI P
Sbjct:   31 KLYLIAQNKPLRGDLKYNDRITGAHAGSIFACQRAANLKGLGRAFYPLLSTDMFNMDYVVPPTYRYGVPLVNLYGEILFDDFMSLVEGRSKPQAKLLDFDGVDITDDIVAPCLWIGQKPIYLNGDYEYAAQSKCRNWQSTYPGENGLAVSLPIVDNAPGLFSKQNFKLISCSKFCRMLCIQITP 214          
BLAST of Collagen alpha-1(XV) chain vs. TrEMBL
Match: A0A504X3V6 (Collagen alpha-1(XV) chain (Fragment) OS=Fasciola gigantica OX=46835 GN=FGIG_02474 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.688e-32
Identity = 72/184 (39.13%), Postives = 100/184 (54.35%), Query Frame = 1
Query: 2260 KLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPS-LYEDKSPTEEGLCLNWMSKSSKN---SATVTFLKSDKALLNSGQVKSRPCNSMCYILCMQIYP 2799
            KL L+A  +   GDLR      GA++GS Y CQ+ A   GLGRAFYPL++TD+F+ +Y++P  YRYGVP+VN   E I   F  L++     QA IL F G  +M +   PC+W+G +P  L  D     +  C NW S        +AT+    +   LL+    K   C+  C +LC+QI P
Sbjct:   18 KLYLVARNERLRGDLRQGNRLTGAHAGSIYACQRSANAVGLGRAFYPLISTDVFNMDYVVPPMYRYGVPLVNLHGEVIFKDFMSLIQGQSRPQAKILSFDGQDVMDDPAAPCLWLGRRPIYLNGDYEYAAQAKCRNWQSTHPTEQALTATLPLGSNAPGLLSKENTKLVACSQFCRMLCIQIAP 201          
BLAST of Collagen alpha-1(XV) chain vs. TrEMBL
Match: A0A183QKF9 (Endostatin domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 6.590e-32
Identity = 76/184 (41.30%), Postives = 105/184 (57.07%), Query Frame = 1
Query: 2260 KLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKP-SLYEDKSPTEEGLCLNWMSK-SSKNSATVTFLKSDKA--LLNSGQVKSRPCNSMCYILCMQIYP 2799
            KL LIA  +P  GDL+ +    GA++GS + CQ+ A   GLGRAFYPLL+TDMF+ +Y++P  YRYGVP+VN   E +   F  L++   + QA +L+F G  I  +I  PC+WIG+KP  L  D     +  C NW S    +N   V+    D A  L +    K   C+  C +LC+QI P
Sbjct:   32 KLYLIAQNEPLRGDLKYNDRITGAHAGSIFACQRAANLKGLGRAFYPLLSTDMFNMDYVVPPTYRYGVPLVNLHGEILFDDFMSLVEGRSKPQAKLLNFDGVDITDDIVAPCLWIGQKPIYLNGDYEFAAQSKCRNWQSTYPGENGLAVSLPIVDNAPGLFSKQNFKLISCSKFCRMLCIQITP 215          
BLAST of Collagen alpha-1(XV) chain vs. TrEMBL
Match: A0A183JYN8 (Endostatin domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS7844 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.453e-31
Identity = 78/184 (42.39%), Postives = 105/184 (57.07%), Query Frame = 1
Query: 2260 KLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPS-LYEDKSPTEEGLCLNWMSK-SSKNSATVTFLKSDKA--LLNSGQVKSRPCNSMCYILCMQIYP 2799
            KL LIA  KP  GDL+ +    GA++GS + CQ+ A   GLGRAFYPLL+TDMF+ +Y++P  YRYGVP+VN   E +   F  L++   + QA +LDF G  I  +I  PC+WIG+KP  L  D     +  C NW S    +N   V+    D A  L +    K   C+  C +LC+QI P
Sbjct:  158 KLYLIAQNKPLRGDLKYNDRITGAHAGSIFACQRAANLKGLGRAFYPLLSTDMFNMDYVVPPTYRYGVPLVNLYGEILFDDFMSLVEGRSKPQAKLLDFDGVDITDDIVAPCLWIGQKPIYLNGDYEYAAQSKCRNWQSTYPGENGLAVSLPIVDNAPGLFSKQNFKLISCSKFCRMLCIQITP 341          
BLAST of Collagen alpha-1(XV) chain vs. Ensembl Medaka
Match: col18a1a (collagen type XVIII alpha 1 chain a [Source:ZFIN;Acc:ZDB-GENE-030516-3])

HSP 1 Score: 52.7582 bits (125), Expect = 1.990e-6
Identity = 45/181 (24.86%), Postives = 72/181 (39.78%), Query Frame = 1
Query: 2263 LMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSV---EMQASILDFRGDSIM--SEINEPCVWIGEKPSLYEDKSPTEEGLCLNWMSKSSKNSATVTFLKSDKALLNSGQVKSRPCNSMCYILCMQ 2790
            L LIAL  P  G+++          G  YLC +QA   GL   F   L++ + D + ++    R   P+VN +N+ +  S+  +   SV        I  F G  I+  S   E  VW G     +       +  C  W +     +   + L+S   L    Q     C+  C +LC++
Sbjct: 1060 LRLIALNTPQSGNMK-------GIRGPDYLCFEQARAAGLRGTFRAFLSSKVQDLHTIVRHSDREKPPIVNLKNQVLFDSWQSIFGESVSKMRKNVPIYSFDGRDILRDSAWPEKMVWHGSSKKGHRQT----DQYCEAWRAGDQAVTGLASSLQSSHLL----QQTPTSCSRACIVLCIE 1225          
BLAST of Collagen alpha-1(XV) chain vs. Planmine SMEST
Match: SMESG000081921.1 (SMESG000081921.1)

HSP 1 Score: 426.017 bits (1094), Expect = 4.816e-135
Identity = 232/239 (97.07%), Postives = 236/239 (98.74%), Query Frame = 1
Query:  331 FESVKGDKGKQGAGGLNGSDCECINNLRFDILXXXXXXXXXXXXXXXXXXXXXMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDGRTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLLVNLM 1047
            ++  KG KGKQGAGGLNGSDCECINNLRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDG+TLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLLVNL+
Sbjct:  569 YKGTKGYKGKQGAGGLNGSDCECINNLRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDGKTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLLVNLI 807          
BLAST of Collagen alpha-1(XV) chain vs. Planmine SMEST
Match: SMESG000081921.1 (SMESG000081921.1)

HSP 1 Score: 418.698 bits (1075), Expect = 3.065e-131
Identity = 229/235 (97.45%), Postives = 232/235 (98.72%), Query Frame = 1
Query:  331 FESVKGDKGKQGAGGLNGSDCECINNLRFDILXXXXXXXXXXXXXXXXXXXXXMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDGRTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLL 1035
            ++  KG KGKQGAGGLNGSDCECINNLRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDG+TLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLL
Sbjct:  527 YKGTKGYKGKQGAGGLNGSDCECINNLRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDGKTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLL 761          

HSP 2 Score: 282.337 bits (721), Expect = 6.227e-81
Identity = 132/133 (99.25%), Postives = 132/133 (99.25%), Query Frame = 1
Query: 2236 SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEDK 2634
            SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYE K
Sbjct:  768 SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEIK 900          
BLAST of Collagen alpha-1(XV) chain vs. Planmine SMEST
Match: SMESG000081921.1 (SMESG000081921.1)

HSP 1 Score: 418.698 bits (1075), Expect = 5.734e-131
Identity = 229/235 (97.45%), Postives = 232/235 (98.72%), Query Frame = 1
Query:  331 FESVKGDKGKQGAGGLNGSDCECINNLRFDILXXXXXXXXXXXXXXXXXXXXXMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDGRTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLL 1035
            ++  KG KGKQGAGGLNGSDCECINNLRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDG+TLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLL
Sbjct:  563 YKGTKGYKGKQGAGGLNGSDCECINNLRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDGKTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLL 797          

HSP 2 Score: 282.722 bits (722), Expect = 7.278e-81
Identity = 132/133 (99.25%), Postives = 132/133 (99.25%), Query Frame = 1
Query: 2236 SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEDK 2634
            SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYE K
Sbjct:  804 SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEIK 936          
BLAST of Collagen alpha-1(XV) chain vs. Planmine SMEST
Match: SMESG000081921.1 (SMESG000081921.1)

HSP 1 Score: 419.468 bits (1077), Expect = 6.550e-131
Identity = 229/235 (97.45%), Postives = 232/235 (98.72%), Query Frame = 1
Query:  331 FESVKGDKGKQGAGGLNGSDCECINNLRFDILXXXXXXXXXXXXXXXXXXXXXMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDGRTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLL 1035
            ++  KG KGKQGAGGLNGSDCECINNLRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDG+TLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLL
Sbjct:  586 YKGTKGYKGKQGAGGLNGSDCECINNLRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDGKTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLL 820          

HSP 2 Score: 283.108 bits (723), Expect = 7.969e-81
Identity = 132/133 (99.25%), Postives = 132/133 (99.25%), Query Frame = 1
Query: 2236 SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEDK 2634
            SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYE K
Sbjct:  827 SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEIK 959          
BLAST of Collagen alpha-1(XV) chain vs. Planmine SMEST
Match: SMESG000081921.1 (SMESG000081921.1)

HSP 1 Score: 419.468 bits (1077), Expect = 9.842e-131
Identity = 229/235 (97.45%), Postives = 232/235 (98.72%), Query Frame = 1
Query:  331 FESVKGDKGKQGAGGLNGSDCECINNLRFDILXXXXXXXXXXXXXXXXXXXXXMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDGRTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLL 1035
            ++  KG KGKQGAGGLNGSDCECINNLRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDG+TLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLL
Sbjct:  605 YKGTKGYKGKQGAGGLNGSDCECINNLRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCSCPVETSRGEGKIKTQSIVLNDGKTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQNHQTLL 839          

HSP 2 Score: 283.108 bits (723), Expect = 9.178e-81
Identity = 132/133 (99.25%), Postives = 132/133 (99.25%), Query Frame = 1
Query: 2236 SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEDK 2634
            SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYE K
Sbjct:  846 SSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEIK 978          
The following BLAST results are available for this feature:
BLAST of Collagen alpha-1(XV) chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-1(XV) chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-1(XV) chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-1(XV) chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-1(XV) chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-1(XV) chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-1(XV) chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-1(XV) chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D6FZH87.722e-130100.00Mp-3 (Fragment) OS=Schmidtea mediterranea OX=79327... [more]
A0A183LC575.232e-3342.39Endostatin domain-containing protein OS=Schistosom... [more]
A0A504X3V62.688e-3239.13Collagen alpha-1(XV) chain (Fragment) OS=Fasciola ... [more]
A0A183QKF96.590e-3241.30Endostatin domain-containing protein OS=Schistosom... [more]
A0A183JYN84.453e-3142.39Endostatin domain-containing protein OS=Schistosom... [more]
back to top
BLAST of Collagen alpha-1(XV) chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-1(XV) chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-1(XV) chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-1(XV) chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-1(XV) chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
col18a1a1.990e-624.86collagen type XVIII alpha 1 chain a [Source:ZFIN;A... [more]
back to top
BLAST of Collagen alpha-1(XV) chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081921.14.816e-13597.07SMESG000081921.1[more]
SMESG000081921.13.065e-13197.45SMESG000081921.1[more]
SMESG000081921.15.734e-13197.45SMESG000081921.1[more]
SMESG000081921.16.550e-13197.45SMESG000081921.1[more]
SMESG000081921.19.842e-13197.45SMESG000081921.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006777 ID=SMED30006777|Name=Collagen alpha-1(XV) chain|organism=Schmidtea mediterranea sexual|type=transcript|length=2903bp
ATACTACCTCTCAACCAACAACAACTACAGAATCTACAACAACCTTGCAG
CTAACAACAAGTACAAAATCTACTACTACCTCCCAACCAACAAAAACCCC
AGAATTTTCGACAACCTCGCAAAAAACAAGTACAGAATCTATTACTACCT
TGCAACAAACCACAACTAAAAAATCCACTACAACAGATACAGAATCTACA
GTAACTACTACAAAAGAACCAACAACTACAACTACTCAGCCCACTATATC
TACGAATGCGAATTTGTCAAATGATTCTTCTAATTTTTACAAAGGAACGA
AGGTAAGAACAAAATCTAACGGGCATAGATTTTGAAAGTGTCAAAGGAGA
CAAAGGAAAACAGGGCGCAGGTGGACTAAATGGTTCAGATTGTGAATGCA
TTAATAATTTAAGATTCGATATTCTTCAAAAAGGTGTTAAAGGAGAAAAG
GGTGGATATGGTCAACAAGGTGAAAGAGGAACTACTGGAATGCCTGGTAA
GGATGGAAAGTGTTTATTAAATCAGTGTAATTCATTGCCTCCAATAAAGG
GTACAAAGGGTGATCGAGGAGAAACTGGATATTGTTCATTAGATAATTGT
AAATCGAATATTATTATCGAAAAAGGAGTAAAAGGAGACAAAGGAGAGCA
GGGAATCAAAGAAGATAACGGTGATGGTCTAAAGATTTCAGATGTGCTTG
CTATTCTTGTACCAGAAATTAAGTCTTCAATCGATGATTATGTTTCAAGA
AATGTAATTAATATGAAAGGAGAACCTGGATCATGTTCTTGTCCAGTTGA
AACAAGCAGGGGAGAAGGGAAAATAAAGACACAATCGATAGTTTTAAATG
ATGGTAGAACATTGAAGTCTCTATCTTTCAATATGCCAGTCGGTCAGATG
GTGTTTTTAATCGTGGAAAATATTCTTTTAGTCAAAATTGACGATGTCAA
GAATCGATGGAGAATTGTAAAACTAGAAAGTGCTGAAAGTGATTGGTATT
TTGCTACTGAAACTCAGAATCATCAGACGTTACTGGTAAATCTAATGTCG
ATTTTATTATTTTATTGAAGCATTAATAAATATTTGTATTTATAGCCGTC
CAAGTGCAATTTGGCATCTTATGTAGTCATTTAAAAAGGATGCCTCGTTG
TAAAAGTAGGAGTGTTAAAAATGGTTCGAATAAGCTACGCAGAGCATATA
GAGATAATAATTTTGTGAACTTTTAGATATTTCGGGTTTAGGAAAATTGT
TAATGCACATTTATTTTATATACATTTTGTTGCAAGTGCGGAAATACTTT
TGAATTACAATAATTTTAGTGTTTAATTGTAAGATTTTATTCAACATGAA
GATTTAGAGTTTGGAAATGGAATAATTATGTCAAGATAGTGTTAATATTT
ACCTTTAAATAACATTATTTTAAAATTTAACACTTCTGACTTACTTTTTC
ATATTCACAAACAAACGAGGCGAAGTGAATGTTGTATTATGGATTTCTTT
TTCATGGACATGGTTAACCAATCATTCATGTGTCTTCAATGTCCAGAGAT
AATCTTTGATAAATTCTAGTAATGAAAAGCTGTGTTCCCATAATGGAACA
GTTAGATATTCCATTTTTGTTCATGTGACCAAAATATTGTCGATAAATTT
TTCCAATCGCCAAAATGAGTTATCGGGCAATAAAAATGGTATGGAATAAA
ATTAAAACCTTATCGAAAAACAAACGAAAAAAAATATTTGACAGATACAT
ATAAGTTTTTTGTTTATAATAATGACGACATTTGTTTAAATGTAAGTTTG
CATAGTTCTCAATCATATCTAGCTGCAAGACATAAAGAAGTTACATGTTT
GGTTACTAACCAAAAATGCAACTTCTTTATCTTGTCATAATTATTATATT
TCTGAATTCTAAATTTTCAATGGTTAGAAGCTGGTTGGCATATTGATTAT
TGACATGGAACAGAAGTTCCATTTTAGATAAACTAAAATTAATAATTGTT
TTTGTATTTATTTAAAATGTTTGTATTTTTTTTATTTGGCACCTATGTGA
CTTACTTATGTTGTCTATGCTAGTAGCTGGTTCAGCTTGTAATGCTTTTA
AAAGGCATTTTAAGGAAATATCGAAATTTGTATTTAAAATATTTTCTTGA
AAAATATTTTTTATTTACACGTTTTTAAATGCTGAAATATACAATTACAA
TTATTTTTAACATTTAGCCGACTTTTGGGCCAATATCATCAATGTTTAAC
ACTGCTTTTAAGTTAATGCTCATTGCTTTACCGAAACCAACTGGTGGAGA
TTTAAGATCAGACCAATTTGAACCTGGAGCATATTCAGGTTCAAGTTATC
TTTGTCAAAAACAAGCATATAACTATGGACTTGGTCGAGCATTTTACCCT
TTATTAAATACTGATATGTTTGACTTTAATTATTTATTGCCAGAAAAATA
TCGCTATGGTGTCCCAGTAGTAAACAGGAGAAATGAAAAGATTGCTTCAA
GTTTTACAGACTTATTAAAACCATCAGTAGAAATGCAAGCTAGTATACTT
GATTTTAGAGGTGACTCAATAATGTCAGAAATTAATGAACCATGTGTGTG
GATTGGCGAAAAACCATCGCTCTATGAGGATAAAAGTCCTACTGAAGAAG
GTTTGTGCTTAAATTGGATGTCTAAAAGTTCTAAAAACTCAGCCACTGTT
ACCTTTTTGAAATCTGACAAAGCACTTTTGAATTCTGGCCAGGTCAAATC
TAGACCATGTAACAGCATGTGTTATATTTTGTGTATGCAAATTTATCCGT
TAATGAGCGAGGTCCGTAAAAAATAAACGACGTTAACTATTACAACAAAA
TGCAAGTTTTTCATTTTGATCTCTAATTTAAGCTAGTAATTTTTGTATTG
TGA
back to top

protein sequence of SMED30006777-orf-1

>SMED30006777-orf-1 ID=SMED30006777-orf-1|Name=SMED30006777-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
TTSQPTTTTESTTTLQLTTSTKSTTTSQPTKTPEFSTTSQKTSTESITTL
QQTTTKKSTTTDTESTVTTTKEPTTTTTQPTISTNANLSNDSSNFYKGTK
VRTKSNGHRF*
back to top

protein sequence of SMED30006777-orf-2

>SMED30006777-orf-2 ID=SMED30006777-orf-2|Name=SMED30006777-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=195bp
MFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRA
FYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQA
SILDFRGDSIMSEINEPCVWIGEKPSLYEDKSPTEEGLCLNWMSKSSKNS
ATVTFLKSDKALLNSGQVKSRPCNSMCYILCMQIYPLMSEVRKK*
back to top

protein sequence of SMED30006777-orf-3

>SMED30006777-orf-3 ID=SMED30006777-orf-3|Name=SMED30006777-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=193bp
MPGKDGKCLLNQCNSLPPIKGTKGDRGETGYCSLDNCKSNIIIEKGVKGD
KGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDYVSRNVINMKGEPGSCS
CPVETSRGEGKIKTQSIVLNDGRTLKSLSFNMPVGQMVFLIVENILLVKI
DDVKNRWRIVKLESAESDWYFATETQNHQTLLVNLMSILLFY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR016186C-type_lectin-like/link_sf
IPR010515Collagenase_NC10/endostatin
IPR016187CTDL_fold
Vocabulary: cellular component
TermDefinition
GO:0031012extracellular matrix
GO:0005581collagen trimer
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity