Calpain-B

Overview
NameCalpain-B
Smed IDSMED30006773
Length (bp)2520
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calpain-B (SMED30006773) t-SNE clustered cells

Violin plots show distribution of expression levels for Calpain-B (SMED30006773) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calpain-B (SMED30006773) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calpain-B (SMED30006773) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006773

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30006773SMESG000039299.1 dd_Smed_v4_1752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006773SMESG000039299.1 dd_Smed_v4_1752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006773SMESG000039299.1 dd_Smed_v4_1752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006773SMESG000039299.1 dd_Smed_v4_1752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006773SMESG000039299.1 dd_Smed_v4_1752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30006773SMESG000039299.1 dd_Smed_v4_1752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006773SMESG000039299.1 dd_Smed_v4_1752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006773SMESG000039299.1 dd_Smed_v4_1752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006773SMESG000039299.1 dd_Smed_v4_1752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30006773SMESG000039299.1 dd_Smed_v4_1752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006773SMESG000039299.1 Contig40861uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006773SMESG000039299.1 Contig40861newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30006773SMESG000039299.1 dd_Smed_v6_1752_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30006773SMESG000039299.1 dd_Smed_v6_1752_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calpain-B vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 318/738 (43.09%), Postives = 467/738 (63.28%), Query Frame = 2
Query:  278 PVRPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSL----------RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN--LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE---NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            P +   + AG   P G   A +  +     VK             +  LY DP+FP    SL++SQ+ P +  WKRP EIC+NP FI +GA+R D+ QGELGDCW LAA+ACL+L+  L  +V+P DQ+F + +Y G+F F+FWR+G W +V++DD LPTYNN+LV+  S   NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGV EFF++ ++ P +++ IM KA  R SLMGCSI+   P + E ++  GL+ GHAYS+T +      +P K  K++L+R+RNPWG + EW GSWSD+  +W+++ + ++  +     +DGEFWMSY+DFI +F K+EIC+L   +L++D+L       W + +  G W +  +AGGCRNF DTFWTNPQ+R+K+++ D+D D++  + + ++ LMQK+ RK RK G   +TIG+AIY++  E   N+  L  ++F YN S A++ ++IN+REV  R +LPP  YVIVPST+EP+QE  F++R+FSEK N S E++   ++              PVP+   S  +  +    R  F QIAG D+EI A EL+ +LNT   K            + K  GF++E+ +SM+A+MD D SGKL   EF  LW  ++ W++ FK +D D+SG  NSYE+R  +N  GF L+N++ + + MR+A+K   + FD +I C VRL+ +F  + +   D       +   ++Q  MY 
Sbjct:   26 PAQSKATEAGGGNPSGIYSAIISRNFPIIGVKEKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIE-NYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI-RDAPSDMYKIMKKAIERGSLMGCSIDTIIPVQYETRMACGLVRGHAYSVTGLD----EVPFKGEKVKLVRLRNPWG-QVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSDKL-----QTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISV------------DRPVPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKH----------KDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA 729          
BLAST of Calpain-B vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 313/722 (43.35%), Postives = 462/722 (63.99%), Query Frame = 2
Query:  392 LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN--LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE---NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTA----MIPTESNPV--VSNTA--------------------------TPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            LY DP+FP    SL++SQ+ P +  WKRP EIC+NP FI +GA+R D+ QGELGDCW LAA+ACL+L+  L  +V+P DQ+F + +Y G+F F+FWR+G W +V++DD LPTYNN+LV+  S   NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGV EFF++ ++ P +++ IM KA  R SLMGCSI+   P + E ++  GL+ GHAYS+T +      +P K  K++L+R+RNPWG + EW GSWSD+  +W+++ + ++  +     +DGEFWMSY+DFI +F K+EIC+L   +L++D+L       W + +  G W +  +AGGCRNF DTFWTNPQ+R+K+++ D+D D++  + + ++ LMQK+ RK RK G   +TIG+AIY++  E   N+  L  ++F YN S A++ ++IN+REV  R +LPP  YVIVPST+EP+QE  F++R+FSEK N S E++   +    +   ++ P+  VS+ A                          +P P+   S  +  +    R  F QIAG D+EI A EL+ +LNT   K            + K  GF++E+ +SM+A+MD D SGKL   EF  LW  ++ W++ FK +D D+SG  NSYE+R  +N  GF L+N++ + + MR+A+K   + FD +I C VRL+ +F  + +   D       +   ++Q  MY 
Sbjct:   74 LYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIE-NYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI-RDAPSDMYKIMKKAIERGSLMGCSIDTIIPVQYETRMACGLVRGHAYSVTGLD----EVPFKGEKVKLVRLRNPWG-QVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSDKL-----QTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKH----------KDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA 773          
BLAST of Calpain-B vs. Ensembl Human
Match: CAPN9 (calpain 9 [Source:HGNC Symbol;Acc:HGNC:1486])

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 318/721 (44.11%), Postives = 459/721 (63.66%), Query Frame = 2
Query:  284 RPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            R  G  A     + R   S G S +    +   RG L+ED DFPA N SL++S+RP     WKRP EI +NPEFI  GA+R D+ QGELGDCWLLAA+A L+L+ +   +V+P DQ+F  P Y G+F F+FW+   W +V++DDRLPT+ ++LV++HS D NEFWSALLEKAYAK++GSYE+LKGGS  EA+EDFTGGV E F   KE P+N ++I+ KA  R SL+GC I+     ++EA+ P GLI GHAYS+T +  V+     +  +I+LIRIRNPWG + EW GSWSD SPEW  +  A++  +  T  DDGEFWM+++DF  +F+K+EIC+L P +LE D +      +WE+ +  G W +   AGGCRNFLDTFWTNPQ  +K+   ++D+ +   + ++ LMQKD RK ++ G    TIGYAIY+  D+++  L+ ++F+Y+ S A++ +FINLREV  R KLPPG Y+++PSTFEP+QEA F +RIFSEK   + ++D          N  +     P P       ++ Q    R  F Q+AG+D+E+ A EL+ +LN   +K       ++          S+ + K+++++MD   +GKL FDEFKV W  L+ W   F +FD DKSG  ++YELR  L + GF+LS+ +L  +V+R+A++E  + FDD++ C VRL+     +++    +K+    + + FI   M +
Sbjct:    6 RAPGPQAHPVPKDARITHSSGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSERPQIPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFG-PGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAETF-QTKEAPENFYEILEKALKRGSLLGCFIDTRSAAESEARTPFGLIKGHAYSVTGIDQVSF----RGQRIELIRIRNPWG-QVEWNGSWSDSSPEWRSVGPAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDALEEDAI-----HKWEVTVHQGSWVRGSTAGGCRNFLDTFWTNPQ--IKLSLTEKDEGQEECSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDKDEH-LNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMD---------GNVDIDLPEPPKPTPPDQETEEEQ--RFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKL----------SLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHLTMNI 690          
BLAST of Calpain-B vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 314/764 (41.10%), Postives = 461/764 (60.34%), Query Frame = 2
Query:  392 LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIE------------------------------------ADPR-------------KTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN--LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE---NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAM--------------------IPTESNPVVSNTA------TPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            LY DP+FP    SL++SQ+ P +  WKRP EIC+NP FI +GA+R D+ QGELGDCW LAA+ACL+L+  L  +V+P DQ+F + +Y G+F F+FWR+G W +V++DD LPTYNN+LV+  S   NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGV EFF+++ + P +++ IM KA  R SLMGCSI+                                     DPR             + E ++  GL+ GHAYS+T +      +P K  K++L+R+RNPWG + EW GSWSD+  +W+++ + ++  +     +DGEFWMSY+DFI +F K+EIC+L   +L++D+L       W + +  G W +  +AGGCRNF DTFWTNPQ+R+K+++ D+D D++  + + ++ LMQK+ RK RK G   +TIG+AIY++  E   N+  L  ++F YN S A++ ++IN+REV  R +LPP  YVIVPST+EP+QE  F++R+FSEK N S E++   ++                    +  ES      T+      +P P+   S  +  +    R  F QIAG D+EI A EL+ +LNT   K            + K  GF++E+ +SM+A+MD D SGKL   EF  LW  ++ W++ FK +D D+SG  NSYE+R  +N  GF L+N++ + + MR+A+K   + FD +I C VRL+ +F  + +   D       +   ++Q  MY 
Sbjct:   74 LYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIE-NYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEIR-DAPSDMYKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLNMGELIARMVRNMDNSLLQDSDLDPRGSDERPTRTIIPVQYETRMACGLVRGHAYSVTGLD----EVPFKGEKVKLVRLRNPWG-QVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSDKL-----QTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKH----------KDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA 815          
BLAST of Calpain-B vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 315/770 (40.91%), Postives = 464/770 (60.26%), Query Frame = 2
Query:  392 LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSI------------------------------------EADPR-------------KTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN--LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE---NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTA----MIPTESNPV--VSNTA--------------------------TPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            LY DP+FP    SL++SQ+ P +  WKRP EIC+NP FI +GA+R D+ QGELGDCW LAA+ACL+L+  L  +V+P DQ+F + +Y G+F F+FWR+G W +V++DD LPTYNN+LV+  S   NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGV EFF++ ++ P +++ IM KA  R SLMGCSI                                    + DPR             + E ++  GL+ GHAYS+T +      +P K  K++L+R+RNPWG + EW GSWSD+  +W+++ + ++  +     +DGEFWMSY+DFI +F K+EIC+L   +L++D+L       W + +  G W +  +AGGCRNF DTFWTNPQ+R+K+++ D+D D++  + + ++ LMQK+ RK RK G   +TIG+AIY++  E   N+  L  ++F YN S A++ ++IN+REV  R +LPP  YVIVPST+EP+QE  F++R+FSEK N S E++   +    +   ++ P+  VS+ A                          +P P+   S  +  +    R  F QIAG D+EI A EL+ +LNT   K            + K  GF++E+ +SM+A+MD D SGKL   EF  LW  ++ W++ FK +D D+SG  NSYE+R  +N  GF L+N++ + + MR+A+K   + FD +I C VRL+ +F  + +   D       +   ++Q  MY 
Sbjct:   74 LYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIE-NYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI-RDAPSDMYKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLNMGELIARMVRNMDNSLLQDSDLDPRGSDERPTRTIIPVQYETRMACGLVRGHAYSVTGLD----EVPFKGEKVKLVRLRNPWG-QVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSDKL-----QTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKH----------KDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA 821          
BLAST of Calpain-B vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 506.523 bits (1303), Expect = 1.477e-168
Identity = 254/475 (53.47%), Postives = 345/475 (72.63%), Query Frame = 2
Query:  389 KLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSL-EADQLGGKKKSR--WEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKD--ENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGEL 1798
            +L+EDP F A + SL+FS+RPP++++W RP EI + P+ I+EG SRFDV QGELGDCWLLAA A L+L  ELF +VVP DQ+F++ +Y G+F F+FW++G W +V++DDRLPT N +L+YMHS  +NEFWSALLEKAYAK+ GSYE+LKGG+TSEALED TGG+TEF D+K   P+NL  +M + F   SL GCSIEADP   EA++ NGL+ GHAYSIT  ++V+    G +G+  ++RIRNPWGNE EW G WSD S EW  +  + +  MGL FD DGEFWMS+ DF++NFEKMEIC+LGP  + E  Q+ G K +   W     +G W +   AGGCRN+++TF  NPQFRV++ D D DDD+ L T+I  ++QK  R  +++G++   IG+A+Y + +   N+G L   +F  N S  ++ +FINLRE+ GR ++PPG YV+VPSTFEPN+EA F++R+++    ES EL
Sbjct:  269 RLFEDPQFLANDSSLFFSKRPPKRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTE-NYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDLKNP-PRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVD----GPNGQTCILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDMNNAGNNRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 737          
BLAST of Calpain-B vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 506.523 bits (1303), Expect = 1.477e-168
Identity = 254/475 (53.47%), Postives = 345/475 (72.63%), Query Frame = 2
Query:  389 KLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSL-EADQLGGKKKSR--WEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKD--ENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGEL 1798
            +L+EDP F A + SL+FS+RPP++++W RP EI + P+ I+EG SRFDV QGELGDCWLLAA A L+L  ELF +VVP DQ+F++ +Y G+F F+FW++G W +V++DDRLPT N +L+YMHS  +NEFWSALLEKAYAK+ GSYE+LKGG+TSEALED TGG+TEF D+K   P+NL  +M + F   SL GCSIEADP   EA++ NGL+ GHAYSIT  ++V+    G +G+  ++RIRNPWGNE EW G WSD S EW  +  + +  MGL FD DGEFWMS+ DF++NFEKMEIC+LGP  + E  Q+ G K +   W     +G W +   AGGCRN+++TF  NPQFRV++ D D DDD+ L T+I  ++QK  R  +++G++   IG+A+Y + +   N+G L   +F  N S  ++ +FINLRE+ GR ++PPG YV+VPSTFEPN+EA F++R+++    ES EL
Sbjct:  269 RLFEDPQFLANDSSLFFSKRPPKRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTE-NYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDLKNP-PRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVD----GPNGQTCILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDMNNAGNNRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 737          
BLAST of Calpain-B vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 506.523 bits (1303), Expect = 1.477e-168
Identity = 254/475 (53.47%), Postives = 345/475 (72.63%), Query Frame = 2
Query:  389 KLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSL-EADQLGGKKKSR--WEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKD--ENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGEL 1798
            +L+EDP F A + SL+FS+RPP++++W RP EI + P+ I+EG SRFDV QGELGDCWLLAA A L+L  ELF +VVP DQ+F++ +Y G+F F+FW++G W +V++DDRLPT N +L+YMHS  +NEFWSALLEKAYAK+ GSYE+LKGG+TSEALED TGG+TEF D+K   P+NL  +M + F   SL GCSIEADP   EA++ NGL+ GHAYSIT  ++V+    G +G+  ++RIRNPWGNE EW G WSD S EW  +  + +  MGL FD DGEFWMS+ DF++NFEKMEIC+LGP  + E  Q+ G K +   W     +G W +   AGGCRN+++TF  NPQFRV++ D D DDD+ L T+I  ++QK  R  +++G++   IG+A+Y + +   N+G L   +F  N S  ++ +FINLRE+ GR ++PPG YV+VPSTFEPN+EA F++R+++    ES EL
Sbjct:  269 RLFEDPQFLANDSSLFFSKRPPKRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTE-NYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDLKNP-PRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVD----GPNGQTCILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDMNNAGNNRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 737          
BLAST of Calpain-B vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 505.368 bits (1300), Expect = 8.805e-168
Identity = 254/473 (53.70%), Postives = 344/473 (72.73%), Query Frame = 2
Query:  389 KLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSL-EADQLGGKKKS--RWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGEL 1798
            +L+EDP F A + SL+FS+RPP++++W RP EI + P+ I+EG SRFDV QGELGDCWLLAA A L+L  ELF +VVP DQ+F++ +Y G+F F+FW++G W +V++DDRLPT N +L+YMHS  +NEFWSALLEKAYAK+ GSYE+LKGG+TSEALED TGG+TEF D+K   P+NL  +M + F   SL GCSIEADP   EA++ NGL+ GHAYSIT  ++V+    G +G+  ++RIRNPWGNE EW G WSD S EW  +  + +  MGL FD DGEFWMS+ DF++NFEKMEIC+LGP  + E  Q+ G K +   W     +G W +   AGGCRN+++TF  NPQFRV++ D D DDD+ L T+I  ++QK  R  +++G++   IG+A+Y   + N+G L   +F  N S  ++ +FINLRE+ GR ++PPG YV+VPSTFEPN+EA F++R+++    ES EL
Sbjct:  294 RLFEDPQFLANDSSLFFSKRPPKRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTE-NYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDLKNP-PRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVD----GPNGQTCILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDAGN-NRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 759          
BLAST of Calpain-B vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 505.368 bits (1300), Expect = 1.550e-167
Identity = 254/473 (53.70%), Postives = 344/473 (72.73%), Query Frame = 2
Query:  389 KLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSL-EADQLGGKKKSR--WEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGEL 1798
            +L+EDP F A + SL+FS+RPP++++W RP EI + P+ I+EG SRFDV QGELGDCWLLAA A L+L  ELF +VVP DQ+F++ +Y G+F F+FW++G W +V++DDRLPT N +L+YMHS  +NEFWSALLEKAYAK+ GSYE+LKGG+TSEALED TGG+TEF D+K   P+NL  +M + F   SL GCSIEADP   EA++ NGL+ GHAYSIT  ++V+    G +G+  ++RIRNPWGNE EW G WSD S EW  +  + +  MGL FD DGEFWMS+ DF++NFEKMEIC+LGP  + E  Q+ G K +   W     +G W +   AGGCRN+++TF  NPQFRV++ D D DDD+ L T+I  ++QK  R  +++G++   IG+A+Y   + N+G L   +F  N S  ++ +FINLRE+ GR ++PPG YV+VPSTFEPN+EA F++R+++    ES EL
Sbjct:  315 RLFEDPQFLANDSSLFFSKRPPKRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTE-NYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDLKNP-PRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVD----GPNGQTCILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDAGN-NRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 780          
BLAST of Calpain-B vs. Ensembl Fly
Match: CalpB (gene:FBgn0025866 transcript:FBtr0076343)

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 345/699 (49.36%), Postives = 491/699 (70.24%), Query Frame = 2
Query:  356 DYNNVKNSL--RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQ--GPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMY 2440
            D+ ++++S    G ++EDPDFPA N SL +S+RP R  +W RP +I  +P+F  EG SRFDV+QGELGDCWLLAA A L+  S LF +V+P DQ+F + +Y G+F F+FW++G W EV++DDRLPTYN +L+YMHST+ NEFWSALLEKAYAK+ GSYE+LKGG+T EA+EDFTGGVTE++D+K E P NLF IM KA  R S+MGCS+E DP   EA+ P GLI GHAYSIT V +++I+ P + GK+ +IR+RNPWGN+AEW G WSD SPEW +I +  +  +GL FD DGEFWMS+QDF+ +F+++EIC+L P SL  DQ    ++ +WEM +  GEW   + AGGCRNFL+TFW NPQ+ + + DPD++DD+   T I+ LMQK+ R +R  G++  TIG+AIY L D +    P  +N+FKY  SVA++P FIN REVC R KLPPG Y+IVPSTF+PN+E  F++R+FSE  N   E D++     T+   +  +   P P++     DD Q +ALR+ F+ +AG D E+D  EL+ IL+ + +  +  +           DGFS +  +SMVAM+D D+SG+LGF+EF+ L TD+  W+  FK +D  ++G+ + + LR  LNS G+ L+N++LN+L  R+ ++EG + FDD+++C ++++T  E ++ +  D+ D A F+ D +++  +Y
Sbjct:  245 DFQSLRDSCLANGTMFEDPDFPATNASLMYSRRPDRYYEWLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQE-NYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDIK-EAPPNLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRR-KWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETRNNMEENDDEVGFGETDDR-IAPSLPPPTPKE----EDDPQRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVGS-----------DGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSREGQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLERTIY 924          
BLAST of Calpain-B vs. Ensembl Fly
Match: CalpB (gene:FBgn0025866 transcript:FBtr0304675)

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 345/699 (49.36%), Postives = 491/699 (70.24%), Query Frame = 2
Query:  356 DYNNVKNSL--RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQ--GPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMY 2440
            D+ ++++S    G ++EDPDFPA N SL +S+RP R  +W RP +I  +P+F  EG SRFDV+QGELGDCWLLAA A L+  S LF +V+P DQ+F + +Y G+F F+FW++G W EV++DDRLPTYN +L+YMHST+ NEFWSALLEKAYAK+ GSYE+LKGG+T EA+EDFTGGVTE++D+K E P NLF IM KA  R S+MGCS+E DP   EA+ P GLI GHAYSIT V +++I+ P + GK+ +IR+RNPWGN+AEW G WSD SPEW +I +  +  +GL FD DGEFWMS+QDF+ +F+++EIC+L P SL  DQ    ++ +WEM +  GEW   + AGGCRNFL+TFW NPQ+ + + DPD++DD+   T I+ LMQK+ R +R  G++  TIG+AIY L D +    P  +N+FKY  SVA++P FIN REVC R KLPPG Y+IVPSTF+PN+E  F++R+FSE  N   E D++     T+   +  +   P P++     DD Q +ALR+ F+ +AG D E+D  EL+ IL+ + +  +  +           DGFS +  +SMVAM+D D+SG+LGF+EF+ L TD+  W+  FK +D  ++G+ + + LR  LNS G+ L+N++LN+L  R+ ++EG + FDD+++C ++++T  E ++ +  D+ D A F+ D +++  +Y
Sbjct:  245 DFQSLRDSCLANGTMFEDPDFPATNASLMYSRRPDRYYEWLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQE-NYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDIK-EAPPNLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRR-KWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETRNNMEENDDEVGFGETDDR-IAPSLPPPTPKE----EDDPQRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVGS-----------DGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSREGQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLERTIY 924          
BLAST of Calpain-B vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0340532)

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 359/802 (44.76%), Postives = 484/802 (60.35%), Query Frame = 2
Query:  272 NVPVRPTGSHAGDAVPEGRGG---ASVGP---SQDYNNVKNSL--RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKD---ENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILN----------TAFKKGVTRAGMEVNPANFKFDGFSIETSKSMV--------------AMMDYDQSGKLG--------------FDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSV-------------------GFRLSNKI------LNSLVM-----RFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMY 2440
            N+ V+P  S +   +  G  G   +S+GP    QDY  + NS    G L+EDP FPA NESL FS+RP R I+W RPHEI +NP+F  EG SRFDV+QGELGDCWLLAA A L+  S LF +V+P++Q+F + +Y G+F FRFW++G W +V++DDRLPTYN +L+YMHST+ NEFWSALLEKAYAK+ GSYE+LKGGST EA+EDFTGGV+E++D+K E P NLF I+ KA  R S+MGCSIE DP  TEA+ P GLI GHAYSIT V +++I  P + GKI +IR+RNPWGNEAEW G WSD SPEW YI +  +  +GLTFD DGEFWMS+QDF+ +F+++EIC+L P SL  DQ    K+ +WEM +  GEW   + AGGCRNFLDTFW NPQ+ + +VDPDE+D+E   T+I+ LMQK+ R +R  G+E  TIG+AIY L D   EN+ P  +N+F+Y  SV ++P FIN REVC R KLPPG Y+IVPSTF+PN+E  F++R+FSE  N   E D+       +++ +     TP P        D Q   LR+ F+ IAG+D+E+D  EL+ IL+            F +       E   A    DG       S++               M D      +G               DE      D  + +      D DKSG     E    L+ +                   GF+L   +      LN+ V+     R+ +++G + FDD+I+C V++KT  + +K +  +  + A F  + +I+  +Y
Sbjct:   55 NMRVQPLQSQSNSTLYYGNLGEKSSSLGPYSEVQDYETILNSCLASGSLFEDPLFPASNESLQFSRRPDRHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEE-NYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDLK-EAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKR-KWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENR-PQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEENDDHVGY-GGKADTITPGFPTPKP-------IDPQKEGLRRLFDSIAGKDMEVDWMELKRILDHSMRDDLPKPVVFNRFSNNMAFETQAAGPGDDGAGACGLLSLICGPFLKGTPFEEQLGMNDQSNKRLIGDNPADGGPVTANAIVDETHGFSKD--VCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWIERTIY 842          
BLAST of Calpain-B vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0112869)

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 354/782 (45.27%), Postives = 475/782 (60.74%), Query Frame = 2
Query:  323 GRGGASVGP---SQDYNNVKNSL--RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKD---ENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILN----------TAFKKGVTRAGMEVNPANFKFDGFSIETSKSMV--------------AMMDYDQSGKLG--------------FDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSV-------------------GFRLSNKI------LNSLVM-----RFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMY 2440
            G   +S+GP    QDY  + NS    G L+EDP FPA NESL FS+RP R I+W RPHEI +NP+F  EG SRFDV+QGELGDCWLLAA A L+  S LF +V+P++Q+F + +Y G+F FRFW++G W +V++DDRLPTYN +L+YMHST+ NEFWSALLEKAYAK+ GSYE+LKGGST EA+EDFTGGV+E++D+K E P NLF I+ KA  R S+MGCSIE DP  TEA+ P GLI GHAYSIT V +++I  P + GKI +IR+RNPWGNEAEW G WSD SPEW YI +  +  +GLTFD DGEFWMS+QDF+ +F+++EIC+L P SL  DQ    K+ +WEM +  GEW   + AGGCRNFLDTFW NPQ+ + +VDPDE+D+E   T+I+ LMQK+ R +R  G+E  TIG+AIY L D   EN+ P  +N+F+Y  SV ++P FIN REVC R KLPPG Y+IVPSTF+PN+E  F++R+FSE  N   E D+       +++ +     TP P        D Q   LR+ F+ IAG+D+E+D  EL+ IL+            F +       E   A    DG       S++               M D      +G               DE      D  + +      D DKSG     E    L+ +                   GF+L   +      LN+ V+     R+ +++G + FDD+I+C V++KT  + +K +  +  + A F  + +I+  +Y
Sbjct:   60 GEKSSSLGPYSEVQDYETILNSCLASGSLFEDPLFPASNESLQFSRRPDRHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEE-NYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDLK-EAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKR-KWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENR-PQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEENDDHVGY-GGKADTITPGFPTPKP-------IDPQKEGLRRLFDSIAGKDMEVDWMELKRILDHSMRDDLPKPVVFNRFSNNMAFETQAAGPGDDGAGACGLLSLICGPFLKGTPFEEQLGMNDQSNKRLIGDNPADGGPVTANAIVDETHGFSKD--VCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWIERTIY 827          
BLAST of Calpain-B vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0086529)

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 354/782 (45.27%), Postives = 475/782 (60.74%), Query Frame = 2
Query:  323 GRGGASVGP---SQDYNNVKNSL--RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKD---ENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILN----------TAFKKGVTRAGMEVNPANFKFDGFSIETSKSMV--------------AMMDYDQSGKLG--------------FDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSV-------------------GFRLSNKI------LNSLVM-----RFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMY 2440
            G   +S+GP    QDY  + NS    G L+EDP FPA NESL FS+RP R I+W RPHEI +NP+F  EG SRFDV+QGELGDCWLLAA A L+  S LF +V+P++Q+F + +Y G+F FRFW++G W +V++DDRLPTYN +L+YMHST+ NEFWSALLEKAYAK+ GSYE+LKGGST EA+EDFTGGV+E++D+K E P NLF I+ KA  R S+MGCSIE DP  TEA+ P GLI GHAYSIT V +++I  P + GKI +IR+RNPWGNEAEW G WSD SPEW YI +  +  +GLTFD DGEFWMS+QDF+ +F+++EIC+L P SL  DQ    K+ +WEM +  GEW   + AGGCRNFLDTFW NPQ+ + +VDPDE+D+E   T+I+ LMQK+ R +R  G+E  TIG+AIY L D   EN+ P  +N+F+Y  SV ++P FIN REVC R KLPPG Y+IVPSTF+PN+E  F++R+FSE  N   E D+       +++ +     TP P        D Q   LR+ F+ IAG+D+E+D  EL+ IL+            F +       E   A    DG       S++               M D      +G               DE      D  + +      D DKSG     E    L+ +                   GF+L   +      LN+ V+     R+ +++G + FDD+I+C V++KT  + +K +  +  + A F  + +I+  +Y
Sbjct:   60 GEKSSSLGPYSEVQDYETILNSCLASGSLFEDPLFPASNESLQFSRRPDRHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEE-NYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDLK-EAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKR-KWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENR-PQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEENDDHVGY-GGKADTITPGFPTPKP-------IDPQKEGLRRLFDSIAGKDMEVDWMELKRILDHSMRDDLPKPVVFNRFSNNMAFETQAAGPGDDGAGACGLLSLICGPFLKGTPFEEQLGMNDQSNKRLIGDNPADGGPVTANAIVDETHGFSKD--VCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWIERTIY 827          
BLAST of Calpain-B vs. Ensembl Zebrafish
Match: capn9 (calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 315/690 (45.65%), Postives = 444/690 (64.35%), Query Frame = 2
Query:  383 RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIE-ADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKD--ENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            +GKL+EDPDFPAV+ SL++SQR P   +WKRP EIC+ P+FI+ GA+R D+ QG+LGDCWLLAA+A L+L  E  N+VVP+DQ F +  Y G+F F+FW+   W +V+VDDRLP   +KLV++HS D+NEFWSALLEKAYAK++GSYE+LKGGST EA+EDFTGGV E ++ K   P NLF I+ KA  R S++GCSI+     ++EAQ   GL+ GHAYS+T V+ VN     +  K+QLIR+RNPWG + EW G WSD S EW  I  +++  +     DDGEFWM + DF  N++K+EIC+L P +L  D        +W + +  G W +   AGGCRN++DTFWTNPQF++     + DD + L ++I+ LMQK+ R+ RKEG++  TIG+AIY+  D  ++QG    ++F+YN S A++ ++IN+REV  R +LPPG Y++VP+TF+P++EA FL+R+FSEK   + E+           N + ++   P          D +   LR+ F Q+AG D  I A ELQ +LN    +              KFDG S+ T  S++ +MD D SG + F EFKV W  L+ W   F  +D D+SG  +SYELR  LN+ G +L+N+IL  L +RFA+++  + FDDY+ C VRL+ +F  +++     K     +   F+   M V
Sbjct:   37 KGKLFEDPDFPAVDGSLFYSQRVPVNFEWKRPGEICKEPQFITGGATRTDICQGQLGDCWLLAAIASLTLKEETLNRVVPNDQTFDR-GYAGIFHFQFWQHNKWMDVVVDDRLPCVRDKLVFLHSADNNEFWSALLEKAYAKLNGSYEALKGGSTMEAMEDFTGGVGEMYETKNG-PNNLFLILKKAIERGSMLGCSIDITSSAESEAQTSTGLVKGHAYSVTGVEEVNY----RGAKVQLIRVRNPWG-QVEWNGPWSDNSREWTVIDSSEKKRLLQNSLDDGEFWMEFGDFKSNYDKVEICNLSPDALSDDV-----SKQWAVNLFEGSWIRGSTAGGCRNYIDTFWTNPQFKLH--LENPDDGDKLCSVIVALMQKNRRRLRKEGLDLETIGFAIYEAPDDQDHQGK---DFFRYNPSKARSRTYINVREVSERFRLPPGNYLLVPTTFQPHKEADFLIRLFSEKKAGAIEV----------GNKIEADLPEPPKPNPPEEETDEE-KGLRKLFEQVAGPDNVISARELQHVLNNVLGR----------RKEVKFDGLSLNTCISIINLMDVDGSGMMEFSEFKVFWDKLKKWIMLFLSYDVDRSGTMSSYELRSALNAAGMKLNNRILQLLGLRFADEKLEIDFDDYLTCIVRLENMFRIFQALDAQKKGEVSLNMHQFLLLTMNV 688          
BLAST of Calpain-B vs. Ensembl Zebrafish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 308/737 (41.79%), Postives = 455/737 (61.74%), Query Frame = 2
Query:  248 PAVIGDGSNVP--VRPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSLRGK--LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            P  +G G   P  +        +AV + R        +D+  +++    K  L+EDP FPA + SL++S++ P K++WKRP EIC+NP+FI  GA+R D+ QG+LGDCWLLAA+ACL+L+  +  +VVP DQ+F++ +Y G+F F+FWR+G W +V++DDRLPTY NKLV+  S  +NEFWSAL+EKAYAK+ GSYE+LKGG++ EA+EDFTGGVTEF+++  E PK L++IM KA  R SLMGC+I+   P     +  +GL+ GHAYS+T V+       GK   I+L+R+R+PWG         + KS +W  +++ +++   L   + GEFWM +++F KNF K+EIC+L P +LE DQ+      +W + +  G W K  +AGGCRNF DT+WTNPQFR+  V  + D  E   T+++ LMQK  R  R  G   + IG+AIY++K   Q  L  ++F YN S A++ S++N+REV  R  L PG YVI+PSTF+P++E+ FL+R+FSE  + S  +D +    P +    V N    +  K     +  +    R  F QIAG D+EI+A EL+ +LN    K              K +GFS+E+ +SM+A++D D +G L   EFK LW  ++ WK  F +FD DKS   +S+E+R  L   GF+L+N++ + + MR+AN+   + FD YI C VRL+ +F  +++   D       +   ++Q  MY 
Sbjct:   19 PQTVGSGFTAPGNIYSAILSRNEAVKDAR------RLKDFQELRDKYVRKKVLFEDPLFPAQDSSLFYSEKFPLKLEWKRPMEICKNPQFILGGANRTDICQGDLGDCWLLAAIACLTLNDVILKRVVPHDQSFTE-NYAGIFHFQFWRYGEWVDVVIDDRLPTYKNKLVFTRSGQNNEFWSALMEKAYAKLHGSYEALKGGNSLEAMEDFTGGVTEFYEI-TEAPKELYNIMRKALKRGSLMGCAIDTLVPTAQRTKTASGLVRGHAYSVTGVEQ-GKRKDGKDLMIRLVRVRDPWGVAP----PPACKSNDWVELAKTEQDKQRLQPGEQGEFWMCFEEFQKNFTKLEICNLTPDTLEDDQM-----FKWNVTVHEGRWVKGCSAGGCRNFPDTYWTNPQFRL--VLLEADAKEKTCTVVVALMQKGRRVERCSGATLHNIGFAIYEMKGNQQQQLSKDFFLYNASTARSKSYVNIREVTERFCLKPGEYVIIPSTFDPHKESEFLLRVFSENRSTSKVIDAEIEAEPMQ----VDNVKKKI--KPFEEEETEEEKQFRAIFQQIAGDDMEINANELRTVLNRVVAKH----------KELKTEGFSLESCRSMIALLDTDGTGHLNLQEFKHLWNKIKQWKLVFTRFDTDKSSTISSFEMRNALTEAGFQLNNQLYDIICMRYANEHMELDFDSYISCLVRLEGMFRAFRAFDKDGDGLIKLNVFEWLQLTMYA 719          
BLAST of Calpain-B vs. Ensembl Zebrafish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 308/741 (41.57%), Postives = 456/741 (61.54%), Query Frame = 2
Query:  248 PAVIGDGSNVP--VRPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSLRGK--LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQG----PLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            P  +G G   P  +        +AV + R        +D+  +++    K  L+EDP FPA + SL++S++ P K++WKRP EIC+NP+FI  GA+R D+ QG+LGDCWLLAA+ACL+L+  +  +VVP DQ+F++ +Y G+F F+FWR+G W +V++DDRLPTY NKLV+  S  +NEFWSAL+EKAYAK+ GSYE+LKGG++ EA+EDFTGGVTEF+++  E PK L++IM KA  R SLMGC+I+   P     +  +GL+ GHAYS+T V+       GK   I+L+R+R+PWG         + KS +W  +++ +++   L   + GEFWM +++F KNF K+EIC+L P +LE DQ+      +W + +  G W K  +AGGCRNF DT+WTNPQFR+  V  + D  E   T+++ LMQK  R  R  G   + IG+AIY++  E +G     L  ++F YN S A++ S++N+REV  R  L PG YVI+PSTF+P++E+ FL+R+FSE  + S  +D +    P +    V N    +  K     +  +    R  F QIAG D+EI+A EL+ +LN    K              K +GFS+E+ +SM+A++D D +G L   EFK LW  ++ WK  F +FD DKS   +S+E+R  L   GF+L+N++ + + MR+AN+   + FD YI C VRL+ +F  +++   D       +   ++Q  MY 
Sbjct:   19 PQTVGSGFTAPGNIYSAILSRNEAVKDAR------RLKDFQELRDKYVRKKVLFEDPLFPAQDSSLFYSEKFPLKLEWKRPMEICKNPQFILGGANRTDICQGDLGDCWLLAAIACLTLNDVILKRVVPHDQSFTE-NYAGIFHFQFWRYGEWVDVVIDDRLPTYKNKLVFTRSGQNNEFWSALMEKAYAKLHGSYEALKGGNSLEAMEDFTGGVTEFYEI-TEAPKELYNIMRKALKRGSLMGCAIDTLVPTAQRTKTASGLVRGHAYSVTGVEQ-GKRKDGKDLMIRLVRVRDPWGVAP----PPACKSNDWVELAKTEQDKQRLQPGEQGEFWMCFEEFQKNFTKLEICNLTPDTLEDDQM-----FKWNVTVHEGRWVKGCSAGGCRNFPDTYWTNPQFRL--VLLEADAKEKTCTVVVALMQKGRRVERCSGATLHNIGFAIYEVPKEMKGNQQQQLSKDFFLYNASTARSKSYVNIREVTERFCLKPGEYVIIPSTFDPHKESEFLLRVFSENRSTSKVIDAEIEAEPMQ----VDNVKKKI--KPFEEEETEEEKQFRAIFQQIAGDDMEINANELRTVLNRVVAKH----------KELKTEGFSLESCRSMIALLDTDGTGHLNLQEFKHLWNKIKQWKLVFTRFDTDKSSTISSFEMRNALTEAGFQLNNQLYDIICMRYANEHMELDFDSYISCLVRLEGMFRAFRAFDKDGDGLIKLNVFEWLQLTMYA 723          
BLAST of Calpain-B vs. Ensembl Zebrafish
Match: zgc:55262 (zgc:55262 [Source:ZFIN;Acc:ZDB-GENE-040426-2814])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 308/707 (43.56%), Postives = 437/707 (61.81%), Query Frame = 2
Query:  341 VGPSQDYNNVK------NSLRG------KLYEDPDFPAVNESLYFSQRPPRK-----IDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPR-KTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGP----LDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQT-AMIPTESNPVVSNTATPVPEKVVSPADDAQIMA-LRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDS 2389
             G  Q++N VK       +LR       +L+EDP F A + SL F++  PR      + W RP E+C  P+FI +GA+R D+ QG LGDCWLLAA+A L+L+  L ++VVP  Q+F    Y G+F F+FW+FG W +V++DDRLPT + KL+++HS +  EFWSALLEKAYAK++G YE+L GGST E  EDFTGGVTE +++KK  P +LF I+ +A  R SL+GCSI+   +   EA     L+ GHAYS+T  + V      +    +L+RIRNPWG E EW G+WSD S EW+ + ++ R  +     +DGEFWMS+ DF++ F ++EIC+L   +L+A Q+      +W     NGEW++   AGGCRN+  TFW NPQF+V +  PD        + ++ LMQKD RK+R+EG +  TIG+AIY++  E  G     L  ++F  + S A++  FINLREV  R +LP G Y+IVPSTFEPN+EA F++R+FSEKP  S E+D++  A IP E                    D++QI A  +  F Q+AG D+EI   ELQ ILN    K            + K DGF  E+ +SM+ +MD D SGKLG  EF VLW  ++ + + F+  D DKSG  +SYE+R  L + GF+L+N +   +++R+  ++  V FD+++ C VRL+T+F+T+KS   D+
Sbjct:   21 AGLGQNHNAVKFLGQDYETLRAQSQQSRRLFEDPMFTASSSSLGFNELGPRSSKTQGVRWMRPKEMCARPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQDFD-SRYAGIFHFQFWQFGEWVDVVIDDRLPTKDGKLLFVHSAEGGEFWSALLEKAYAKLNGCYEALSGGSTCEGFEDFTGGVTEMYELKK-APADLFSIIGRAIERGSLLGCSIDITSKFDMEAVTFKKLVKGHAYSVTGAEEVVY----RGNMTKLVRIRNPWG-EVEWTGAWSDNSREWDNVDRSVRGRLQ-NRSEDGEFWMSFSDFLREFTRLEICNLTADALQASQV-----KKWSTANYNGEWRRGSTAGGCRNYPATFWINPQFKVALKHPDSPGQSEC-SFLVALMQKDRRKKRREGQDMETIGFAIYEVPREFLGQSGVHLKRDFFLTHASSARSELFINLREVSSRFRLPAGEYIIVPSTFEPNKEADFVLRVFSEKPANSEEMDDKVMAEIPEEQR-----------------LDESQIDAGFKSLFRQLAGADMEISVTELQTILNRIIAK----------HKDLKTDGFGKESCRSMINLMDTDGSGKLGLVEFHVLWEKIKRYLQIFRDHDVDKSGTMSSYEMRKALETAGFKLNNHLFQLIILRYTEEDLSVDFDNFVSCLVRLETMFKTFKSLDTDA 686          
BLAST of Calpain-B vs. Ensembl Zebrafish
Match: capn3a (calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912-97])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 302/700 (43.14%), Postives = 450/700 (64.29%), Query Frame = 2
Query:  353 QDYNNVKNSLRGK--LYEDPDFPAVNESLYFSQ-----RPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNL--GTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE---NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPA-DDAQIMALRQSFNQIA------------GQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKS 2374
            QDY  +K     K  L+ED  FPA  +SL + +        + I WKRP EIC NP+FI  GASR D+ QG+LGDCWLLAA+ACL+L+ +L  +V+P +Q+FS+  Y G+F F+FWR+G W +V+VDDR+PT+NN+LV+  S + NEFWSALLEKAYAK+ GSYE+LKGG+T+E +EDFTGGVTEF++M KE PK L+ IM KA  R SLMGCSI++  P + E +   GL+ GHAYS+T V+    +   K  +++L+R+RNPWG + EW G WSD S EW  +S+A++  +     +DGEFWMS++DF KN+ K+EIC+L P +LE D+L      +W + +  G W +  +AGGCRN+ DTFWTNPQ+R+++++ D+D +++    T ++ LMQK+ RK RK G    TIG++IY++  E   N+  +   +F    + A++ ++INLREV  R +L PG YVI+PS++EP+QE  F++R+FSEK N S E++          N + ++   P P      + +D Q +++   F  IA            G ++E+ A EL+D+LN    K            +   + FS E  +SM+A+MD D +G+L   EF+ LW  ++ W+E FK++D D +   +SYE+R  +N  GFRL+N++ + + MR+AN+   V F+ +I C VRL+ +F  +++
Sbjct:   35 QDYTLLKQEYLQKKTLFEDETFPATVDSLGYKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNDKLLYRVIPQEQSFSE-QYAGIFHFQFWRYGDWVDVVVDDRIPTFNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTAEGMEDFTGGVTEFYEM-KEAPKELYKIMQKALERGSLMGCSIDSLVPARFETRTATGLVKGHAYSVTAVEECKQS-QQKESRVRLVRLRNPWG-QVEWNGPWSDNSKEWESLSKAEKEKLQQQNAEDGEFWMSFEDFKKNYTKIEICNLTPDALEDDKL-----HKWTVSVNEGRWVRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPEDDEVACTFVVALMQKNRRKERKLGANLLTIGFSIYEVPKEMHGNKQHMQKEFFMSTTAKARSRAYINLREVTQRFRLSPGEYVIIPSSYEPHQEGEFILRVFSEKRNTSEEIE----------NRIEADHPVPSPASTGEESEEDQQFLSI---FQHIAGDVSTGEAVSAWGSNMEVSANELKDVLNKVVSK----------HKDIHTESFSRECCRSMIALMDMDGTGRLNLQEFRQLWNKIKQWQEIFKRYDFDHNDTISSYEMRNAINDAGFRLNNQLYDIITMRYANESMNVDFESFISCLVRLEGMFRAFQA 702          
BLAST of Calpain-B vs. Ensembl Xenopus
Match: tgfbrap1 (transforming growth factor beta receptor associated protein 1 [Source:Xenbase;Acc:XB-GENE-1009020])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 320/699 (45.78%), Postives = 450/699 (64.38%), Query Frame = 2
Query:  359 YNNVKNSL--RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIE-ADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKS-QPHDSKDRAMFDQDTFIQCIMYV 2443
            Y  +KN    +G L+ED DFPA + SL++S++P     WKRP E+  +PEFI  GASR DV QG+LGDCWLLAA+A L+L+ ++  +VVP DQ+FS   Y G+F F+FW+   W +V++DDRLPT+ N+LV++HS D NEFWSALLEKAYAK++GSYE+LKGGST EA+EDFTGGVTE ++++   P NLFDI+ KA  + S++GCSI+     +TEA+ P GL+ GHAYSIT   +VN     K  K++LIRIRNPWG + EW G+WSD S EWN I  A++N +     DDGEFWM ++DF ++F+K+EIC+L P SL+ D      K +WE+ +  G W +   AGGCRNFL+TFW+NPQ  +K+   ++DD +   T I  LMQK+ RK RK G +  TIGY IYQ    ++  L  ++FK+N S A++ +++NLRE+  R KLPPG Y+ +P+TFEP+QEA F +RIFSEK  +  E+D +  +   +             E+             R  F QI+GQDLE+ A ELQ +LN   ++            N KF   S+ +  +++++MD   +GKLGFDEFK+ W  L+ W   F ++D DKSG  +SYELRL L S GF L+N +L  +V+R+A+ +  + FDD++ C VRL+  +  +K     D+ +    +Q  FI   M +
Sbjct:   29 YEQLKNDCLRKGVLFEDVDFPANDSSLFYSEKPSVPFVWKRPKEMVADPEFILGGASRTDVCQGDLGDCWLLAAIASLTLNDKILYRVVPPDQSFS-TGYAGIFHFQFWQHNEWLDVVIDDRLPTFRNRLVFVHSADLNEFWSALLEKAYAKLNGSYEALKGGSTLEAMEDFTGGVTETYEIRS-APANLFDILDKAIKKGSMLGCSIDITSSAETEAKTPQGLVKGHAYSITGADVVNF----KGQKVKLIRIRNPWG-QVEWNGAWSDNSSEWNIIGAAEKNRLSQASLDDGEFWMDFEDFKRHFDKLEICNLTPDSLDDD-----AKHKWEVTVHEGSWIRGSTAGGCRNFLETFWSNPQ--IKLSLTEQDDGQKECTFIAALMQKNRRKLRKTGADLLTIGYTIYQCPG-SESILSKDFFKFNPSKARSKTYVNLREISQRFKLPPGDYMFIPTTFEPHQEADFCLRIFSEKKADIKEMDGEVNIDLPDPPAPTPPHKETEEER-----------QFRTLFEQISGQDLEVSAEELQYVLNAVLRR----------TKNIKFKEMSLLSCNNIISLMDASGNGKLGFDEFKIFWDKLKTWIGIFMQYDLDKSGTMSSYELRLALKSAGFHLNNIVLQLIVLRYADDQFQIEFDDFLNCLVRLENSYRVFKQLNRSDTTETIQLNQAEFIALTMNI 691          
BLAST of Calpain-B vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 315/711 (44.30%), Postives = 459/711 (64.56%), Query Frame = 2
Query:  395 YEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN--LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQG---PLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELD---EQTAMIP-------TESNPVVS-NTATPVPEKVVSPADDAQIMA-----------LRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            ++D +FP    SL++SQ  P K +WKRP EIC+NP+FI  GA+R D+ QG+LGDCW LAA+ACL+L+ ++  +V+P DQNF+  +Y G+F F+FWR+G W +V++DD LPTYNN+LV+  S+  NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGVTEF+++ KE PK++++IM KAF R SL+GCSI+   P + E ++ NGL+ GHAYS+T V+   +    K   I+L+R+RNPWG + EW G+W D + EW  + ++++  +     +DGEFWMSY DF+KNF K EIC+L P +L++D L       W + +  G W +  +AGGCRN+ DT+WTNPQ+R+K+++ D+D  +N  + + ++ LMQK+ RK RK G   +TIG+AIY++  E  G    L  ++F YN S AK  S+IN+REVC R +LPP  YVI+PST+EP+QE  F++R+FSEK N S E++   E    IP       + SN  ++ + AT   +K +      +  A            R  F QIAG D+EI A ELQ +LN    K  T           K  GF++E+ +SM+A+MD D  G+L   EF  LW  ++ W++ F +FD D+SG  +S+E+R  +N  GF L+N++ + + MR+ANK   + FD +I C VRL+ +F  + +   D       +   ++Q  MY 
Sbjct:   66 FQDREFPPDESSLFYSQSFPIKFEWKRPPEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTD-NYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEL-KEAPKDMYNIMKKAFERGSLIGCSIDTLVPVQLETRMANGLVKGHAYSVTGVEETKL----KGKPIKLVRLRNPWG-QVEWNGAWGDNAKEWTMVDKSEKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSDSL-----QVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVALMQKNRRKDRKAGANLFTIGFAIYEVPKEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEEVENKIEAEKPIPIIFVSDRSNSNKELNVDGATDEDQKKMDAEKKDKTSASTDTETEEEKQFRNIFQQIAGDDMEISADELQSVLNNVVNKHKT----------LKSSGFTLESCRSMIALMDTDGCGRLNLQEFYHLWQKIKQWQKIFLRFDSDQSGTISSFEMRNAINEAGFHLNNQLYDIITMRYANKRMDLDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA 754          
BLAST of Calpain-B vs. Ensembl Xenopus
Match: tgfbrap1 (transforming growth factor beta receptor associated protein 1 [Source:Xenbase;Acc:XB-GENE-1009020])

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 319/694 (45.97%), Postives = 448/694 (64.55%), Query Frame = 2
Query:  359 YNNVKNSL--RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIE-ADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKS-QPHDSKDRAMFDQDTFIQ 2428
            Y  +KN    +G L+ED DFPA + SL++S++P     WKRP E+  +PEFI  GASR DV QG+LGDCWLLAA+A L+L+ ++  +VVP DQ+FS   Y G+F F+FW+   W +V++DDRLPT+ N+LV++HS D NEFWSALLEKAYAK++GSYE+LKGGST EA+EDFTGGVTE +++ +  P NLFDI+ KA  + S++GCSI+     +TEA+ P GL+ GHAYSIT   +VN     K  K++LIRIRNPWG + EW G+WSD S EWN I  A++N +     DDGEFWM ++DF ++F+K+EIC+L P SL+ D      K +WE+ +  G W +   AGGCRNFL+TFW+NPQ  +K+   ++DD +   T I  LMQK+ RK RK G +  TIGY IYQ    ++  L  ++FK+N S A++ +++NLRE+  R KLPPG Y+ +P+TFEP+QEA F +RIFSEK  +  E+D +  +   +             E+             R  F QI+GQDLE+ A ELQ +LN   ++            N KF   S+ +  +++++MD   +GKLGFDEFK+ W  L+ W   F ++D DKSG  +SYELRL L S GF L+N +L  +V+R+A+ +  + FDD++ C VRL+  +  +K     D+ +    +Q   IQ
Sbjct:   29 YEQLKNDCLRKGVLFEDVDFPANDSSLFYSEKPSVPFVWKRPKEMVADPEFILGGASRTDVCQGDLGDCWLLAAIASLTLNDKILYRVVPPDQSFS-TGYAGIFHFQFWQHNEWLDVVIDDRLPTFRNRLVFVHSADLNEFWSALLEKAYAKLNGSYEALKGGSTLEAMEDFTGGVTETYEI-RSAPANLFDILDKAIKKGSMLGCSIDITSSAETEAKTPQGLVKGHAYSITGADVVNF----KGQKVKLIRIRNPWG-QVEWNGAWSDNSSEWNIIGAAEKNRLSQASLDDGEFWMDFEDFKRHFDKLEICNLTPDSLDDD-----AKHKWEVTVHEGSWIRGSTAGGCRNFLETFWSNPQ--IKLSLTEQDDGQKECTFIAALMQKNRRKLRKTGADLLTIGYTIYQCPG-SESILSKDFFKFNPSKARSKTYVNLREISQRFKLPPGDYMFIPTTFEPHQEADFCLRIFSEKKADIKEMDGEVNIDLPDPPAPTPPHKETEEER-----------QFRTLFEQISGQDLEVSAEELQYVLNAVLRR----------TKNIKFKEMSLLSCNNIISLMDASGNGKLGFDEFKIFWDKLKTWIGIFMQYDLDKSGTMSSYELRLALKSAGFHLNNIVLQLIVLRYADDQFQIEFDDFLNCLVRLENSYRVFKQLNRSDTTETIQLNQAEVIQ 686          
BLAST of Calpain-B vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 315/755 (41.72%), Postives = 459/755 (60.79%), Query Frame = 2
Query:  395 YEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEAD---------------------------------------------PRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN--LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQG---PLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELD---EQTAMIP-------TESNPVVS-NTATPVPEKVVSPADDAQIMA-----------LRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            ++D +FP    SL++SQ  P K +WKRP EIC+NP+FI  GA+R D+ QG+LGDCW LAA+ACL+L+ ++  +V+P DQNF+  +Y G+F F+FWR+G W +V++DD LPTYNN+LV+  S+  NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGVTEF+++K E PK++++IM KAF R SL+GCSI+                                               P + E ++ NGL+ GHAYS+T V+   +    K   I+L+R+RNPWG + EW G+W D + EW  + ++++  +     +DGEFWMSY DF+KNF K EIC+L P +L++D L       W + +  G W +  +AGGCRN+ DT+WTNPQ+R+K+++ D+D  +N  + + ++ LMQK+ RK RK G   +TIG+AIY++  E  G    L  ++F YN S AK  S+IN+REVC R +LPP  YVI+PST+EP+QE  F++R+FSEK N S E++   E    IP       + SN  ++ + AT   +K +      +  A            R  F QIAG D+EI A ELQ +LN    K  T           K  GF++E+ +SM+A+MD D  G+L   EF  LW  ++ W++ F +FD D+SG  +S+E+R  +N  GF L+N++ + + MR+ANK   + FD +I C VRL+ +F  + +   D       +   ++Q  MY 
Sbjct:   66 FQDREFPPDESSLFYSQSFPIKFEWKRPPEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTD-NYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYELK-EAPKDMYNIMKKAFERGSLIGCSIDDKYGSSCGFAPPSNMEDAIMKMIESVGDTRPDTNGRGQPPKPVATLVPVQLETRMANGLVKGHAYSVTGVEETKL----KGKPIKLVRLRNPWG-QVEWNGAWGDNAKEWTMVDKSEKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSDSL-----QVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVALMQKNRRKDRKAGANLFTIGFAIYEVPKEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEEVENKIEAEKPIPIIFVSDRSNSNKELNVDGATDEDQKKMDAEKKDKTSASTDTETEEEKQFRNIFQQIAGDDMEISADELQSVLNNVVNKHKT----------LKSSGFTLESCRSMIALMDTDGCGRLNLQEFYHLWQKIKQWQKIFLRFDSDQSGTISSFEMRNAINEAGFHLNNQLYDIITMRYANKRMDLDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA 798          
BLAST of Calpain-B vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 329/810 (40.62%), Postives = 478/810 (59.01%), Query Frame = 2
Query:  275 VPVRPTGSHAGDAVPEGR----GGASVGP----SQDYNNVKNSLRGK--LYEDPDFPAVNESL---YFSQRPPR--KIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEAD---------------------------------------------PRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN--LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQG---PLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELD---EQTAMIP-------TESNPVVS-NTATPVPEKVVSPADDAQIMA-----------LRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            +P  P  S    A+ E       GA   P    +QD+  +K+   GK  L+EDP F    +SL    F+Q+  +   I WKRP EIC+NP+FI  GA+R D+ QG+LGDCW LAA+ACL+L+ ++  +V+P DQNF+  +Y G+F F+FWR+G W +V++DD LPTYNN+LV+  S+  NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGVTEF+++K E PK++++IM KAF R SL+GCSI+                                               P + E ++ NGL+ GHAYS+T V+   +    K   I+L+R+RNPWG + EW G+W D + EW  + ++++  +     +DGEFWMSY DF+KNF K EIC+L P +L++D L       W + +  G W +  +AGGCRN+ DT+WTNPQ+R+K+++ D+D  +N  + + ++ LMQK+ RK RK G   +TIG+AIY++  E  G    L  ++F YN S AK  S+IN+REVC R +LPP  YVI+PST+EP+QE  F++R+FSEK N S E++   E    IP       + SN  ++ + AT   +K +      +  A            R  F QIAG D+EI A ELQ +LN    K  T           K  GF++E+ +SM+A+MD D  G+L   EF  LW  ++ W++ F +FD D+SG  +S+E+R  +N  GF L+N++ + + MR+ANK   + FD +I C VRL+ +F  + +   D       +   ++Q  MY 
Sbjct:    1 MPFMPANSICDRAIRERERRNGDGALAKPVKFENQDFATLKSEFVGKKKLFEDPIFLPAVQSLGQKEFAQKSTKLKNIIWKRPKEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTD-NYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYELK-EAPKDMYNIMKKAFERGSLIGCSIDDKYGSSCGFAPPSNMEDAIMKMIESVGDTRPDTNGRGQPPKPVATLVPVQLETRMANGLVKGHAYSVTGVEETKL----KGKPIKLVRLRNPWG-QVEWNGAWGDNAKEWTMVDKSEKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSDSL-----QVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVALMQKNRRKDRKAGANLFTIGFAIYEVPKEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEEVENKIEAEKPIPIIFVSDRSNSNKELNVDGATDEDQKKMDAEKKDKTSASTDTETEEEKQFRNIFQQIAGDDMEISADELQSVLNNVVNKHKT----------LKSSGFTLESCRSMIALMDTDGCGRLNLQEFYHLWQKIKQWQKIFLRFDSDQSGTISSFEMRNAINEAGFHLNNQLYDIITMRYANKRMDLDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA 788          
BLAST of Calpain-B vs. Ensembl Mouse
Match: Capn3 (calpain 3 [Source:MGI Symbol;Acc:MGI:107437])

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 317/738 (42.95%), Postives = 465/738 (63.01%), Query Frame = 2
Query:  278 PVRPTGSHAGDAVPEGRGGASVGPSQDYNNVKN----SLRGK------LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEAD-PRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN--LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE---NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            P +   + AG   P G   A +  +     VK      LR K      LY DP+FP    SL++SQ+ P +  WKRP EIC+NP FI  GA+R D+ QG+LGDCW LAA+ACL+L+  L  +V+P DQ+F++ +Y G+F F+FWR+G W +V++DD LPTYNN+LV+  S   NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGVTEFF++ K+ P +++ IM KA  R SLMGCSI+   P + E ++  GL+ GHAYS+T ++        K  K++L+R+RNPWG + EW GSWSD   +W+++ + ++  +     +DGEFWMSY DF+ +F K+EIC+L   +LE+D+L       W + +  G W +  +AGGCRNF DTFWTNPQ+R+K+++ D+D +++  + + ++ LMQK+ RK RK G   +TIG+AIY++  E   N+  L  ++F YN S A++ ++IN+REV  R +LPP  YVIVPST+EP+QE  F++R+FSEK N S E +   ++              PVP    +  +  +    R  F QIAG D+EI A EL+++LNT   K            + K  GF++E+ +SM+A+MD D SG+L   EF  LW  ++ W++ FK +D D SG  NSYE+R  +N  GF L++++ + + MR+A+K   + FD +I C VRL+ +F  + +   D       +   ++Q  MY 
Sbjct:   26 PAQGKTTEAGGGHPSGIYSAIISRNFPIIGVKEKTFEQLRRKCLEKKVLYLDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTE-NYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEI-KDAPSDMYKIMRKAIERGSLMGCSIDTIVPVQYETRMACGLVKGHAYSVTGLEEALF----KGEKVKLVRLRNPWG-QVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADALESDKL-----QTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPEDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAENTISV------------DRPVPRPGHTDQESEEQQQFRNIFRQIAGDDMEICADELKNVLNTVVNKH----------KDLKTQGFTLESCRSMIALMDTDGSGRLNLQEFHHLWKKIKAWQKIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMYA 729          
BLAST of Calpain-B vs. Ensembl Mouse
Match: Capn9 (calpain 9 [Source:MGI Symbol;Acc:MGI:1920897])

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 309/687 (44.98%), Postives = 443/687 (64.48%), Query Frame = 2
Query:  386 GKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            G L+ED DFPA N SL++S+RP     WKRP EI + PEFI  GA+R D+ QGELGDCWLLAA+A L+L+ +   +VVP DQ F    Y G+F F+FW+   W +V++DDRLPT+ ++LV++HS D NEFWSALLEKAYAK++GSYE+LKGGS  EA+EDFTGGV E F + +E P++ F+I+ KA  R SL+GCSI+  +  ++EA+   GLI GHAY++T +  VN +      +I+LIR+RNPWG + EW G WSD SPEW  +   ++  +G T  DDGEFWM+++DF  +F+K+EIC+L P +LE   L      RWE+ I  G W +   AGGCRNFLDTFWTNPQ  +K+   + D+ +   T +  LMQKD R+ ++ G    TIGYAIYQ  D++ G L  ++F+Y+ S+A++ +FINLREV  R +LPPG Y+++PSTFEP+QEA F +RIFSEK   + +LDE   +   E           +P+      +  +    R  F ++AG+D+E+ A EL+ +LN   +K              KF   S+ + ++++++MD   +GKL F+EF+V W  L+ W + F +FD DKSG  +SYELR  L + GF+L   +L  +V+R+A+++  + FDDY+ C VRL+     ++S    +KD    + + FI   M +
Sbjct:   40 GTLFEDADFPASNVSLFYSERPQVPFVWKRPGEIVEKPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALTRVVPQDQGFGS-GYAGIFHFQFWQHSEWLDVVIDDRLPTFKDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAENFQI-REAPEDFFEILEKALKRGSLLGCSIDTLNASESEARTSLGLIKGHAYTVTGLDQVNFH----GQRIKLIRVRNPWG-QVEWNGPWSDSSPEWRSVDLEEQKRLGHTALDDGEFWMAFKDFKIHFDKVEICNLTPDALEDSAL-----HRWEVTIHQGSWVRGSTAGGCRNFLDTFWTNPQ--IKLSLTERDEGQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQCPDKD-GHLSRDFFRYHASLARSKTFINLREVSERFQLPPGDYILIPSTFEPHQEADFCLRIFSEKRAVTRDLDENIDIDLPE-----------LPKPTPQEEETEEEQQFRALFQRVAGEDMEVSAEELEYVLNAVLQKKTA----------LKFKRLSLLSCRNIISLMDTSGNGKLEFEEFRVFWDKLKHWMDLFLQFDVDKSGTMSSYELRTALKAAGFQLGGHLLQLIVLRYADEDLQLDFDDYLNCLVRLENASRVFQSLSVKNKDFIHLNINEFISLTMNI 690          
BLAST of Calpain-B vs. Ensembl Mouse
Match: Capn3 (calpain 3 [Source:MGI Symbol;Acc:MGI:107437])

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 307/694 (44.24%), Postives = 450/694 (64.84%), Query Frame = 2
Query:  392 LYEDPDFPAVNESL---YFSQRPPRK-IDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEAD-PRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN--LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE---NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            L+ED  FPA  ++L     SQ+   K I WKRP EIC+NP FI  GA+R D+ QG+LGDCW LAA+ACL+L+  L  +V+P DQ+F++ +Y G+F F+FWR+G W +V++DD LPTYNN+LV+  S   NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGVTEFF++ K+ P +++ IM KA  R SLMGCSI+   P + E ++  GL+ GHAYS+T ++        K  K++L+R+RNPWG + EW GSWSD   +W+++ + ++  +     +DGEFWMSY DF+ +F K+EIC+L   +LE+D+L       W + +  G W +  +AGGCRNF DTFWTNPQ+R+K+++ D+D +++  + + ++ LMQK+ RK RK G   +TIG+AIY++  E   N+  L  ++F YN S A++ ++IN+REV  R +LPP  YVIVPST+EP+QE  F++R+FSEK N S E +          N +  +   P P      +++ Q    R  F QIAG D+EI A EL+++LNT   K            + K  GF++E+ +SM+A+MD D SG+L   EF  LW  ++ W++ FK +D D SG  NSYE+R  +N  GF L++++ + + MR+A+K   + FD +I C VRL+ +F  + +   D       +   ++Q  MY 
Sbjct:   50 LFEDRVFPAGVQALGSHELSQKAKMKAITWKRPKEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTE-NYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEI-KDAPSDMYKIMRKAIERGSLMGCSIDTIVPVQYETRMACGLVKGHAYSVTGLEEALF----KGEKVKLVRLRNPWG-QVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADALESDKL-----QTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPEDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAE----------NTISVDRPVPRPGHTDQESEEQQ--QFRNIFRQIAGDDMEICADELKNVLNTVVNK----------HKDLKTQGFTLESCRSMIALMDTDGSGRLNLQEFHHLWKKIKAWQKIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMYA 709          
BLAST of Calpain-B vs. Ensembl Mouse
Match: Capn3 (calpain 3 [Source:MGI Symbol;Acc:MGI:107437])

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 307/712 (43.12%), Postives = 451/712 (63.34%), Query Frame = 2
Query:  392 LYEDPDFPAVNESL---YFSQRPPRK-IDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEAD-PRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN--LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE---NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKK------------------GVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            L+ED  FPA  ++L     SQ+   K I WKRP EIC+NP FI  GA+R D+ QG+LGDCW LAA+ACL+L+  L  +V+P DQ+F++ +Y G+F F+FWR+G W +V++DD LPTYNN+LV+  S   NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGVTEFF++ K+ P +++ IM KA  R SLMGCSI+   P + E ++  GL+ GHAYS+T ++        K  K++L+R+RNPWG + EW GSWSD   +W+++ + ++  +     +DGEFWMSY DF+ +F K+EIC+L   +LE+D+L       W + +  G W +  +AGGCRNF DTFWTNPQ+R+K+++ D+D +++  + + ++ LMQK+ RK RK G   +TIG+AIY++  E   N+  L  ++F YN S A++ ++IN+REV  R +LPP  YVIVPST+EP+QE  F++R+FSEK N S E +          N +  +   P P      +++ Q    R  F QIAG D+EI A EL+++LNT   K                    +         + K  GF++E+ +SM+A+MD D SG+L   EF  LW  ++ W++ FK +D D SG  NSYE+R  +N  GF L++++ + + MR+A+K   + FD +I C VRL+ +F  + +   D       +   ++Q  MY 
Sbjct:   50 LFEDRVFPAGVQALGSHELSQKAKMKAITWKRPKEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTE-NYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEI-KDAPSDMYKIMRKAIERGSLMGCSIDTIVPVQYETRMACGLVKGHAYSVTGLEEALF----KGEKVKLVRLRNPWG-QVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADALESDKL-----QTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPEDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAE----------NTISVDRPVPRPGHTDQESEEQQ--QFRNIFRQIAGDDMEICADELKNVLNTVVNKRERPTPDVGDGQGPQLSESSSSPFSIPPDKDLKTQGFTLESCRSMIALMDTDGSGRLNLQEFHHLWKKIKAWQKIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMYA 737          
BLAST of Calpain-B vs. Ensembl Mouse
Match: Capn3 (calpain 3 [Source:MGI Symbol;Acc:MGI:107437])

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 322/812 (39.66%), Postives = 471/812 (58.00%), Query Frame = 2
Query:  278 PVRPTGSHAGDAVPEGRGGASVGPSQDYNNVKN----SLRGK------LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIE------------------------------------ADPRKT-------------EAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN--LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE---NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTA--------------------------TPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            P +   + AG   P G   A +  +     VK      LR K      LY DP+FP    SL++SQ+ P +  WKRP EIC+NP FI  GA+R D+ QG+LGDCW LAA+ACL+L+  L  +V+P DQ+F++ +Y G+F F+FWR+G W +V++DD LPTYNN+LV+  S   NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGVTEFF++K + P +++ IM KA  R SLMGCSI+                                     DPR +             E ++  GL+ GHAYS+T ++        K  K++L+R+RNPWG + EW GSWSD   +W+++ + ++  +     +DGEFWMSY DF+ +F K+EIC+L   +LE+D+L       W + +  G W +  +AGGCRNF DTFWTNPQ+R+K+++ D+D +++  + + ++ LMQK+ RK RK G   +TIG+AIY++  E   N+  L  ++F YN S A++ ++IN+REV  R +LPP  YVIVPST+EP+QE  F++R+FSEK N S E +   ++        VS+ A                          TP P    +  +  +    R  F QIAG D+EI A EL+++LNT   K            + K  GF++E+ +SM+A+MD D SG+L   EF  LW  ++ W++ FK +D D SG  NSYE+R  +N  GF L++++ + + MR+A+K   + FD +I C VRL+ +F  + +   D       +   ++Q  MY 
Sbjct:   26 PAQGKTTEAGGGHPSGIYSAIISRNFPIIGVKEKTFEQLRRKCLEKKVLYLDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTE-NYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEIK-DAPSDMYKIMRKAIERGSLMGCSIDDGTNMTYGTSPSGLNMGELIARMVRNMDNSLLRDSDLDPRGSDDRPSRTIVPVQYETRMACGLVKGHAYSVTGLEEALF----KGEKVKLVRLRNPWG-QVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADALESDKL-----QTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPEDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAENTISVDRPVPIIFVSDRANSNKELGVDQEAEEGKDKAGPEKRGETPQPRPGHTDQESEEQQQFRNIFRQIAGDDMEICADELKNVLNTVVNKH----------KDLKTQGFTLESCRSMIALMDTDGSGRLNLQEFHHLWKKIKAWQKIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMYA 815          
BLAST of Calpain-B vs. UniProt/SwissProt
Match: sp|Q9VT65|CANB_DROME (Calpain-B OS=Drosophila melanogaster OX=7227 GN=CalpB PE=1 SV=2)

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 345/699 (49.36%), Postives = 491/699 (70.24%), Query Frame = 2
Query:  356 DYNNVKNSL--RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQ--GPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMY 2440
            D+ ++++S    G ++EDPDFPA N SL +S+RP R  +W RP +I  +P+F  EG SRFDV+QGELGDCWLLAA A L+  S LF +V+P DQ+F + +Y G+F F+FW++G W EV++DDRLPTYN +L+YMHST+ NEFWSALLEKAYAK+ GSYE+LKGG+T EA+EDFTGGVTE++D+K E P NLF IM KA  R S+MGCS+E DP   EA+ P GLI GHAYSIT V +++I+ P + GK+ +IR+RNPWGN+AEW G WSD SPEW +I +  +  +GL FD DGEFWMS+QDF+ +F+++EIC+L P SL  DQ    ++ +WEM +  GEW   + AGGCRNFL+TFW NPQ+ + + DPD++DD+   T I+ LMQK+ R +R  G++  TIG+AIY L D +    P  +N+FKY  SVA++P FIN REVC R KLPPG Y+IVPSTF+PN+E  F++R+FSE  N   E D++     T+   +  +   P P++     DD Q +ALR+ F+ +AG D E+D  EL+ IL+ + +  +  +           DGFS +  +SMVAM+D D+SG+LGF+EF+ L TD+  W+  FK +D  ++G+ + + LR  LNS G+ L+N++LN+L  R+ ++EG + FDD+++C ++++T  E ++ +  D+ D A F+ D +++  +Y
Sbjct:  245 DFQSLRDSCLANGTMFEDPDFPATNASLMYSRRPDRYYEWLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQE-NYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDIK-EAPPNLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRR-KWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETRNNMEENDDEVGFGETDDR-IAPSLPPPTPKE----EDDPQRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVGS-----------DGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSREGQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLERTIY 924          
BLAST of Calpain-B vs. UniProt/SwissProt
Match: sp|Q11002|CANA_DROME (Calpain-A OS=Drosophila melanogaster OX=7227 GN=CalpA PE=1 SV=2)

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 354/782 (45.27%), Postives = 475/782 (60.74%), Query Frame = 2
Query:  323 GRGGASVGP---SQDYNNVKNSL--RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKD---ENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILN----------TAFKKGVTRAGMEVNPANFKFDGFSIETSKSMV--------------AMMDYDQSGKLG--------------FDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSV-------------------GFRLSNKI------LNSLVM-----RFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMY 2440
            G   +S+GP    QDY  + NS    G L+EDP FPA NESL FS+RP R I+W RPHEI +NP+F  EG SRFDV+QGELGDCWLLAA A L+  S LF +V+P++Q+F + +Y G+F FRFW++G W +V++DDRLPTYN +L+YMHST+ NEFWSALLEKAYAK+ GSYE+LKGGST EA+EDFTGGV+E++D+K E P NLF I+ KA  R S+MGCSIE DP  TEA+ P GLI GHAYSIT V +++I  P + GKI +IR+RNPWGNEAEW G WSD SPEW YI +  +  +GLTFD DGEFWMS+QDF+ +F+++EIC+L P SL  DQ    K+ +WEM +  GEW   + AGGCRNFLDTFW NPQ+ + +VDPDE+D+E   T+I+ LMQK+ R +R  G+E  TIG+AIY L D   EN+ P  +N+F+Y  SV ++P FIN REVC R KLPPG Y+IVPSTF+PN+E  F++R+FSE  N   E D+       +++ +     TP P        D Q   LR+ F+ IAG+D+E+D  EL+ IL+            F +       E   A    DG       S++               M D      +G               DE      D  + +      D DKSG     E    L+ +                   GF+L   +      LN+ V+     R+ +++G + FDD+I+C V++KT  + +K +  +  + A F  + +I+  +Y
Sbjct:   60 GEKSSSLGPYSEVQDYETILNSCLASGSLFEDPLFPASNESLQFSRRPDRHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEE-NYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDLK-EAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKR-KWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENR-PQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEENDDHVGY-GGKADTITPGFPTPKP-------IDPQKEGLRRLFDSIAGKDMEVDWMELKRILDHSMRDDLPKPVVFNRFSNNMAFETQAAGPGDDGAGACGLLSLICGPFLKGTPFEEQLGMNDQSNKRLIGDNPADGGPVTANAIVDETHGFSKD--VCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWIERTIY 827          
BLAST of Calpain-B vs. UniProt/SwissProt
Match: sp|O35920|CAN9_RAT (Calpain-9 OS=Rattus norvegicus OX=10116 GN=Capn9 PE=2 SV=2)

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 311/687 (45.27%), Postives = 448/687 (65.21%), Query Frame = 2
Query:  386 GKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            G L+ED DFPA N SL++S+RP     WKRP EI +NPEFI  GA+R D+ QGELGDCWLLAA+A L+L+ +   +VVP DQ F    Y G+F F+FW+   W +V++DDRLPT+ ++LV++HS D NEFWSALLEKAYAK++GSYE+LKGGS  EA+EDFTGGV E F + +E P++ ++I+ KA  R SL+GCSI+  +  ++EA+ P GLI GHAY++T +  VN +      +I+LIR+RNPWG + EW G WSD SPEW  +S  ++  +G T  DDGEFWM+++DF  +F+K+EIC+L P +LE + L      +WE+ I  G W +   AGGCRNFLDTFWTNPQ  +K+   + D+ +   T +  LMQKD R+ ++ G    TIGYAIYQ  D++ G L+ ++F+Y+ S+A++ +FINLREV GR +LPPG Y+++PSTFEP+QEA F +RIFSEK   + +LDE   +   E           +P+      +  +    R  F +IAG+D+E+ A EL+ +LN   +K              KF   S+ + ++++++MD   +GK+ F+EF+V W  LR W + F +FD DKSG  +SYELR  L + GF+L + +L  +V+R+A++   + FDDY+ C VRL+     ++     +KD    + + FI   M +
Sbjct:   40 GTLFEDADFPASNSSLFYSERPQVPFVWKRPGEIVENPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVVPQDQGFGS-GYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAENFQI-REAPEDFYEILEKALRRGSLLGCSIDTLNASESEARTPLGLIKGHAYTVTGLDQVNFH----GQRIKLIRVRNPWG-QVEWNGPWSDSSPEWRSMSLEEQKRLGHTALDDGEFWMAFEDFKTHFDKVEICNLTPDALEDNTL-----HKWEVTIHQGSWVRGSTAGGCRNFLDTFWTNPQ--IKLSLTERDEGQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQCPDKD-GHLNRDFFRYHASLARSKTFINLREVSGRFQLPPGDYILIPSTFEPHQEADFCLRIFSEKKAVTQDLDENIDIDLPE-----------LPKPTPQEEETEEERQFRALFRRIAGEDMEVSAEELEYVLNAVLQKKTA----------LKFKRLSLLSCRNIISLMDTSGNGKMEFEEFRVFWDKLRYWMDLFLQFDVDKSGTMSSYELRTALKAAGFQLGSHLLQLIVLRYADENLQLDFDDYLNCLVRLENASRVFQCLSVKNKDFIHLNINEFINLTMNI 690          
BLAST of Calpain-B vs. UniProt/SwissProt
Match: sp|O14815|CAN9_HUMAN (Calpain-9 OS=Homo sapiens OX=9606 GN=CAPN9 PE=1 SV=1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 318/721 (44.11%), Postives = 459/721 (63.66%), Query Frame = 2
Query:  284 RPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            R  G  A     + R   S G S +    +   RG L+ED DFPA N SL++S+RP     WKRP EI +NPEFI  GA+R D+ QGELGDCWLLAA+A L+L+ +   +V+P DQ+F  P Y G+F F+FW+   W +V++DDRLPT+ ++LV++HS D NEFWSALLEKAYAK++GSYE+LKGGS  EA+EDFTGGV E F   KE P+N ++I+ KA  R SL+GC I+     ++EA+ P GLI GHAYS+T +  V+     +  +I+LIRIRNPWG + EW GSWSD SPEW  +  A++  +  T  DDGEFWM+++DF  +F+K+EIC+L P +LE D +      +WE+ +  G W +   AGGCRNFLDTFWTNPQ  +K+   ++D+ +   + ++ LMQKD RK ++ G    TIGYAIY+  D+++  L+ ++F+Y+ S A++ +FINLREV  R KLPPG Y+++PSTFEP+QEA F +RIFSEK   + ++D          N  +     P P       ++ Q    R  F Q+AG+D+E+ A EL+ +LN   +K       ++          S+ + K+++++MD   +GKL FDEFKV W  L+ W   F +FD DKSG  ++YELR  L + GF+LS+ +L  +V+R+A++E  + FDD++ C VRL+     +++    +K+    + + FI   M +
Sbjct:    6 RAPGPQAHPVPKDARITHSSGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSERPQIPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFG-PGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAETF-QTKEAPENFYEILEKALKRGSLLGCFIDTRSAAESEARTPFGLIKGHAYSVTGIDQVSF----RGQRIELIRIRNPWG-QVEWNGSWSDSSPEWRSVGPAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDALEEDAI-----HKWEVTVHQGSWVRGSTAGGCRNFLDTFWTNPQ--IKLSLTEKDEGQEECSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDKDEH-LNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMD---------GNVDIDLPEPPKPTPPDQETEEEQ--RFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKL----------SLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHLTMNI 690          
BLAST of Calpain-B vs. UniProt/SwissProt
Match: sp|Q9D805|CAN9_MOUSE (Calpain-9 OS=Mus musculus OX=10090 GN=Capn9 PE=2 SV=2)

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 309/687 (44.98%), Postives = 443/687 (64.48%), Query Frame = 2
Query:  386 GKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            G L+ED DFPA N SL++S+RP     WKRP EI + PEFI  GA+R D+ QGELGDCWLLAA+A L+L+ +   +VVP DQ F    Y G+F F+FW+   W +V++DDRLPT+ ++LV++HS D NEFWSALLEKAYAK++GSYE+LKGGS  EA+EDFTGGV E F + +E P++ F+I+ KA  R SL+GCSI+  +  ++EA+   GLI GHAY++T +  VN +      +I+LIR+RNPWG + EW G WSD SPEW  +   ++  +G T  DDGEFWM+++DF  +F+K+EIC+L P +LE   L      RWE+ I  G W +   AGGCRNFLDTFWTNPQ  +K+   + D+ +   T +  LMQKD R+ ++ G    TIGYAIYQ  D++ G L  ++F+Y+ S+A++ +FINLREV  R +LPPG Y+++PSTFEP+QEA F +RIFSEK   + +LDE   +   E           +P+      +  +    R  F ++AG+D+E+ A EL+ +LN   +K              KF   S+ + ++++++MD   +GKL F+EF+V W  L+ W + F +FD DKSG  +SYELR  L + GF+L   +L  +V+R+A+++  + FDDY+ C VRL+     ++S    +KD    + + FI   M +
Sbjct:   40 GTLFEDADFPASNVSLFYSERPQVPFVWKRPGEIVEKPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALTRVVPQDQGFGS-GYAGIFHFQFWQHSEWLDVVIDDRLPTFKDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAENFQI-REAPEDFFEILEKALKRGSLLGCSIDTLNASESEARTSLGLIKGHAYTVTGLDQVNFH----GQRIKLIRVRNPWG-QVEWNGPWSDSSPEWRSVDLEEQKRLGHTALDDGEFWMAFKDFKIHFDKVEICNLTPDALEDSAL-----HRWEVTIHQGSWVRGSTAGGCRNFLDTFWTNPQ--IKLSLTERDEGQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQCPDKD-GHLSRDFFRYHASLARSKTFINLREVSERFQLPPGDYILIPSTFEPHQEADFCLRIFSEKRAVTRDLDENIDIDLPE-----------LPKPTPQEEETEEEQQFRALFQRVAGEDMEVSAEELEYVLNAVLQKKTA----------LKFKRLSLLSCRNIISLMDTSGNGKLEFEEFRVFWDKLKHWMDLFLQFDVDKSGTMSSYELRTALKAAGFQLGGHLLQLIVLRYADEDLQLDFDDYLNCLVRLENASRVFQSLSVKNKDFIHLNINEFISLTMNI 690          
BLAST of Calpain-B vs. TrEMBL
Match: A0A1I8HRD3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 961.829 bits (2485), Expect = 0.000e+0
Identity = 452/691 (65.41%), Postives = 557/691 (80.61%), Query Frame = 2
Query:  377 SLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGG--KKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            S + +LYEDPDFPA  +S+++S++PPR  +WKRPHE+C NP F   GASRFDVRQGELGDCWLLAAVA LS+H +LF+ VVP DQ+F+   YCG+ RFRFW+FG W +VLVDDRLPTYNN+LV+MHSTDSNEFWSALLEKAYAK+ GSYE+LKGGS SEA+EDFTGG+TEF+D+++  P +LF  M KA  R SLMGCSIEADP + EAQL NGLIMGHAYSITDV+ V +N+ GK G +QL+RIRNPWGNEAEWKG+W D SPEW+ +S+ ++  MGL+FDDDGEFWMS+QDF  NF+K+EICHLGP SL  +QLG   K K RWE    N  W+KR++AGGCRN+LDTFWTNPQFRVKV+DPDEDDDEN G+II+GLMQK+MRK+R EG++ +TIGYAIY++KD +  PLD+ +FK   SVAKAP+FINLREVCGRHKL PGTYVIVPSTFEPNQEA FL+RI+SE  NESGE+D+ T +   +            P++  +  + AQ  AL+++F +IAG+D+E+DAYEL+DI+NTAF+K             FKFDGFS+ET +SMVA+MD DQSGKLGFDEFK LW DLRLWK  FKK+D DKSGNFNSYELR  LN+VGFR++NKI + LVMR+A +EG++ FDDY+LCCVRLKT+FET+K+QP D + +A F Q+ F+Q I+YV
Sbjct:   46 SSKKQLYEDPDFPAQPKSIFYSRQPPRPFEWKRPHELCDNPRFFVGGASRFDVRQGELGDCWLLAAVASLSMHPQLFDLVVPQDQDFTDADYCGVVRFRFWQFGEWTDVLVDDRLPTYNNRLVFMHSTDSNEFWSALLEKAYAKMMGSYEALKGGSASEAMEDFTGGITEFYDLRQSTPPSLFQTMVKANKRSSLMGCSIEADPNQIEAQLSNGLIMGHAYSITDVRTVEVNLRGKKGAVQLLRIRNPWGNEAEWKGAWGDSSPEWSILSEDEKKKMGLSFDDDGEFWMSFQDFCSNFQKLEICHLGPDSLNEEQLGAPDKNKRRWEALTHNSAWRKRVSAGGCRNYLDTFWTNPQFRVKVIDPDEDDDENKGSIIVGLMQKNMRKKRSEGLDLHTIGYAIYRIKDGDDRPLDLKFFKCTASVAKAPAFINLREVCGRHKLDPGTYVIVPSTFEPNQEAEFLLRIYSETKNESGEMDDVTTVEEVQ------------PDREPTAQEKAQEKALKEAFQKIAGEDMEVDAYELRDIVNTAFQK------------EFKFDGFSVETCRSMVALMDVDQSGKLGFDEFKTLWNDLRLWKTVFKKYDSDKSGNFNSYELRQALNAVGFRVNNKIFSCLVMRYATREGIIEFDDYVLCCVRLKTVFETFKAQPKDGQGKATFSQEEFLQTIIYV 712          
BLAST of Calpain-B vs. TrEMBL
Match: A0A267EIH1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019924g1 PE=3 SV=1)

HSP 1 Score: 961.444 bits (2484), Expect = 0.000e+0
Identity = 452/691 (65.41%), Postives = 557/691 (80.61%), Query Frame = 2
Query:  377 SLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGG--KKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            S + +LYEDPDFPA  +S+++S++PPR  +WKRPHE+C NP F   GASRFDVRQGELGDCWLLAAVA LS+H +LF+ VVP DQ+F+   YCG+ RFRFW+FG W +VLVDDRLPTYNN+LV+MHSTDSNEFWSALLEKAYAK+ GSYE+LKGGS SEA+EDFTGG+TEF+D+++  P +LF  M KA  R SLMGCSIEADP + EAQL NGLIMGHAYSITDV+ V +N+ GK G +QL+RIRNPWGNEAEWKG+W D SPEW+ +S+ ++  MGL+FDDDGEFWMS+QDF  NF+K+EICHLGP SL  +QLG   K K RWE    N  W+KR++AGGCRN+LDTFWTNPQFRVKV+DPDEDDDEN G+II+GLMQK+MRK+R EG++ +TIGYAIY++KD +  PLD+ +FK   SVAKAP+FINLREVCGRHKL PGTYVIVPSTFEPNQEA FL+RI+SE  NESGE+D+ T +   +            P++  +  + AQ  AL+++F +IAG+D+E+DAYEL+DI+NTAF+K             FKFDGFS+ET +SMVA+MD DQSGKLGFDEFK LW DLRLWK  FKK+D DKSGNFNSYELR  LN+VGFR++NKI + LVMR+A +EG++ FDDY+LCCVRLKT+FET+K+QP D + +A F Q+ F+Q I+YV
Sbjct:   46 SSKKQLYEDPDFPAQPKSIFYSRQPPRPFEWKRPHELCDNPRFFVGGASRFDVRQGELGDCWLLAAVASLSMHPQLFDLVVPQDQDFTDADYCGVVRFRFWQFGEWTDVLVDDRLPTYNNRLVFMHSTDSNEFWSALLEKAYAKMMGSYEALKGGSASEAMEDFTGGITEFYDLRQNTPPSLFQTMVKANKRSSLMGCSIEADPNQIEAQLSNGLIMGHAYSITDVQTVEVNLRGKKGAVQLLRIRNPWGNEAEWKGAWGDSSPEWSILSEDEKKKMGLSFDDDGEFWMSFQDFCSNFQKLEICHLGPDSLNEEQLGAPDKNKRRWEALTHNSAWRKRVSAGGCRNYLDTFWTNPQFRVKVIDPDEDDDENKGSIIVGLMQKNMRKKRSEGLDLHTIGYAIYRIKDGDDRPLDLKFFKCTASVAKAPAFINLREVCGRHKLDPGTYVIVPSTFEPNQEAEFLLRIYSETKNESGEMDDVTTVEEVQ------------PDREPTAQEKAQEKALKEAFQKIAGEDMEVDAYELRDIVNTAFQK------------EFKFDGFSVETCRSMVALMDVDQSGKLGFDEFKTLWNDLRLWKTVFKKYDSDKSGNFNSYELRQALNAVGFRVNNKIFSCLVMRYATREGIIEFDDYVLCCVRLKTVFETFKAQPKDGQGKATFSQEEFLQTIIYV 712          
BLAST of Calpain-B vs. TrEMBL
Match: A0A2R2MIP4 (calpain-A OS=Lingula unguis OX=7574 GN=LOC106156774 PE=3 SV=1)

HSP 1 Score: 918.302 bits (2372), Expect = 0.000e+0
Identity = 435/698 (62.32%), Postives = 545/698 (78.08%), Query Frame = 2
Query:  353 QDYNNVK-NSLR-GKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMY 2440
            Q++  +K   LR G+L+EDP+FPA+N+S+++S+ PPR   WKRPHE+C NP+    GASRFDV+QGELGDCWLLAA+A LSL+ EL ++VVP +Q+F+   Y G+F F+FWRFG W +V+VDDRLPTYNN+LV+MHS DSNEFWSA+LEKAYAK+ GSYE+LKGGST EA+EDFTGGVTE FD+++  P NLF IM KAF R SLMGCSIEA P + EA+L NGLIMGHAYSIT VKMV+I  P  +GKI LIRIRNPWGNEAEWKG+W DKSPEWN+IS+A+R  +GL FDDDGEFWMS++DF  NF+K+EIC+LGP +L  D+LG   K +WE   E G WK+R+NAGGCRN+LDTFWTNPQ+R+ V DPDEDDD+N  TII+GLMQKD RK++KEG++  T+GYAIY LKD + GPLD+ +FKYN S AK+PSFIN+REVCGRHKLPPG+Y I+PSTFEPNQE  FL+RIF+EK N +  +DE+T +   ++         P P+  V+P D+ Q   LR++F+++AG+D+EIDA+EL+D+LN AF +             FKFDGFS+ET +SMVAMMD DQSGKLGF+EF+ LW DLRLWK  FK+FD+D SG  NSYELR  LN+VG R+SN+  N+LVMRFA+K G + FDD+ILC VRLKT+F+T+ S   +    A F  D FIQ  MY
Sbjct:  116 QNFEELKAQCLREGRLFEDPEFPAINQSIFYSRAPPRPFQWKRPHELCSNPDLFVGGASRFDVQQGELGDCWLLAAIASLSLNKELLHKVVPPNQSFADGEYAGIFVFKFWRFGKWVDVVVDDRLPTYNNRLVFMHSADSNEFWSAMLEKAYAKLCGSYEALKGGSTCEAMEDFTGGVTEMFDLRQPQPPNLFQIMQKAFERSSLMGCSIEASPHQLEAELSNGLIMGHAYSITSVKMVDIKTPRMAGKIPLIRIRNPWGNEAEWKGAWGDKSPEWNFISEAERQEIGLQFDDDGEFWMSFKDFASNFQKLEICNLGPDALTEDELGTTSKKKWEASSEEGGWKRRVNAGGCRNYLDTFWTNPQYRISVTDPDEDDDDNTCTIIVGLMQKDRRKKKKEGLDLLTVGYAIYLLKDPDCGPLDLRFFKYNASFAKSPSFINMREVCGRHKLPPGSYAIIPSTFEPNQEGDFLLRIFTEKANTAAAIDEKTGISDVQN----GFPHKPGPQAPVTPQDEQQTQKLRETFHRVAGEDMEIDAHELRDVLNAAFMR------------EFKFDGFSMETCRSMVAMMDVDQSGKLGFEEFQKLWNDLRLWKSVFKQFDKDMSGTLNSYELRNALNNVGMRVSNQTFNALVMRFADKHGAIFFDDFILCAVRLKTMFDTFTSLDPNKTGAATFTLDQFIQTTMY 797          
BLAST of Calpain-B vs. TrEMBL
Match: A0A5J4NR82 (Calpain, invertebrate OS=Paragonimus westermani OX=34504 GN=DEA37_0012115 PE=3 SV=1)

HSP 1 Score: 905.59 bits (2339), Expect = 0.000e+0
Identity = 436/759 (57.44%), Postives = 567/759 (74.70%), Query Frame = 2
Query:  200 PIGSAKFQTPRSNVIKPAVIGDGSNVPVRPT--GSHAGDAVPEGRGGASVGPSQDYNNVKNSLR--GKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSR---WEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMD----YDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            P G  +F  PR    + A+    +N  V P   G  +   VP  RGG     S  Y+ +K  L+  G+L+EDP+FPAV+ SLY+S+ PPRK+DW RPH+IC NPEFI+ GASRFDVRQGELGDCWLLAA+ACLS+H  LF Q+VP DQ+F+   YCG+FRF FW +G WKEV+VDDRLPT    L+Y+HST+ NEFWSAL+EKAYAK+ GSYE+LKGG+TSEALEDFTGG+ E F+++ + P +L  IM K+  RCSLM CSI+ADP + EA+LPNGLIMGHAYS+T VK+VN++IPG+SG I L+R+RNPWGNEAEWKG+WSDKS EW+ +S A R  +G+TFDDDGEFWMSY+DF++NFEK+EICHLGPQS     LGG+ ++R   WEMC+E G WK R++AGGCRNFL+TFW NPQ+RV VVDPDE+DD+NLGT+I+GLMQK+ R  RK+G +  TIGYA+Y+L   + G LD+N+FKYN S A++P+FINLREVCGRHKL PG YVI+PSTF+PN+EA F++R+FSEKP  S ELDE              N     P   VS  ++ Q+ AL+++F ++AG+D EID  EL+DILN AF +            +FKFDGF++E+ +SMVAMMD    +D+S  L F+EFK LW  LRLWK AFKKFD D+SG  NS+ELR  L +VGF ++N I  +LVMRF+ ++G +LFDDY++CC RLKT+F+ Y S   +++D+A+FD+ +F+  ++Y+
Sbjct:   42 PTGIIQF--PRFKDPRVALRNAQNNKVVIPPDYGITSNKPVPSTRGGDLASTSLSYDQLKAQLQQQGRLFEDPEFPAVDGSLYYSRSPPRKVDWLRPHQICSNPEFITGGASRFDVRQGELGDCWLLAAIACLSMHKNLFEQIVPEDQSFTS-EYCGLFRFHFWHYGEWKEVVVDDRLPTVRGSLIYIHSTEKNEFWSALMEKAYAKLCGSYEALKGGTTSEALEDFTGGIAEMFELRDKCPPDLLKIMLKSQERCSLMACSIQADPNRIEAELPNGLIMGHAYSVTSVKVVNVSIPGRSGDIPLVRVRNPWGNEAEWKGAWSDKSREWSLLSDATRREVGITFDDDGEFWMSYEDFVRNFEKLEICHLGPQS-----LGGESETRGRHWEMCVEQGSWKPRVSAGGCRNFLETFWINPQYRVTVVDPDENDDDNLGTMIVGLMQKNRRCLRKQGEDLLTIGYAVYELPQTSGGTLDMNFFKYNASKARSPAFINLREVCGRHKLKPGNYVIIPSTFQPNEEADFMLRVFSEKPQTSEELDE--------------NVGVKDPIATVSTLNEQQVEALKRAFTKVAGEDGEIDCEELRDILNVAFTR------------DFKFDGFTLESCRSMVAMMDVSFAFDRSSMLSFEEFKNLWNLLRLWKTAFKKFDVDQSGCMNSFELRNALKAVGFSVNNAIFATLVMRFSRRDGSILFDDYVICCARLKTLFDIYASTSKNTEDKAVFDETSFVNTVLYM 766          
BLAST of Calpain-B vs. TrEMBL
Match: A0A4S2LH56 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007626 PE=3 SV=1)

HSP 1 Score: 905.205 bits (2338), Expect = 0.000e+0
Identity = 435/747 (58.23%), Postives = 558/747 (74.70%), Query Frame = 2
Query:  218 FQTPRSNVIKPAVIGDGSNVPVRP--TGSHAGDAVPEGRGGASVGPSQDYNNVKNSL--RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSL-EADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            F+ PR    + A+     N  V P   G  A   VP  RGGA    +Q Y+ +K  L  +G+L+EDP+FP ++ SLY+SQ PPR + W RPHEICQNPEFI+ GASRFDVRQG+LGDCWLLAA+ACLS+H ELF QVVP DQ F    YCG+FRF FWRFG WKEV+VDDRLPTY   L+Y+HST+ NEFWSAL+EKAYAK+ GSYE+LKGG+TSEALEDFTGG+ E F+++ + P +LF IM K+  RCSLM CSI+ADP + EA+L NGLIMGHAYS+T VKM++ +    + ++ L+R+RNPWG+EAEWKG+WSDKSPEWN I    R  +GLTF+DDGEFWMSY DFI NFEK+EICHLGPQSL  A +L G+K   WEMC+E+G W  R++AGGCRNFL+TFW NPQF V +VDPDEDDD N GT+IIGLMQK  RK RK+G +  TIGYAIY L + + G LD+N+FKYN S A++P+FINLREVCGRHKLPPG Y I+PSTF+PN+EA F++RIF+E P  S E+D+  A   T        + T     ++ P ++AQ+ AL+++F ++AG D EID+ EL+DILN AF +G        +   FKFDGF++E+ +SM++MMD+D+SG L F+EFK LW  LRLWK AFKKFD DKSG  NS+ELR  L +VGF ++N I N+LVMRFA ++G + FDDY++CC RL+T+FE +K+ P  ++ RA+FD+  F+  ++Y+
Sbjct:   35 FKFPRFEDPRIALRKAKDNKVVLPFDAGETAKKPVPVTRGGALASTTQSYDELKVQLLQQGRLFEDPEFPPLDSSLYYSQPPPRPVQWLRPHEICQNPEFITGGASRFDVRQGQLGDCWLLAAIACLSMHKELFEQVVPGDQTFGS-GYCGLFRFHFWRFGEWKEVVVDDRLPTYGKSLIYIHSTEKNEFWSALMEKAYAKLCGSYEALKGGTTSEALEDFTGGIAEMFELRSKCPPDLFKIMLKSQERCSLMACSIQADPNRYEARLANGLIMGHAYSVTSVKMIDTHT---ARQVTLVRVRNPWGDEAEWKGAWSDKSPEWNQIPAETRQLVGLTFEDDGEFWMSYTDFISNFEKLEICHLGPQSLGGAGELPGRK---WEMCVEHGSWVPRVSAGGCRNFLETFWINPQFSVNLVDPDEDDDVNEGTMIIGLMQKHRRKLRKQGEDLLTIGYAIYALPESHSGTLDMNFFKYNASKARSPAFINLREVCGRHKLPPGRYAIIPSTFQPNEEAEFMLRIFAEHPQTSEEIDDAVAAADT--------SDTGDKNALIQPLNEAQVEALKRAFTKVAGVDGEIDSEELRDILNVAFTRG-------SDAQYFKFDGFTLESCRSMISMMDFDRSGMLSFNEFKTLWNLLRLWKTAFKKFDVDKSGCMNSFELRNALKAVGFSINNSIFNTLVMRFARRDGSIAFDDYVICCARLQTLFEIFKASPKTTEGRAIFDETNFVNTLLYM 759          
BLAST of Calpain-B vs. Ensembl Cavefish
Match: zgc:55262 (calpain-1 catalytic subunit-like [Source:NCBI gene;Acc:103042634])

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 314/712 (44.10%), Postives = 451/712 (63.34%), Query Frame = 2
Query:  353 QDYNNVK-NSLRGK-LYEDPDFPAVNESLYFSQRPPRK-----IDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPR-KTEAQLPNGLIMGHAYSITDV-KMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGP----LDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQ-TAMIPTESNPVVSNTATPVPEKVVSPADDAQIMA-LRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            QDY  +K   L+ + L+ED  FPA + SL F++  PR      + WKRP EIC  P+FI +GA+R D+ QG LGDCWLLAA+A L+L+  L ++VVP  Q+F    Y G+F F+FW+FG W +V++DDRLP  + KL+++HS +  EFWSAL+EKAYAK++G YE+L GGSTSE  EDFTGGVTE +++KK  P +L++I+ +A  R SL+GCSI+   +   EA     L+ GHAYS+T V ++V    P K     L+RIRNPWG E EW G+WSD S EW+ +  + R  + +   +DGEFWMS++DF++ F ++EIC+L   +LEA Q+      +W  C+ NGEW++   AGGCRNF  TFW NPQF+V +  PD+    +  + ++ LMQKD RK+RKEG +  TIG+AIY++  +  G     L  ++F  N S A++  FINLREV  R +LP G Y+IVPSTFEP +EA F++R+FSEKP  + ELD+  TA +P+E+                   D++QI A  +  F Q+AG D+EI   ELQ ILN    K            + K DGF  E  +SM+ +MD D SGKLG  EF VLW  ++ +   F++FD DKSG  +SYE+R+ L + GF+L+N +   +++R+  ++  V FD+++ C VRL+T+F+T+K+   D+      + + +I   M+ 
Sbjct:   35 QDYEMLKARCLQSRSLFEDSLFPASSSSLGFNELGPRSSKTQGVQWKRPPEICSRPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQSFGS-GYAGIFHFQFWQFGEWMDVVIDDRLPVKDGKLLFVHSAEGGEFWSALVEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYELKK-APSDLYNIIQRAVDRGSLLGCSIDITSKFDMEAVTFKKLVKGHAYSVTAVHEVVYRGTPTK-----LVRIRNPWG-EVEWTGAWSDNSREWDSVDSSSRARLQVR-SEDGEFWMSFRDFLQEFSRLEICNLTADALEAGQV-----KKWSTCLYNGEWRRGSTAGGCRNFPATFWLNPQFKVNLTHPDKAGSSDC-SFLVALMQKDRRKKRKEGKDMETIGFAIYEVPGQYVGQSGVHLKRDFFLTNASSARSELFINLREVSSRFRLPAGEYIIVPSTFEPQKEADFVLRVFSEKPASAEELDDDVTAELPSENQ-----------------LDESQIDAGFKSLFRQLAGSDMEISVTELQTILNRIISK----------HKDLKTDGFGPEACRSMINLMDTDGSGKLGLTEFHVLWEKIKRYLTVFRQFDLDKSGTMSSYEMRMALEAAGFKLTNHLFQLIILRYTEEDLTVDFDNFVTCLVRLETMFKTFKTLDTDADGFISLNFNQWITLTMFA 704          
BLAST of Calpain-B vs. Ensembl Cavefish
Match: zgc:55262 (calpain-1 catalytic subunit-like [Source:NCBI gene;Acc:103042634])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 302/688 (43.90%), Postives = 431/688 (62.65%), Query Frame = 2
Query:  353 QDYNNVK-NSLRGK-LYEDPDFPAVNESLYFSQRPPRK-----IDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPR-KTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQ-TAMIPTESNPVVSNTATPVPEKVVSPADDAQIMA-LRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQ------SGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETY 2368
            QDY  +K   L+ + L+ED  FPA + SL F++  PR      + WKRP EIC  P+FI +GA+R D+ QG LGDCWLLAA+A L+L+  L ++VVP  Q+F    Y G+F F+FW+FG W +V++DDRLP  + KL+++HS +  EFWSAL+EKAYAK++G YE+L GGSTSE  EDFTGGVTE +++KK  P +L++I+ +A  R SL+GCSI+   +   EA     L+ GHAYS+T V  V    P K     L+RIRNPWG E EW G+WSD S EW+ +  + R  + +   +DGEFWMS++DF++ F ++EIC+L   +LEA Q+      +W  C+ NGEW++   AGGCRNF  TFW NPQF+V +  PD+    +  + ++ LMQKD RK+RKEG +  TIG+AIY+   ++   L  ++F  N S A++  FINLREV  R +LP G Y+IVPSTFEP +EA F++R+FSEKP  + ELD+  TA +P+E+                   D++QI A  +  F Q+AG D+EI   ELQ ILN    K                     E S S+  ++ +D+      SGKLG  EF VLW  ++ +   F++FD DKSG  +SYE+R+ L + GF+L+N +   +++R+  ++  V FD+++ C VRL+T+F  +
Sbjct:   35 QDYEMLKARCLQSRSLFEDSLFPASSSSLGFNELGPRSSKTQGVQWKRPPEICSRPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQSFG-SGYAGIFHFQFWQFGEWMDVVIDDRLPVKDGKLLFVHSAEGGEFWSALVEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYELKK-APSDLYNIIQRAVDRGSLLGCSIDITSKFDMEAVTFKKLVKGHAYSVTAV--VYRGTPTK-----LVRIRNPWG-EVEWTGAWSDNSREWDSVDSSSRARLQVR-SEDGEFWMSFRDFLQEFSRLEICNLTADALEAGQV-----KKWSTCLYNGEWRRGSTAGGCRNFPATFWLNPQFKVNLTHPDKAGSSDC-SFLVALMQKDRRKKRKEGKDMETIGFAIYEYVGQSGVHLKRDFFLTNASSARSELFINLREVSSRFRLPAGEYIIVPSTFEPQKEADFVLRVFSEKPASAEELDDDVTAELPSENQ-----------------LDESQIDAGFKSLFRQLAGSDMEISVTELQTILNRIISKR--------------------EFSDSLYCLIFFDRCIQTDGSGKLGLTEFHVLWEKIKRYLTVFRQFDLDKSGTMSSYEMRMALEAAGFKLTNHLFQLIILRYTEEDLTVDFDNFVTCLVRLETMFSKW 668          
BLAST of Calpain-B vs. Ensembl Cavefish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 291/688 (42.30%), Postives = 446/688 (64.83%), Query Frame = 2
Query:  392 LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN---LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            L++DP FPA + SLY++Q+ P K+ WKRP EIC+NP+FI  GA+R D+ QG+LGDCWLLAA+ACL+L   L  +VVP+DQ+FS+ +Y G+F F+FWR+G W +V+VDDRLPT NN LV+  S + NEFWSALLEKAYAK+ G+YE+LKGG+T EA+EDFTGGVTEF+++  + P+ +++IM KA +R SLMGCSI++  P  +E +   GL+ GHAYS+T V+       G   +I+L+R+R+PWG         S  S +W+ ++ ++++   L   + GEFWM +++F + F K+EIC+L P +L+ D+L      +W++ +  G W +  +AGGCRN+ DTFWTNPQ+R+++ + D+D+ ++     T+++ LMQK  R+ R  G    TIG+AIY++   N+  L  ++F Y  S A+  S+INLREV  R  L PG YVIVPSTF+PN E+ F++R+FSEK + S     + +    E++P V      +P+     +   +    R  F QIAG D++I+A EL+ + N    K              K +GFS+++ +SM+A+MD D +G+L  +EFK LW+ ++ WK  F ++D+DKS + +S+E+R  +   GF+L+ ++ + + MR+A++   + FD YI C VRL+ +F  +K+   D       +   ++Q  MY 
Sbjct:   79 LFKDPLFPADDSSLYYNQKFPLKLVWKRPSEICKNPQFIVGGANRTDICQGDLGDCWLLAAIACLTLSETLLYRVVPADQSFSE-NYAGIFHFQFWRYGEWVDVVVDDRLPTSNNHLVFTRSGNKNEFWSALLEKAYAKLHGTYEALKGGNTLEAMEDFTGGVTEFYEI-SDAPREIYNIMKKALNRGSLMGCSIDSLVPSASETKTDTGLVRGHAYSVTAVEQ-GKQEDGSDTRIRLVRLRDPWGVAP----PPSRMSCDWSSLATSEQDQQRLKPVEAGEFWMGFEEFQQTFTKLEICNLTPDALQDDEL-----LKWDVSVNEGRWVRGCSAGGCRNYPDTFWTNPQYRLRLTEEDDDEPDHGEKGCTVVVALMQKGRRRERCTGGTLLTIGFAIYEMHG-NKQHLPKDFFLYTASKARCKSYINLREVTERFCLSPGEYVIVPSTFDPNNESDFILRVFSEKTSTS-----ELSGAVIEADPCV------LPKSEDEES--DEEKQFRAMFQQIAGDDMQINAKELRSVFNKLLTK----------YKGLKTEGFSLDSCRSMIALMDTDGTGRLNLEEFKHLWSKIQQWKLIFSRYDRDKSSSISSFEMRNAVADAGFQLNPQLHDIIAMRYASEHLYLDFDSYICCLVRLEGMFRAFKAFDIDGDGIIKLNSLEWLQLTMYA 730          
BLAST of Calpain-B vs. Ensembl Cavefish
Match: capn1a (calpain-1 catalytic subunit-like [Source:NCBI gene;Acc:103024720])

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 286/689 (41.51%), Postives = 445/689 (64.59%), Query Frame = 2
Query:  350 SQDYNNVKNSLR--GKLYEDPDFPAVNESLYFSQRPPRK-----IDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPR-KTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQ-LIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNL--GTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDI----NYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYK 2371
            +QD+  +K      G L+EDP FPA   SL F +  P       ++W RP E+C +P+FI  GA+R D+ QG LGDCWLLAA+A L+L+ +L ++VVP  Q+F +  Y G+F F+FW+FG W ++++DDRLP  + +L+++HS + NEFWSAL+EKAYAK++GSYE+L GGST+E  EDFTGGV+E ++++K  P++L+ I+ KA    SL+GCSI+       EA     L+ GHAYS+T ++ VN       G +Q LIRIRNPWG + EW G+WSD S EW+ I   +R  + L   +DGEFWMS+ +F++ F ++EIC+L P +L  D L     S W     +G W++   AGGCRN  +TFW NPQ+++ +++ D+D +++    + ++ L+QKD R+ R++G + +TIG+A+Y++ +E +G  ++    N+F  + S A++ +FINLREV  R +LPPG Y+IVPSTFEP++EA F++R+F+EK +E+ ELD++ +    +   +  +                   + +  F Q+AG+D+EI  +EL+ ILN             +   + K DGFS+E+ ++MV +MD D S +LG  EF++LW  +R W   +++FD DKSG  +SYE+RL + S GF+L+N++   LV R+A  E ++ FD++I C V+L+ +F +++
Sbjct:   32 NQDFEELKQECVEGGFLFEDPCFPAEPPSLGFKELGPHSSKTSGVEWMRPTELCDDPQFILGGATRTDICQGALGDCWLLAAIASLTLNEKLLHRVVPHGQSF-QDDYAGIFHFQFWQFGEWVDIVIDDRLPVKDGELMFVHSAEGNEFWSALIEKAYAKLNGSYEALSGGSTTEGFEDFTGGVSEMYELRKP-PRDLYRIISKALELGSLLGCSIDITSTFDMEAVTFKKLVKGHAYSVTGLRQVNFR-----GDLQRLIRIRNPWG-QVEWTGAWSDNSSEWDEIDPTEREDLCLQM-EDGEFWMSFNEFLRQFSRLEICNLTPDALSDDGL-----SHWNTIQFHGSWRRGSTAGGCRNHPNTFWINPQYKITLLEEDDDPEDDEVACSFLVALLQKDRRRYRRQGQDMHTIGFAVYEIPEEFRGCQNVHLKKNFFLSHSSCARSETFINLREVSARLRLPPGEYLIVPSTFEPSKEADFVLRVFTEKQSETEELDDEISADLEDEEEITEDDID---------------DSFKSMFAQLAGEDMEISVHELRTILNRVV----------LRHKDLKTDGFSMESCRTMVNLMDKDGSARLGLVEFQILWNKIRKWLVIYRQFDLDKSGTMSSYEMRLAVESAGFKLNNRLNQILVARYAENE-VIDFDNFICCLVKLEAMFRSFQ 680          
BLAST of Calpain-B vs. Ensembl Cavefish
Match: si:dkeyp-50d11.2 (si:dkeyp-50d11.2 [Source:ZFIN;Acc:ZDB-GENE-091113-22])

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 300/710 (42.25%), Postives = 438/710 (61.69%), Query Frame = 2
Query:  353 QDYNNVKNSL--RGKLYEDPDFPAVNESLYFSQRPP-----RKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADP-RKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQG----PLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGEL-DEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            QD+ +++ S     +L+ED  FPA   SL F +  P     R + W RP E C +P FI +GA+R D+ QG LGDCWLLAA+ACL+L+  L ++VVP  Q+F    Y G+F F+FW+FG W +V++DDRLP  + KL+++HS +  EFWSAL+EKAYAK++G YE+L GG TSE  EDFTGGVTE ++++K  P NLF I+ +A  R SL+GCSI+       EA     L+ GHAYS+T V  V      +    +LIRIRNPWG E EW G+WSD+S EW+ I+ A R+ +     +DGEFWMS+ DF+K F ++EIC+L   +L++ +L      +W   +  GEW++   AGGCRN+  TFW NPQ+++ + DPD +  +   + ++ LMQK+ R+ R+EG +  TIG+AIY++  +  G     L  ++F  N S A++  FINLREV  R  LP G Y+IVPSTFEP +E  F++R+FSEK  +S EL DE TA +P E           +PE  +    D    AL   F ++AG+D+EID  +LQ ILN    K            + K DGF  E  + M+++MD    G+LG  +F VLW  ++ +   F++FD DKSG  +SYE+RL L S GF+L+N +   +++R+A  +  V FD+++ C +RL+++F+T+++   D+     F+   +I   M+ 
Sbjct:   35 QDFESLRASCLQSRRLFEDETFPAQPSSLGFKELAPGSAKTRGVRWMRPTEFCDDPHFIVDGATRTDICQGALGDCWLLAAIACLTLNEPLLHRVVPHGQSFHY-QYAGIFHFQFWQFGDWVDVVIDDRLPVRDGKLLFVHSDEGAEFWSALVEKAYAKLNGCYEALSGGCTSEGFEDFTGGVTEMYELRK-APPNLFSIIRRAVERGSLLGCSIDITSFFDMEAVTFKKLVKGHAYSVTGVDEVEF----RGNLTKLIRIRNPWG-EVEWTGAWSDESREWSGINPALRSRLH-NRAEDGEFWMSFSDFLKEFSRLEICNLTADALQSSEL-----KKWNSSLYTGEWRRGSTAGGCRNYPATFWINPQYKIMLKDPDTEGQDGC-SFLVALMQKNRRQLRREGKDMETIGFAIYEVPLQFLGMAGVHLKRDFFLTNTSSARSELFINLREVSSRFCLPAGEYIIVPSTFEPQKEGDFVLRVFSEKAADSQELDDELTADLPEED---------ALPESEI----DEGFKAL---FAKLAGKDMEIDVPKLQMILNRVISK----------HKDLKTDGFGKEACRCMISLMDTSGCGRLGLTDFHVLWEKIKRYLTIFREFDLDKSGTMSSYEMRLALESAGFKLTNNLFQLIILRYAKPDLNVDFDNFVTCLIRLESMFKTFRTMDTDADGVVTFNFIQWISLTMFT 704          
BLAST of Calpain-B vs. Ensembl Sea Lamprey
Match: capn3a (calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912-97])

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 325/772 (42.10%), Postives = 465/772 (60.23%), Query Frame = 2
Query:  392 LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIE---------------------------------------ADPRK------TEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN--LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGP---LDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELD---------------------------EQTAMIPTESNPVVSN--TATPVPEKVVSP---------ADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            L+EDPDFPA N S+YFSQ  P +  W RP E+C  P  I   A+   + +G+LGDCW+LAA+AC++++ EL  +V+P+ Q+F + +Y G+F F+FWRFG W +V+VDDRLPT+NN+LV++ S + NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGVTE+F+MK   PK+L+ IM KA SR SLMGCSI+                                       A  RK       E++ P GL+  HAYSIT +  V      +S  +QL+R+RNPWG+  EW G WSD S EWN I+ +++  + L   +DGEFW+S+QDF +NF K+EIC+L P     D L   + ++W + +  G W +  +AGGCRN+ DTFWTNPQ+R+++ D D+D D+N  L + I+ LMQK+ RK R++G    TIG+AIY++ +E +G    L  ++F YN S A+  S+INLREV  R +LPPG YVIVPSTFE +QE  FL+R+F+EK N S E+D                           +Q    P ES P   N   + P   K+  P          +D Q   +   F Q+AG D+E+ A +L +ILN    K            + K  GFS+E+ ++MVA+MD D SGKLG+++FK LW  L+ W++ F+K+D DKSG+  SYE+RL +N  G++L+N++   + +R A++   + FD++I C +RL+ +F  +K+   D       +   ++Q  MY 
Sbjct:   66 LFEDPDFPAHNNSIYFSQNAPMQFQWMRPKELCV-PRSIVIEANHTHICEGDLGDCWVLAAIACMTMNEELLARVIPAGQSFEE-NYAGIFHFQFWRFGEWVDVVVDDRLPTFNNQLVFVQSAERNEFWSALLEKAYAKVHGSYEALKGGNTTEAMEDFTGGVTEYFEMKNP-PKDLYKIMVKATSRRSLMGCSIDDGMCWRCGVPAPDSIGLVRSNMSPPILRHIQLTPIGIEDAKKRKIAMLTHAESRTPMGLVRNHAYSITGLDEVK----HRSKIVQLVRLRNPWGH-VEWIGPWSDASKEWNEITPSEKQRLQLISAEDGEFWISFQDFCRNFTKLEICNLSP-----DALADDRTNKWTVSVSEGRWVRGCSAGGCRNYPDTFWTNPQYRLQLYDEDDDPDDNELLCSFIVALMQKNRRKERRQGSTMLTIGFAIYEVTEELRGSREHLPKDFFLYNASRARCNSYINLREVTERFRLPPGEYVIVPSTFEAHQEGEFLLRVFAEKHNVSEEMDDIIGVKKKSKKKKNKPIVFISDRTKKGQQQPESPDESEPEDGNEEESEPKSNKLAEPENPKEPDLTPEDKQFKTI---FKQLAGDDMEVGAADLHNILNKVITKH----------KDLKTSGFSLESCRTMVALMDTDLSGKLGYNDFKYLWDKLKFWQQIFRKYDSDKSGSMTSYEMRLAINEAGYQLNNQLYQIITLRHADENLNIGFDNFIACLIRLEAMFRAFKAFDKDGDGIIRLNVLEWLQLTMYA 811          
BLAST of Calpain-B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003998.1 (pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 gene:ENSPMAG00000003440.1 transcript:ENSPMAT00000003998.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 317/755 (41.99%), Postives = 436/755 (57.75%), Query Frame = 2
Query:  470 KRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIE--------ADPRKT-----------------------------------------------EAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQF--RVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQL---KDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNES-GE----------------------------------LDEQTA--MIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            + P EIC NP+FI  GA+R D++QG LGDCWLLAA+A L+LH  L  +VVP  Q+FS   Y G+F F+FW+FG W +V++DD LPT NNKL ++HSTD NEFWSALLEKAYAK++GSYE+LKGGS +EA+EDFTGGV EF+++KK  P +L+ IM K   + S+MGCSI+        + PR                                                 EA+LPNGL+ GHAYSIT +  V      +   ++L+RIRNPWG E EW G+WSD S EW  +  ++R  +     +DGEFWMS+ DF +NF KMEIC+L P +L   Q G +    W +    G W +   AGGCRN+  TFWTNPQF  R+   D D DDDE   + I+ LMQK+MR+++++     TIGYAIY++          L   +F  N S A++ +FINLREV  R +LPPG YVIVPST+EP+QEA FL+R++ EK N S GE                                  +DE  A  ++ + S  V       +P +VV   +D +     Q F ++AG+D+EI   ELQD+LN    K      ++V    FK DGFS+   +SMVA+MD D SGKLG  EFK+LW  +++W+  F+K+D+D+SG  +SYE+R  LN+ GF L+N++   + MR+A++   + F+DYI C VRL+ +F  + +   D +         ++Q  MY 
Sbjct:    1 RAPQEICYNPQFIVNGATRTDIKQGALGDCWLLAAIASLTLHPRLLARVVPEGQSFSD-GYAGIFHFQFWQFGEWVDVVIDDLLPTQNNKLAFLHSTDRNEFWSALLEKAYAKLNGSYEALKGGSIAEAMEDFTGGVFEFYNLKK-APPDLYRIMRKGLEKASMMGCSIDEGSTFKYRSTPRAINMSKMTATFRAWSSGIRRFAERFLPSRLGHARLLASSGIEITSMFDLEARLPNGLVKGHAYSITGLDQVFF----EGQDVRLVRIRNPWG-EVEWNGAWSDNSWEWRVVDVSERRRLEQVRAEDGEFWMSFSDFKRNFSKMEICNLSPDTLRT-QSGSR---HWTVTAHEGRWLRGCTAGGCRNYAGTFWTNPQFHLRLHEEDDDPDDDEVACSFIVALMQKNMRRQKRD---LLTIGYAIYEIPLKAPPGCTHLPGEFFVRNSSRARSHNFINLREVSDRFRLPPGHYVIVPSTYEPHQEADFLLRVYCEKMNRSRGETKHNSVSKGRPIFRGAFKQVSNLGGCGGPNCYRVVDEHIADEILKSNSERVGEAVQPSMPVEVVETDEDRRFT---QVFKKLAGEDMEISPRELQDLLNKVTAK------LKV----FKSDGFSLYACQSMVALMDSDGSGKLGLPEFKLLWEKIKMWQAIFRKYDEDRSGTMSSYEMRAALNAAGFHLNNQMYQLITMRYADESMTIKFNDYITCMVRLEAMFRIFHALDKDKRGVIRLGLGLWLQLTMYA 728          
BLAST of Calpain-B vs. Ensembl Sea Lamprey
Match: capn9 (calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 288/601 (47.92%), Postives = 395/601 (65.72%), Query Frame = 2
Query:  461 IDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRF--RFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIE-ADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXX---XXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVG 2245
            + W    EI QNPEFI +GA+R D++QG LGDCWLLAA+A L+L+ +L  +VVP  QNF +  Y G+F F  +FW FG W +V +DDRLPT N +LV++HS D  EFWSALLEKAY+K++GSYE+LKGGS +EA+EDFTGGV E  D+K   P +LF IM KA  + S+MGCSI+  +  ++EA+  NGL+ GHAYSIT V  VN     +  K++L+RIRNPWG E EW G+WSD +PEW  + Q +RN +     +DGEFWMS+ DF+++F KMEIC+L P  +E +         W + + +G W K   AGGCRNF +TFWTNPQFR+K+ +     ++      + I+ LMQK+MRK+++      T+GYAIY++ D+  GP+   +F YN S A++PSFINLREV  R +LP G YVIVPSTFEP+QEA FL+R+F+EKPN S E D++   I  E +  +++ A P  E      DD +   L   F ++AG+D+EI   ELQD+LN    K              +  GFS+   +S+VA+ D D SGKLG  EF++LW  ++ W+  F+K D+D SG  +SYE++  LN+ G
Sbjct:    2 VKWGLSREIVQNPEFIVDGATRTDIKQGALGDCWLLAAIASLTLNDQLLAKVVPPGQNF-RDGYAGIFHFQQKFWHFGEWMDVFIDDRLPTKNGQLVFVHSADKREFWSALLEKAYSKLNGSYEALKGGSIAEAMEDFTGGVYELLDLKT-APPDLFRIMCKARQKGSMMGCSIDVTNASESEARTSNGLVKGHAYSITGVDEVNY----RGQKVKLLRIRNPWG-EVEWNGAWSDHAPEWKALDQGERNRLQQVMAEDGEFWMSFDDFMRHFTKMEICNLTPDRVERE----GDPRYWTVTVHDGRWLKGCTAGGCRNFPETFWTNPQFRLKLHNEDDEADETGSKACSFIVALMQKNMRKQQR---NMLTMGYAIYKIPDQT-GPMPKEFFLYNASKARSPSFINLREVSQRFRLPAGEYVIVPSTFEPHQEADFLVRVFAEKPNRSKESDDK---IGAEID--LNDVAKPGTE----TEDDRKFKTL---FGRLAGEDMEISPKELQDMLNKITAK----------HGELESTGFSMHACRSIVALTDVDGSGKLGLQEFRILWNKIKKWQAIFRKHDEDLSGTMSSYEMKNALNAAG 565          
BLAST of Calpain-B vs. Ensembl Sea Lamprey
Match: capn1a (calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-1263])

HSP 1 Score: 428.328 bits (1100), Expect = 2.072e-139
Identity = 263/688 (38.23%), Postives = 386/688 (56.10%), Query Frame = 2
Query:  350 SQDYNNVKNSL--RGKLYEDPDFPAVNESLYFSQRPP------RKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIE--ADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCR--NFLDTFWTNPQFRVKXXXXXXXXXXNLGT-IIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKS 2374
            S+ +  +K     R  L+EDPDFPA   SL+   +P         I+WKRP E+ ++PEFI  GA+R D+ QG L DCWLL+A+A L+L+ +L  +VVP  Q+F +  Y G+F FRF ++G W +V VDDRLPT   +LV++ S   NEFWSALLEKAYAK++G YE+L  G   EAL DFTGGV E F M    P++ +D + +A  + +++ C IE  A   + E   P GL+ GHAYSIT V  + +  PGK+  +QLIR+RNP+G + E+ G WSD S  WN + + D+  + +   +DGEFW+S +DF KNF  +EICH G + +E +     +K+ W   + N  W K LNAGG R       F  N QF + +++ D   D   G   ++ L QK  RK RK G++F  IG  IY+     +  L     +    + ++P FI  REV  R  LPPG Y+I+P T    QEA FL+RIF EK  +   L  Q  +             TP   ++VSP   A+   + +SF Q+AG+D  I A +LQ ++    +K  T             D FS+E+ + +VA+ D D SG+LG++EF ++W  +++  + +K  D DKSG  +S EL + L    F++   +   ++MRF+     + FD ++    ++ T F  + S
Sbjct:   27 SKTFQEIKKECLQRKILFEDPDFPASLSSLHIRVQPTVITQSNNFIEWKRPWELVRHPEFIVSGATRADINQGTLPDCWLLSAIASLTLYPDLLAKVVPMGQSFHE-DYAGIFLFRFCQYGEWVDVHVDDRLPTKKGELVFVQSGTGNEFWSALLEKAYAKLNGCYEALAYGFPVEALCDFTGGVGETFTMNN-APRDYWDGISRAIKKGAIICCGIETLAASGRGEKVTPMGLVEGHAYSITGV--IKLKFPGKT--VQLIRVRNPYG-KVEYTGPWSDGSTTWNEVPEEDQKRLHVR-AEDGEFWISDKDFRKNFHLVEICHQGSE-VEIEH----RKNLWICELHNSMWLKGLNAGGSRRHRVFKEFPLNYQFFLTLLEEDNVMDVCHGCHFLLSLTQKHRRKFRKIGIDFVPIGIYIYKAVVPGK-KLTPQQLRKEKPLVESPEFIARREVTMRMTLPPGNYIIIPCTESAGQEAQFLLRIFMEKAQQHQGLASQLEV-------------TPYFPRMVSPP-PAENFDMEESFLQVAGKDKLIKADKLQALITLEIQKYTTVV----------VDKFSMESCRVLVALFDIDNSGQLGYEEFLLVWEFIKMTLKTYKMCDVDKSGTLSSTELPMALEHSRFKVGKLMQRLIMMRFSEPNLTISFDSFVCLLAKMYTAFNIFIS 676          
BLAST of Calpain-B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007888.1 (pep scaffold:Pmarinus_7.0:GL477427:174304:193458:1 gene:ENSPMAG00000007039.1 transcript:ENSPMAT00000007888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 394.43 bits (1012), Expect = 4.664e-128
Identity = 221/582 (37.97%), Postives = 331/582 (56.87%), Query Frame = 2
Query:  806 KISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRK-TEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLG--TIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQG----PLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMI----PTESNPVV-----------------SNTATPVPEKVVSPAD------DAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKE-GLVL-FDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            ++ GSYE+L GGST+E  EDFTGGV E  ++ K  P NL+ ++ +A  R SLMGCSI    +  +EA     L+ GHAYS+T    V+     +   ++L+RIRNPWG + EW G+WSD +P+W Y+S  DR  + ++  +DGEFWMS++DF++ F ++EIC+L P +L+ D LG      W      G W +  +AGGCRNF+   W   +F +K  + D+D  +N    T I+ LMQK+ RK+R++G +  T+GYAIY++ ++  G     L  +YF+Y+ S A++  FINLREV  R  LP G Y++VPSTFEPNQEA F++RIFSEK + +      T+      PT +                     S   TP P    +P         +      + F+++AG+D EI A ELQ ILN    K           +    DGF +E  +SMV++MD D + KLG  EF  LW  ++ W++ F ++D D +G  NS E+RL L + GFRL+ K+   +  R+A+ E G+ + FD+Y+ C VRL+T+F T+++   D  ++   +   F+   M+ 
Sbjct:    1 RLQGSYEALSGGSTTEGFEDFTGGVAESIELNKP-PSNLWRMLQQATLRGSLMGCSINITSQADSEAITSRKLVKGHAYSLTGTTEVDY----QGQMVRLVRIRNPWG-QVEWTGAWSDNAPQWGYVSDEDRGRLQVS-QEDGEFWMSFEDFLRQFSRLEICNLTPDALDDDSLG-----HWSANNFEGSWVRGCSAGGCRNFIVHLWEKWKFHLKHTEEDDDPHDNEAGCTFIVALMQKERRKKRRQGGDVLTVGYAIYEVPEQFVGQPQVKLKKDYFQYHSSKARSEVFINLREVSQRFTLPAGEYIVVPSTFEPNQEADFILRIFSEKQSVTVSARTTTSNTSPHSPTHTCTYTNTRIPHDGCSHTRERAHSRARTPTPRHSDAPTSFTSFKFSSTCPRFYKLFDRLAGEDQEISAKELQSILNRVVSK---------LHSTVTTDGFGLEACRSMVSLMDKDGTAKLGVKEFNFLWKKIKNWQQIFLEYDTDSTGTMNSMEMRLALEAAGFRLNEKLNQIVTTRYADGENGITIDFDNYVCCLVRLETMFRTFQALEKDGNEKINLNLPQFLHVTMFA 561          
BLAST of Calpain-B vs. Ensembl Nematostella
Match: EDO40193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7W7])

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 326/701 (46.50%), Postives = 464/701 (66.19%), Query Frame = 2
Query:  347 PSQDYNNVKNSLR--GKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSD--QNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQS-LEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE--NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQ 2428
            P+   ++V+  +R  GK +ED +F A++ S++FS+RPPR  +WKRP +IC++P     GASR D++QG LGDCWLLAA+A L+ HS L N+VVP D   N +  +Y G  +F  W++G WK+V++DDRLPTYN KLV++HS++ NEFWSALLEKAYAK++GSYESLKGG T EALEDFTGG+ E FD+ K VPK+LF IM  A  R +LMGCSI A   + EA+L NGL+ GHAY++T  + V          ++L+R+RNPWGNE EWKG+W D S EW  +S  ++ ++GLTF+DDGEFWMS+ DF K+F  +EIC LG  S +E   +G + +S      E+G W++ L AGGCRNF+ TF  NPQFR+  +   +DD ++L T+II LMQKD RK +K G+   TIG++IY+L++E   QG LD+ +F+Y+ S A++P FIN REV GR+ LPPG YV++P+TF PN+E +F++R++SEK +++ E+DE+T   P     V          ++     D      ++ F+ ++G+D EIDA ELQ IL+TA K             +     FS+E ++S+++M D D SGKLGF+EFK  W  ++ W + F+ FD+DKSG  ++YELR  L   GF LSN +L ++  R++  +G V  DD++    RL  +   ++ Q      RA FD D F++
Sbjct:    2 PNLTMDDVRRQVRSTGKPFEDDEFLAIDSSIFFSKRPPRPFEWKRPSDICEDPHMFVGGASRLDIQQGMLGDCWLLAAIAALTQHSALMNKVVPQDYVANPNDRNYTGALKFCIWQYGEWKDVIIDDRLPTYNGKLVFVHSSERNEFWSALLEKAYAKLNGSYESLKGGQTGEALEDFTGGLAESFDLNKNVPKDLFCIMQTAEKRHALMGCSIAAKANEIEAKLNNGLVKGHAYTVTGCRQVKAKTRRGDLDVELVRVRNPWGNEREWKGAWGDGSSEWQLLSDYEKKSIGLTFEDDGEFWMSFDDFKKHFTTLEICMLGADSAMEGSSVGFESRS------EHGMWRRGLTAGGCRNFIKTFHKNPQFRI-TLQDSDDDADDLCTVIIALMQKDRRKEKKHGINPLTIGFSIYKLEEEKDKQGNLDMEFFQYHASTARSPVFINSREVVGRYALPPGEYVVIPTTFNPNEEGNFVLRMYSEKAHKTCEVDEKTEFAPQHQRRV----------QISREQHDTLNSKFKEFFDNLSGRDGEIDAKELQQILSTALKN------------DLGGKPFSLEGARSIISMYDEDASGKLGFEEFKETWLQVKKWMKIFQVFDEDKSGEMDTYELRGALKEAGFTLSNSVLYAVSARYSTGDGKVNVDDFMEILTRLNILSAAFQKQAGQGGRRAAFDIDQFLE 673          
BLAST of Calpain-B vs. Ensembl Nematostella
Match: EDO48633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ83])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 306/664 (46.08%), Postives = 433/664 (65.21%), Query Frame = 2
Query:  389 KLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKT---EAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQL-KDENQGP-LDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIM--ALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIF 2359
            +L+ED DFPA N  L F++R   ++ WKRPHEI ++P+FI+ G S  DV QG + +CW +AA+A L+ + +L + V P DQ+F   SYCGMFRF FW+FG W E++VDD LPTYN +L +  S D +EFWSALLEKAYAK+ GSYE++  G  SEAL+D TGG+ E  D++   P  LF++M KA+ R SLMGCSIE     +   E  L NGLI  HAYSIT ++   ++      ++ LIR+RNP  N +EW+G+WSD+SPEWN +S  ++  + LTFDDDGEFWMS+ DF+ NF ++EIC L P S+E +      + +W++  E G W+K + AGGCRNF+ +F+TNPQFRV  +   +DDD+ L T+I+ LM+ D   R K   +   IG+AIY+   D  +G  LD  +F+YN +VA   SF  LRE+  R++L  G YV++PSTF P QE  FL+RIFSE+P  + E+D++T M           T+ P   KVV   DDA+ +       F+Q+AG+D E+D YELQ+IL+ +F +       E+N      + F++E  +SM++M D D+SG LG++EF+ L   L  WK  F K+D+D SG+ N+YELR  LN +G++LSN  ++SLV+R+ NK G + FD +I   VR+  +F
Sbjct:   24 RLFEDRDFPASNRVL-FTRRRSVQLIWKRPHEISKSPQFIARGFSSSDVAQGRIRNCWFVAALADLTTNIDLLHHVCPPDQSFEPGSYCGMFRFNFWQFGEWVEIIVDDYLPTYNGRLYFTKSDDPDEFWSALLEKAYAKLCGSYEAMSLGRISEALQDMTGGMIENVDLQNP-PHGLFNVMMKAYERQSLMGCSIEVKKYSSDQYEGTLENGLITRHAYSITGLRKATLSSLRGRPEVDLIRLRNPHANSSEWRGAWSDRSPEWNMLSSQEKRELNLTFDDDGEFWMSFDDFLNNFTRLEICMLTPDSMEQND-----RRKWDVQNEKGRWQKGVTAGGCRNFIASFYTNPQFRV-CLKNPDDDDDELCTVIVSLMRVDHSHRVKIP-DRAPIGFAIYKAPSDMRKGDRLDRAFFEYNKAVAMTTSFSKLREISSRYRLHAGEYVVIPSTFNPGQEGDFLLRIFSERPQYASEIDQETKM-----------TSGP---KVVITQDDAKSIDHEFWDVFHQMAGEDGEVDQYELQEILSKSFTR-------ELNN-----NLFALEACRSMISMFDTDRSGALGYNEFRALMILLEKWKNHFHKYDRDHSGDMNAYELRDALNGLGYQLSNSAMSSLVLRYHNKRGTISFDTFIQIVVRVVVMF 652          
BLAST of Calpain-B vs. Ensembl Nematostella
Match: EDO34860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN59])

HSP 1 Score: 347.821 bits (891), Expect = 5.496e-109
Identity = 201/497 (40.44%), Postives = 284/497 (57.14%), Query Frame = 2
Query:  389 KLYEDPDFPAVNESLYFSQR-PPRKIDWKRPHEICQN--PEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVP----SDQNFSKP-SYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMK-------KEVPKNLFDIMFKAFSRCSLMGCSIEADPR-KTEAQLPNGLIMGHAYSITDVKMVNINIPGKS----GKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGT-IIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAM 1816
            +L+ D  F     SLY+S+  PP  ++WKRP EIC    P    +GA   DV QG+LG+CW +AA + L+L   L  +V+P     + +  KP +Y G+FRFRF+R G W EV+VDD LPT N KLVY+HS + NEFWSAL+EKAYAK++G+YE+L  GST++AL DFTGGV E   +        +E    LF  + +     SLM  SI+ + R + E +L  GLI GHAY +T VK V +     S        +IR+RNPWG E EW G WSD+S EW  +   DR  MG+ F++DGEFWM + DF + F    +CH+  +++       K   +W +   N  W +  NAGGC    DTF  NPQ+            +N G   ++ LMQ+D RK + +GV   TIG+ I ++++  +  +   + K   S+     FIN REV  R  L  G Y++VPST+EP+    F+MRIF+ K + +  LD+  ++
Sbjct:   24 QLFVDSVFKPETSSLYYSRSCPPEPVEWKRPSEICHPAVPHLFVDGADSHDVTQGKLGNCWFVAACSSLALRPFLLYKVIPDKDKQEWDPKKPENYQGIFRFRFYRQGEWTEVVVDDLLPTVNGKLVYIHSKEKNEFWSALIEKAYAKLAGTYEALAAGSTADALVDFTGGVAEAISLSNGGYAEDQEKRLQLFKTLERGHKEKSLMSASIKINNRNEMEQRLDTGLIKGHAYGVTMVKKVTVGEGLLSLFNKKHFYMIRLRNPWG-EKEWNGRWSDESEEWKKLKPGDRKKMGIVFENDGEFWMEFDDFCREFTDCTLCHVINKAMIH-----KVFKQWHIYKHNYNWTQGQNAGGCVQNQDTFLKNPQY-------AFSITDNEGEDAMVSLMQEDRRKDKSKGVGNLTIGFYIMKVEENRKYRVHSMFPKAGDSI-----FINAREVMNRFFLAAGRYLVVPSTYEPHTPGHFMMRIFTRKRSNAMFLDQDHSV 502          
BLAST of Calpain-B vs. Ensembl Nematostella
Match: EDO48536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ84])

HSP 1 Score: 323.553 bits (828), Expect = 5.343e-100
Identity = 163/374 (43.58%), Postives = 232/374 (62.03%), Query Frame = 2
Query:  479 HEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPS---DQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQ-SLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKD 1588
             EIC  P F  +GASR D++QG LG+CWLLAA++ L+ H  L ++++P    + +   P Y G   F+ W++G W  V++DDRLPTY  KLV++HS + NEFW ALLEKAYAKI GSYE+LKGG T EALEDFTGG++E F ++ + P NLF IM +A  R +LMGCSI                             N+ +  + G ++LIRIRNPWG+E EW G+W D+SPEW  +SQ ++ ++ L FD DGEFWMS++DF  +F+K+E+C L  + +++  Q+    +      +ENG W+K ++AGGCRNFL+TF TNPQFR+          E  G  +  +  + M +   EG     IG+A+Y++ +
Sbjct:   11 QEICSEPRFYVDGASRLDIKQGVLGNCWLLAAMSVLAQHKPLVDRIMPEGVYEADRFSPRYTGKVVFKLWQYGEWVTVIIDDRLPTYKGKLVFVHSPEKNEFWCALLEKAYAKIHGSYEALKGGLTGEALEDFTGGLSEVFVLE-DAPANLFQIMQRAEKRSALMGCSI-----------------------------NVFLSTRGG-VELIRIRNPWGDEKEWTGAWGDRSPEWQELSQDEKRSLDLEFDVDGEFWMSFEDFKSHFDKLEVCMLDVENAIDKTQISFNSR------LENGFWRKHVSAGGCRNFLETFHTNPQFRLVSRVMSRMICEGTGFALYKVSNRVMSREICEG-----IGFALYKVSN 342          

HSP 2 Score: 82.8037 bits (203), Expect = 2.228e-16
Identity = 45/89 (50.56%), Postives = 57/89 (64.04%), Query Frame = 2
Query: 1559 IGYAIYQLKDENQ-----GPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQT 1810
            IG+A+Y++ D  +       LD  YF++N S  ++ +FIN REV GR +L PG YVIVPSTF  N EA FL+RIFSEK   S  L E T
Sbjct:  393 IGFALYKIDDITKRKYGVSRLDKEYFQFNKSTERS-TFINSREVVGRFELAPGEYVIVPSTFIQNAEADFLLRIFSEKAVSSSALTEST 480          
BLAST of Calpain-B vs. Ensembl Nematostella
Match: EDO37991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE78])

HSP 1 Score: 150.984 bits (380), Expect = 4.065e-38
Identity = 102/322 (31.68%), Postives = 157/322 (48.76%), Query Frame = 2
Query:  395 YEDPDFPAVNESLYFSQRP---PRKIDWKRPHEI-----CQN--PEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKE---------VPKNL-FDIMFKAFSRCSLMGCSIEADPRKTEAQLPN--GLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHL 1294
            + D  FP V +SLY + R    PR  DW RP+EI     C+   P  +       D+ QG LGDCW L+++A L+   EL  +++ + +   +    G ++ R  + G W  +L+DD LP               + W  L+EKA AK+ GSYE+L  G + E L   TG   E   + +          + K+L +  +  + +   LMG S   D +  E    N  GL   HAYS+ DV+ V+         I+L+R+RNPWG +  W G WSD S  W   +   R+ + +    +G FWMS +DF+K F+ +++C +
Sbjct:   44 FVDDSFPPVLKSLYINPRHSEHPRVADWLRPNEIDNFSTCRTNIPWAVFRNPRPSDIIQGVLGDCWFLSSLAVLAERPELLEKILITREVSPQ----GAYQVRLCKDGKWTVILIDDLLPCNQRGQPVYSWAHRRQLWVPLIEKAMAKLHGSYEALTAGRSIEGLATLTGAPCESIALHESQNNSGNTEPIDKDLIWAQLISSRTAGFLMGASCGGDTQPEEEPGYNAVGLQTHHAYSVLDVRDVH--------GIRLLRLRNPWG-QYSWTGDWSDASSLW---TPELRHELMVHGAQEGVFWMSLEDFMKYFDSVDVCKI 349          
BLAST of Calpain-B vs. Ensembl Medaka
Match: capn3a (calpain-3 [Source:NCBI gene;Acc:101157263])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 317/710 (44.65%), Postives = 463/710 (65.21%), Query Frame = 2
Query:  353 QDYNNVKNSL--RGKLYEDPDFPAVNESLYFSQ-----RPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNL--GTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE---NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            QD++ ++     R  L+ED  FPA  ESL F +        + I WKRP EIC NP+FI  GASR D+ QG+LGDCWLLAA+ACL+L+ +L  +VVP +Q+FS+ SY G+F F+FWR+G W +V+VDDR+PT NN+LV+  S + NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGVTEF++M KE PK L+  M KA  R SLMGCSI++  P + E +   GL+ GHAYS+T V     +   K  K++L+R+RNPWG + EW G WSD S EW  +S+A++  +     +DGEFWMS++DF KN+ K+EIC+L P +LE D++      +W + +  G W +  +AGGCRN+ DTFWTNPQ+R+++++ D+D D+N    T ++ LMQK+ R+ RK G   +TIG++IY++  E   N+  L  ++F  N S A++ S+INLREV  R +L PG YVIVPST+EP+QE  F++R+FSEK N S E++          N + ++   P P  V   +++      R  F +IAG+D+EI A +L+++LN      V     ++N       GFS+E+ +SM+A+MD D +G+L   EF+ LW  ++ W+  FK ++ D+SG  NSYE+R  +N  GFRL+N++ + + +R+AN+   + FD +I C VRL+ +F  +++   D           ++Q  MY 
Sbjct:   35 QDFSTLRQECLQRKGLFEDDSFPATVESLGFKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNEKLLFRVVPQEQSFSE-SYAGIFHFQFWRYGDWVDVVVDDRIPTLNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEM-KEAPKELYKTMKKALERGSLMGCSIDSLVPARFETRTTTGLVKGHAYSVTAVDECRPS-QQKESKVRLVRLRNPWG-QVEWNGPWSDNSKEWATLSKAEKEKLQHQSAEDGEFWMSFEDFKKNYTKIEICNLTPDTLEDDKI-----HKWTVSVNEGRWLRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPDDNEVACTFVVSLMQKNRRRERKMGANLFTIGFSIYEVPKEMHGNKQHLQKDFFLLNSSKARSKSYINLREVTQRFRLSPGEYVIVPSTYEPHQEGEFILRVFSEKRNTSEEIE----------NRIEADHPVPAPASVGEESEEDH--HFRTIFQEIAGEDMEITANKLKNVLNR-----VITERKDLNTV-----GFSLESCRSMIALMDMDGTGRLNLQEFRHLWNKIKQWEGIFKHYNADQSGIINSYEMRNAVNDAGFRLNNQLYHIITLRYANENMNIDFDSFISCLVRLEAMFRAFQAFDQDGDGTIRLSVLEWLQLTMYA 713          
BLAST of Calpain-B vs. Ensembl Medaka
Match: capn3a (calpain-3 [Source:NCBI gene;Acc:101157263])

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 316/698 (45.27%), Postives = 459/698 (65.76%), Query Frame = 2
Query:  353 QDYNNVKNSL--RGKLYEDPDFPAVNESLYFSQ-----RPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNL--GTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQD 2416
            QD++ ++     R  L+ED  FPA  ESL F +        + I WKRP EIC NP+FI  GASR D+ QG+LGDCWLLAA+ACL+L+ +L  +VVP +Q+FS+ SY G+F F+FWR+G W +V+VDDR+PT NN+LV+  S + NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGVTEF++M KE PK L+  M KA  R SLMGCSI++  P + E +   GL+ GHAYS+T V         K  K++L+R+RNPWG + EW G WSD S EW  +S+A++  +     +DGEFWMS++DF KN+ K+EIC+L P +LE D++      +W + +  G W +  +AGGCRN+ DTFWTNPQ+R+++++ D+D D+N    T ++ LMQK+ R+ RK G   +TIG++IY++   N+  L  ++F  N S A++ S+INLREV  R +L PG YVIVPST+EP+QE  F++R+FSEK N S E++          N + ++   P P  V   +++      R  F +IAG+D+EI A +L+++LN      V     ++N       GFS+E+ +SM+A+MD D +G+L   EF+ LW  ++ W+  FK ++ D+SG  NSYE+R  +N  GFRL+N++ + + +R+AN+   + FD +I C VRL+ +F  +++          FDQD
Sbjct:   35 QDFSTLRQECLQRKGLFEDDSFPATVESLGFKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNEKLLFRVVPQEQSFSE-SYAGIFHFQFWRYGDWVDVVVDDRIPTLNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEM-KEAPKELYKTMKKALERGSLMGCSIDSLVPARFETRTTTGLVKGHAYSVTAVD------EQKESKVRLVRLRNPWG-QVEWNGPWSDNSKEWATLSKAEKEKLQHQSAEDGEFWMSFEDFKKNYTKIEICNLTPDTLEDDKI-----HKWTVSVNEGRWLRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPDDNEVACTFVVSLMQKNRRRERKMGANLFTIGFSIYEMHG-NKQHLQKDFFLLNSSKARSKSYINLREVTQRFRLSPGEYVIVPSTYEPHQEGEFILRVFSEKRNTSEEIE----------NRIEADHPVPAPASVGEESEEDH--HFRTIFQEIAGEDMEITANKLKNVLNR-----VITERKDLNTV-----GFSLESCRSMIALMDMDGTGRLNLQEFRHLWNKIKQWEGIFKHYNADQSGIINSYEMRNAVNDAGFRLNNQLYHIITLRYANENMNIDFDSFISCLVRLEAMFRAFQA----------FDQD 685          
BLAST of Calpain-B vs. Ensembl Medaka
Match: capn3a (calpain-3 [Source:NCBI gene;Acc:101157263])

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 317/701 (45.22%), Postives = 461/701 (65.76%), Query Frame = 2
Query:  353 QDYNNVKNSL--RGKLYEDPDFPAVNESLYFSQ-----RPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNL--GTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE---NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQD 2416
            QD++ ++     R  L+ED  FPA  ESL F +        + I WKRP EIC NP+FI  GASR D+ QG+LGDCWLLAA+ACL+L+ +L  +VVP +Q+FS+ SY G+F F+FWR+G W +V+VDDR+PT NN+LV+  S + NEFWSALLEKAYAK+ GSYE+LKGG+T+EA+EDFTGGVTEF++M KE PK L+  M KA  R SLMGCSI++  P + E +   GL+ GHAYS+T V     +   K  K++L+R+RNPWG + EW G WSD S EW  +S+A++  +     +DGEFWMS++DF KN+ K+EIC+L P +LE D++      +W + +  G W +  +AGGCRN+ DTFWTNPQ+R+++++ D+D D+N    T ++ LMQK+ R+ RK G   +TIG++IY++  E   N+  L  ++F  N S A++ S+INLREV  R +L PG YVIVPST+EP+QE  F++R+FSEK N S E++          N + ++   P P  V   +++      R  F +IAG+D+EI A +L+++LN      V     ++N       GFS+E+ +SM+A+MD D +G+L   EF+ LW  ++ W+  FK ++ D+SG  NSYE+R  +N  GFRL+N++ + + +R+AN+   + FD +I C VRL+ +F  +++          FDQD
Sbjct:   35 QDFSTLRQECLQRKGLFEDDSFPATVESLGFKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNEKLLFRVVPQEQSFSE-SYAGIFHFQFWRYGDWVDVVVDDRIPTLNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEM-KEAPKELYKTMKKALERGSLMGCSIDSLVPARFETRTTTGLVKGHAYSVTAVDECRPS-QQKESKVRLVRLRNPWG-QVEWNGPWSDNSKEWATLSKAEKEKLQHQSAEDGEFWMSFEDFKKNYTKIEICNLTPDTLEDDKI-----HKWTVSVNEGRWLRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPDDNEVACTFVVSLMQKNRRRERKMGANLFTIGFSIYEVPKEMHGNKQHLQKDFFLLNSSKARSKSYINLREVTQRFRLSPGEYVIVPSTYEPHQEGEFILRVFSEKRNTSEEIE----------NRIEADHPVPAPASVGEESEEDH--HFRTIFQEIAGEDMEITANKLKNVLNR-----VITERKDLNTV-----GFSLESCRSMIALMDMDGTGRLNLQEFRHLWNKIKQWEGIFKHYNADQSGIINSYEMRNAVNDAGFRLNNQLYHIITLRYANENMNIDFDSFISCLVRLEAMFRAFQA----------FDQD 694          
BLAST of Calpain-B vs. Ensembl Medaka
Match: capn3b (calpain-3 [Source:NCBI gene;Acc:101169329])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 312/705 (44.26%), Postives = 447/705 (63.40%), Query Frame = 2
Query:  392 LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEA-DPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXN-LGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGP---LDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPE-----------------KVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMY 2440
            L+EDP FPA + SL++S +P  KI+WKRP EIC+NP+FI +GA+R D+ QGELGDCWLLAA+ACL+L  +L  +V+P +Q+F++ +Y G+F F+FWR+G W +++VDDR+PT NN LV+  S   NEFWSALLEKAYAK+ GSYE+LKGG+T +A+EDFTGGVTE F++  E PK LF IM KA  R SLMGCSI+       E++   GL+ GHAYSI  + +   +   + GKI+LIR+RNPWG    WKG WS  S EW+ +S ADR+ +     +  EFWMS+ DF KNF K+E+C+L P     D L G ++  W + I  G W +  +AGGCRNF DTFWTNPQ+R+++ + D+ ++E  L T+++ LMQK  R +R  G +F TIG++IY++  E QG    L  ++F YN S AK  ++INLREV  R +LPPG YVI+P+TF+ ++E  FL+R+FSE  N+S   + +T++   E    VS+ A    E                  + +  +  +    R  + +IAG+D+EI A EL  I+     K           +  K DGFS+ET +SM+A+MD D SGKL   EFK LW  ++ W+  FK++D+D   + +S+E+R  +N  GF L+ ++ + + MR+A+K   + FD YI C VRL+ +F  + +   D       +   ++Q  MY
Sbjct:   77 LFEDPLFPANDSSLFYSHKPSMKIEWKRPTEICENPQFIIDGANRTDICQGELGDCWLLAAIACLTLSEKLLYRVIPPEQSFTE-NYAGIFHFQFWRYGEWIDIVVDDRIPTCNNLLVFTKSFRENEFWSALLEKAYAKLHGSYEALKGGNTLDAMEDFTGGVTELFEL-SEAPKGLFIIMKKALERGSLMGCSIDVTTANDIESRTNQGLVRGHAYSI--IALEECDQVSEDGKIRLIRLRNPWG-WVLWKGPWSVNSKEWSTVSTADRDNLKKQTLEMSEFWMSFDDFKKNFTKLEMCNLTP-----DALTGDERQSWTVSINEGRWVRGSSAGGCRNFPDTFWTNPQYRLRLYEEDDPEEEQVLCTVVVALMQKGRRMQRHAGAKFLTIGFSIYEVPKELQGQNQHLQKDFFLYNASKAKCKAYINLREVTERFRLPPGEYVILPTTFKAHEEGEFLLRVFSE--NKSTSEEAETSIDKIEPIVFVSDRARTNKEIEHEGIRGEKKKKPKRKPLQAVEETEEEKQFRVIYQKIAGEDMEICASELMAIMKNVLSK----------HSEIKSDGFSLETCRSMIALMDTDGSGKLNLQEFKHLWKKIKEWQLIFKRYDKDGKCSISSFEMRNAVNDAGFNLNKQLYDIIAMRYADKHLNIDFDSYICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMY 759          
BLAST of Calpain-B vs. Ensembl Medaka
Match: zgc:55262 (calpain-1 catalytic subunit [Source:NCBI gene;Acc:101155642])

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 308/710 (43.38%), Postives = 448/710 (63.10%), Query Frame = 2
Query:  353 QDYNNVK-NSLR-GKLYEDPDFPAVNESLYFSQRPPRK-----IDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIE-ADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDI----NYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMA-LRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            QDY ++K   LR GKL+ED  FP    SL F++  PR      + W RP E+C+ PEFI +GA+R D+ QG LGDCWLLAA+A L+L+  L ++VVP  Q F K  Y G+F F+FW+FG W +V++DDRLP  + KL+++HS +  EFWSALLEKAYAK++G YE+L GGSTSE  EDFTGGVTE +D+ K  P +LF I+ +A  R SL+GCSI+       EA     L+ GHAYS+T V  V      +    +L+R+RNPWG E EW G WSD S EW+Y+  + R+ +     +DGEFWM++ DF++ F ++EIC+     L AD L   +  +W   +  GEW++   AGGCRN+  TFW NPQF++ +  PD     +  + ++GLMQKD RK+R+EG +  TIG+A+Y++ DE +G  ++    ++F  + S A++  FINLREV  R +LP G Y++VPSTFEPN+EA F++R+FSEKP +S ELD+              +    +P++++   D++QI A  +  F Q+AG D+EI   ELQ+ILN    K            + K DGF+ E  +SM+ +MD D SGKLG  EF VLW  ++ +   F++FD DKSG  +SYE+R+ L S GF+L+N +   +++R+  ++  V FD+++ C VRL+T+F+T+K+   D+  +   +   +I   M+ 
Sbjct:   36 QDYESLKAQCLRSGKLFEDNLFPCAASSLGFNELGPRSSKTYGVRWMRPTELCKRPEFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQCF-KQGYAGIFHFQFWQFGEWVDVVIDDRLPAKDGKLLFVHSVEGTEFWSALLEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYDLIKP-PPDLFGIISRAVERGSLLGCSIDITSSTDREAVTFKKLVKGHAYSLTGVDEVMY----RGNLTRLVRMRNPWG-EMEWTGPWSDDSKEWSYVDSSVRDRLQ-NRSEDGEFWMAFSDFLREFSRVEICN-----LTADALDNTQMKKWSSSLFQGEWRRGSTAGGCRNYPATFWLNPQFKISLQHPDVSGKPDC-SFLVGLMQKDRRKKRQEGKDMETIGFALYEVPDEFKGSSNVHLKRDFFLTHASSARSELFINLREVSSRLRLPAGEYIVVPSTFEPNKEADFVLRVFSEKPADSEELDD--------------DVVADLPKEIL--LDESQIDAGFKSLFKQLAGPDMEISVTELQNILNKIISK----------HKDLKTDGFTPEACRSMINLMDTDGSGKLGLKEFHVLWEKIKRYLTIFRQFDLDKSGTMSSYEMRIALESAGFKLTNHLFQLIILRYTEEDMSVDFDNFVTCLVRLETMFKTFKTLDTDADGQISLNFFQWITLTMFA 705          
BLAST of Calpain-B vs. Planmine SMEST
Match: SMESG000039299.1 (SMESG000039299.1)

HSP 1 Score: 1597.02 bits (4134), Expect = 0.000e+0
Identity = 795/795 (100.00%), Postives = 795/795 (100.00%), Query Frame = 2
Query:   59 MPYVSTRTVRTIKYSGGGVPEVXXXXXXXXXXXXXXXXVQGNDFGGIPIGSAKFQTPRSNVIKPAVIGDGSNVPVRPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            MPYVSTRTVRTIKYSGGGVPEVTTTTTTIDNGDKKTITVQGNDFGGIPIGSAKFQTPRSNVIKPAVIGDGSNVPVRPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV
Sbjct:    1 MPYVSTRTVRTIKYSGGGVPEVTTTTTTIDNGDKKTITVQGNDFGGIPIGSAKFQTPRSNVIKPAVIGDGSNVPVRPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 795          
BLAST of Calpain-B vs. Planmine SMEST
Match: SMESG000039299.1 (SMESG000039299.1)

HSP 1 Score: 1564.28 bits (4049), Expect = 0.000e+0
Identity = 783/795 (98.49%), Postives = 783/795 (98.49%), Query Frame = 2
Query:   59 MPYVSTRTVRTIKYSGGGVPEVXXXXXXXXXXXXXXXXVQGNDFGGIPIGSAKFQTPRSNVIKPAVIGDGSNVPVRPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            MPYVSTRTVRTIKYSGGGVPEVTTTTTTIDNGDKKTITVQGNDFGGIPIGSAKFQTPRSNVIKPAVIGDGSNVPVRPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTE            PEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV
Sbjct:    1 MPYVSTRTVRTIKYSGGGVPEVTTTTTTIDNGDKKTITVQGNDFGGIPIGSAKFQTPRSNVIKPAVIGDGSNVPVRPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTE------------PEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 783          
BLAST of Calpain-B vs. Planmine SMEST
Match: SMESG000039299.1 (SMESG000039299.1)

HSP 1 Score: 1527.69 bits (3954), Expect = 0.000e+0
Identity = 770/795 (96.86%), Postives = 771/795 (96.98%), Query Frame = 2
Query:   59 MPYVSTRTVRTIKYSGGGVPEVXXXXXXXXXXXXXXXXVQGNDFGGIPIGSAKFQTPRSNVIKPAVIGDGSNVPVRPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            MPYVSTRTVRTIKYSGGGVPEVTTTTTTIDNGDKKTITVQGNDFGGIPIGSAKFQTPRSNVIKPAVIGDGSNVPVRPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTE            PEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKK            +FKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV
Sbjct:    1 MPYVSTRTVRTIKYSGGGVPEVTTTTTTIDNGDKKTITVQGNDFGGIPIGSAKFQTPRSNVIKPAVIGDGSNVPVRPTGSHAGDAVPEGRGGASVGPSQDYNNVKNSLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTE------------PEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKK------------DFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 771          
BLAST of Calpain-B vs. Planmine SMEST
Match: SMESG000067761.1 (SMESG000067761.1)

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 421/707 (59.55%), Postives = 534/707 (75.53%), Query Frame = 2
Query:  338 SVGPSQD-YNNVKNSLRGK--LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE--NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 2443
            S+  S+D + N K  L+ K  L+EDP FPA N SLY+ + PP+KI+WKRP E+ QN  FI++G SRFDV QGELGDCWLLAAV+ LS++  L  QV+PSDQ+F +  Y G F FR W+FG W +V+VDDRLPT   +LVY+HS D NEFWSALLEKAYAK++GSYE+LKGGS+SEA+EDFTGG+TE FD+    P NL+DIM K  +R SLMGCSIEADP K EA+   GLI GHAYSITDVK VN     K G++ L+R+RNPWGN  EW G++SDKSPEWN IS  +R  +GLTF+DDGEFWM++QDF+K F K+EICHL P+S E +   G KKS+WEMCIENGEW+K ++AGGCRNF++TF  NPQF+VKVVDPDE+D+EN GT+IIGLMQK+MR RRKEG + +TIGYAIYQ+KD   ++  LD  YF+   S AK+P+FINLREVCGRHKLP G YVIVPSTF   +EA FL+RIFSE+P +S ++DE+T ++  +    +       PE  V   +DA  + L+ +F  I+G D EIDA ELQ IL+ +FK+            +FKF+GFS ET +SMVAMMD DQSG+LGF+EFKVLW DLRLWK  FKKFD+D+SG FNSYE+R  LN +GFR+SN++  +++ R+ANK+G++ FDDYIL  VRL+T+F TYK+Q   SK  A+F QD F+QC++Y+
Sbjct:   48 SLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMYQVIPSDQDFDR-DYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVN----SKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPES-ELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIP------PE--VKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKR------------DFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYILLLVRLRTVFLTYKAQQKTSKGEAIFPQDEFMQCVLYM 728          
BLAST of Calpain-B vs. Planmine SMEST
Match: SMESG000017238.1 (SMESG000017238.1)

HSP 1 Score: 824.698 bits (2129), Expect = 0.000e+0
Identity = 402/733 (54.84%), Postives = 528/733 (72.03%), Query Frame = 2
Query:  272 NVPVR-PTGSHAGDAVPEGRGGASVGPSQDYNNVKNSL--RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKN------LFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKI-QLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKXXXXXXXXXXNLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMY 2440
            N+P +   G+ A  A    RGG  VG ++ Y+++K  L  +G LYED DFPA  ES+YF+        WKRPHEIC +P+F   GASRFDV QGELGDCWLLAAVA LS+ + LF+QV P+DQ+F+K  YCG F F FW +G WKE+++DDRLPT NN+LV+MHS DSNEFWSALLEKAYAK+ GSYE LKGGS+SEA+EDFTGG+TE  D+K +  KN      LF IM ++ S+ SLMGCSI+A+P+ TEA+L NGLIMGHAYSIT VK ++  +PG +G I +L+RIRNPWG ++EW G W D S  W++IS  +R  +GL FD+DGEFWMS+ DF+ NFEK+EICHLGPQS+    L    K  WE  ++ G WKK  +AGGC NF +TFW+NPQFR+ V DPD+DD +N+GT+IIGL+QK+MR  +  G + + IGY +Y+L   + GPLD  +F+ N  VA +P+FIN+REVCGRH+LPPG+Y I+PSTFE NQEA FL+RIFSE+ N   E+DE + M          N   PV      P ++++I  LR +F  +AG D+EIDA EL+D+L++AF++               F  F+I+T +SMVAMMD D SG+LGF+EF+V+W DL+LWK  FKK D+D SG+ +SYELR  LN++GFR+SNKI  +LV+RFA K+G + FDD++ CCVRLKT+F+T+K+Q  D+ + A+ DQDTFIQ  +Y
Sbjct:   64 NIPEKGALGALATRAKLVSRGG--VGQAESYDSLKEKLVAKGTLYEDEDFPANGESIYFTSNKGGNFQWKRPHEICSDPQFFVGGASRFDVCQGELGDCWLLAAVASLSMQTMLFSQVAPNDQSFAKGKYCGAFHFNFWHYGEWKEIIIDDRLPTRNNRLVFMHSRDSNEFWSALLEKAYAKLCGSYELLKGGSSSEAMEDFTGGITEIIDLKGDNRKNNESKEKLFQIMIQSHSKMSLMGCSIDANPKVTEAKLGNGLIMGHAYSITAVKQISAKVPGYNGDIIKLVRIRNPWG-QSEWNGEWGDSSDSWHHISDKERGVLGLNFDNDGEFWMSFNDFVNNFEKLEICHLGPQSVGESLLKNSNKRTWESSVQQGAWKKGASAGGCLNFQETFWSNPQFRIVVTDPDKDDTDNMGTVIIGLLQKNMRSIKNRGNDLFPIGYVLYKLPSTDCGPLDKVFFRTNRKVAMSPAFINMREVCGRHRLPPGSYAIIPSTFEVNQEADFLLRIFSERANCGKEIDETSKMDD-------KNLVLPV------PVNESEIEQLRSAFKAVAGDDMEIDASELKDVLDSAFRREAF------------FKEFTIDTCRSMVAMMDIDLSGRLGFEEFQVMWLDLKLWKTVFKKEDKDGSGSLSSYELRTLLNAIGFRVSNKIFTNLVVRFATKDGTIEFDDFVHCCVRLKTVFQTFKAQKKDAHNNAIIDQDTFIQSSIY 768          
The following BLAST results are available for this feature:
BLAST of Calpain-B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPN30.000e+043.09calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
CAPN30.000e+043.35calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
CAPN90.000e+044.11calpain 9 [Source:HGNC Symbol;Acc:HGNC:1486][more]
CAPN30.000e+041.10calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
CAPN30.000e+040.91calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
back to top
BLAST of Calpain-B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clp-11.477e-16853.47Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-11.477e-16853.47Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-11.477e-16853.47Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-18.805e-16853.70Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-11.550e-16753.70Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
back to top
BLAST of Calpain-B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CalpB0.000e+049.36gene:FBgn0025866 transcript:FBtr0076343[more]
CalpB0.000e+049.36gene:FBgn0025866 transcript:FBtr0304675[more]
CalpA0.000e+044.76gene:FBgn0012051 transcript:FBtr0340532[more]
CalpA0.000e+045.27gene:FBgn0012051 transcript:FBtr0112869[more]
CalpA0.000e+045.27gene:FBgn0012051 transcript:FBtr0086529[more]
back to top
BLAST of Calpain-B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn90.000e+045.65calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2][more]
capn3b0.000e+041.79calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
capn3b0.000e+041.57calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
zgc:552620.000e+043.56zgc:55262 [Source:ZFIN;Acc:ZDB-GENE-040426-2814][more]
capn3a0.000e+043.14calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912... [more]
back to top
BLAST of Calpain-B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tgfbrap10.000e+045.78transforming growth factor beta receptor associate... [more]
CAPN30.000e+044.30calpain 3 [Source:NCBI gene;Acc:100497532][more]
tgfbrap10.000e+045.97transforming growth factor beta receptor associate... [more]
CAPN30.000e+041.72calpain 3 [Source:NCBI gene;Acc:100497532][more]
CAPN30.000e+040.62calpain 3 [Source:NCBI gene;Acc:100497532][more]
back to top
BLAST of Calpain-B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Capn30.000e+042.95calpain 3 [Source:MGI Symbol;Acc:MGI:107437][more]
Capn90.000e+044.98calpain 9 [Source:MGI Symbol;Acc:MGI:1920897][more]
Capn30.000e+044.24calpain 3 [Source:MGI Symbol;Acc:MGI:107437][more]
Capn30.000e+043.12calpain 3 [Source:MGI Symbol;Acc:MGI:107437][more]
Capn30.000e+039.66calpain 3 [Source:MGI Symbol;Acc:MGI:107437][more]
back to top
BLAST of Calpain-B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VT65|CANB_DROME0.000e+049.36Calpain-B OS=Drosophila melanogaster OX=7227 GN=Ca... [more]
sp|Q11002|CANA_DROME0.000e+045.27Calpain-A OS=Drosophila melanogaster OX=7227 GN=Ca... [more]
sp|O35920|CAN9_RAT0.000e+045.27Calpain-9 OS=Rattus norvegicus OX=10116 GN=Capn9 P... [more]
sp|O14815|CAN9_HUMAN0.000e+044.11Calpain-9 OS=Homo sapiens OX=9606 GN=CAPN9 PE=1 SV... [more]
sp|Q9D805|CAN9_MOUSE0.000e+044.98Calpain-9 OS=Mus musculus OX=10090 GN=Capn9 PE=2 S... [more]
back to top
BLAST of Calpain-B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HRD30.000e+065.41Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EIH10.000e+065.41Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2R2MIP40.000e+062.32calpain-A OS=Lingula unguis OX=7574 GN=LOC10615677... [more]
A0A5J4NR820.000e+057.44Calpain, invertebrate OS=Paragonimus westermani OX... [more]
A0A4S2LH560.000e+058.23Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Calpain-B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:552620.000e+044.10calpain-1 catalytic subunit-like [Source:NCBI gene... [more]
zgc:552620.000e+043.90calpain-1 catalytic subunit-like [Source:NCBI gene... [more]
capn3b0.000e+042.30calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
capn1a0.000e+041.51calpain-1 catalytic subunit-like [Source:NCBI gene... [more]
si:dkeyp-50d11.20.000e+042.25si:dkeyp-50d11.2 [Source:ZFIN;Acc:ZDB-GENE-091113-... [more]
back to top
BLAST of Calpain-B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn3a0.000e+042.10calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912... [more]
ENSPMAT00000003998.10.000e+041.99pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 g... [more]
capn90.000e+047.92calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2][more]
capn1a2.072e-13938.23calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc... [more]
ENSPMAT00000007888.14.664e-12837.97pep scaffold:Pmarinus_7.0:GL477427:174304:193458:1... [more]
back to top
BLAST of Calpain-B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calpain-B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO401930.000e+046.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486330.000e+046.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348605.496e-10940.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485365.343e-10043.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379914.065e-3831.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calpain-B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn3a0.000e+044.65calpain-3 [Source:NCBI gene;Acc:101157263][more]
capn3a0.000e+045.27calpain-3 [Source:NCBI gene;Acc:101157263][more]
capn3a0.000e+045.22calpain-3 [Source:NCBI gene;Acc:101157263][more]
capn3b0.000e+044.26calpain-3 [Source:NCBI gene;Acc:101169329][more]
zgc:552620.000e+043.38calpain-1 catalytic subunit [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Calpain-B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039299.10.000e+0100.00SMESG000039299.1[more]
SMESG000039299.10.000e+098.49SMESG000039299.1[more]
SMESG000039299.10.000e+096.86SMESG000039299.1[more]
SMESG000067761.10.000e+059.55SMESG000067761.1[more]
SMESG000017238.10.000e+054.84SMESG000017238.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006773 ID=SMED30006773|Name=Calpain-B|organism=Schmidtea mediterranea sexual|type=transcript|length=2520bp
TTTGAATTGATTGTAAAAATTTATTTCTATCATTTTCAAAATTAAAACAG
ATCTATAAATGCCATACGTGTCTACAAGAACTGTAAGAACTATTAAATAT
TCTGGTGGAGGAGTACCTGAAGTAACAACTACTACTACAACAATAGACAA
TGGAGACAAAAAAACAATTACAGTCCAAGGAAATGATTTTGGTGGTATTC
CTATCGGATCAGCGAAATTTCAAACCCCGCGTTCTAATGTAATTAAGCCC
GCTGTAATTGGTGATGGTAGTAATGTACCAGTTCGTCCAACTGGATCACA
TGCCGGAGACGCTGTTCCAGAAGGTAGAGGGGGTGCATCTGTCGGCCCAA
GCCAAGACTACAATAACGTGAAAAATAGCTTACGTGGAAAACTATACGAA
GACCCCGATTTTCCTGCAGTTAATGAAAGTCTTTATTTCAGTCAACGTCC
TCCCAGAAAAATTGATTGGAAACGACCTCACGAAATTTGCCAAAATCCGG
AATTTATTTCTGAAGGTGCAAGCAGATTTGATGTAAGACAAGGAGAATTA
GGGGACTGTTGGCTGCTTGCAGCAGTTGCTTGTCTCAGTTTGCATTCTGA
ACTTTTTAATCAAGTCGTTCCTAGTGATCAGAATTTCTCCAAGCCCAGTT
ATTGCGGAATGTTTAGATTTAGGTTCTGGAGATTTGGCGCATGGAAAGAA
GTCTTGGTGGATGACAGGCTGCCAACATATAATAACAAATTGGTTTACAT
GCATTCAACAGATAGCAATGAATTTTGGTCTGCTTTATTGGAAAAAGCAT
ACGCAAAAATATCAGGATCCTATGAATCATTAAAAGGTGGATCAACAAGT
GAAGCATTGGAAGACTTTACCGGGGGAGTTACAGAATTTTTCGATATGAA
AAAAGAAGTTCCAAAAAATCTATTTGATATAATGTTTAAAGCATTCAGTC
GATGTTCTTTAATGGGTTGTTCTATTGAAGCCGATCCCAGAAAGACCGAG
GCGCAACTTCCAAATGGTTTGATTATGGGACATGCATATTCAATAACTGA
CGTGAAAATGGTCAATATAAATATACCTGGAAAATCCGGCAAAATCCAGT
TGATTCGAATTAGAAATCCTTGGGGAAATGAAGCTGAATGGAAAGGTTCT
TGGAGTGATAAAAGTCCTGAATGGAACTATATTTCTCAAGCTGATCGAAA
CACTATGGGGCTGACCTTCGATGATGATGGAGAATTCTGGATGTCTTATC
AGGATTTCATTAAAAACTTTGAGAAAATGGAAATATGCCATCTGGGTCCA
CAATCTCTTGAGGCTGATCAATTAGGCGGGAAAAAGAAATCTCGCTGGGA
AATGTGTATTGAAAATGGAGAATGGAAAAAACGATTAAATGCTGGAGGCT
GTAGAAACTTTTTAGATACATTTTGGACAAATCCACAATTCCGAGTTAAA
GTGGTTGATCCAGATGAAGATGACGACGAGAATCTCGGAACAATTATTAT
TGGATTAATGCAGAAGGATATGCGCAAACGTCGTAAGGAAGGAGTTGAAT
TTTATACAATTGGTTATGCAATTTATCAATTAAAAGATGAAAATCAGGGA
CCTTTAGATATTAACTATTTTAAATATAACGGCTCAGTTGCAAAGGCACC
GTCTTTTATAAACCTTCGAGAAGTTTGTGGTCGACACAAATTACCACCTG
GAACATATGTTATTGTTCCTTCAACATTTGAACCTAATCAGGAAGCATCA
TTCCTTATGAGAATTTTCTCTGAGAAACCAAATGAATCTGGTGAACTTGA
TGAACAAACAGCTATGATTCCTACAGAGAGTAATCCAGTAGTCAGTAACA
CTGCTACTCCAGTGCCAGAGAAAGTCGTCAGTCCAGCTGATGATGCACAA
ATTATGGCGCTGCGACAGTCATTCAACCAAATCGCTGGGCAAGATCTGGA
AATCGATGCATACGAATTGCAGGATATTTTGAATACCGCATTCAAGAAAG
GAGTAACGAGAGCCGGAATGGAGGTTAATCCAGCAAATTTCAAATTTGAT
GGATTTAGTATTGAAACTTCAAAAAGCATGGTTGCCATGATGGATTATGA
TCAATCTGGAAAATTGGGATTCGATGAATTTAAAGTTCTCTGGACTGATT
TACGTTTATGGAAGGAAGCTTTTAAAAAGTTCGATCAGGATAAAAGTGGA
AACTTTAATTCATACGAATTGAGACTTTGTCTTAATTCCGTAGGTTTCCG
GTTGAGTAACAAGATTCTAAACAGTCTCGTTATGCGCTTTGCCAACAAGG
AAGGCTTGGTTTTATTTGATGATTATATTCTGTGCTGTGTTCGACTGAAG
ACTATTTTCGAGACATACAAGAGTCAGCCTCATGATTCTAAAGATCGAGC
AATGTTTGATCAAGATACGTTTATTCAATGCATCATGTACGTCTGAGAAA
TTCTAAATGAACTAATCGAAAATGGAATTATTTAAAAATTTAGTTATCTT
ACCATTTCATGTGCTTGCTG
back to top

protein sequence of SMED30006773-orf-1

>SMED30006773-orf-1 ID=SMED30006773-orf-1|Name=SMED30006773-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=796bp
MPYVSTRTVRTIKYSGGGVPEVTTTTTTIDNGDKKTITVQGNDFGGIPIG
SAKFQTPRSNVIKPAVIGDGSNVPVRPTGSHAGDAVPEGRGGASVGPSQD
YNNVKNSLRGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFI
SEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCG
MFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAK
ISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCS
LMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIR
IRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDF
IKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRN
FLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYT
IGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTY
VIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTAT
PVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVT
RAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRL
WKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGL
VLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR033883C2_III
IPR038765Papain-like_cys_pep_sf
IPR036213Calpain_III_sf
IPR022684Calpain_cysteine_protease
IPR002048EF_hand_dom
IPR022683Calpain_III
IPR001300Peptidase_C2_calpain_cat
IPR022682Calpain_domain_III
IPR011992EF-hand-dom_pair
IPR000169Pept_cys_AS
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: molecular function
TermDefinition
GO:0004198calcium-dependent cysteine-type endopeptidase activity
GO:0005509calcium ion binding
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022684Peptidase C2, calpain familyPRINTSPR00704CALPAINcoord: 161..177
score: 72.16
coord: 253..280
score: 66.55
coord: 198..223
score: 59.87
coord: 97..120
score: 27.22
coord: 544..572
score: 62.07
coord: 137..159
score: 58.12
coord: 444..461
score: 72.41
coord: 389..410
score: 61.52
coord: 228..251
score: 71.67
IPR001300Peptidase C2, calpain, catalytic domainSMARTSM00230cys_prot_2coord: 96..421
e-value: 9.1E-181
score: 616.5
IPR001300Peptidase C2, calpain, catalytic domainPFAMPF00648Peptidase_C2coord: 113..411
e-value: 2.2E-130
score: 434.0
IPR001300Peptidase C2, calpain, catalytic domainPROSITEPS50203CALPAIN_CATcoord: 112..413
score: 80.366
IPR001300Peptidase C2, calpain, catalytic domainCDDcd00044CysPccoord: 108..411
e-value: 5.40866E-139
score: 411.34
IPR002048EF-hand domainSMARTSM00054efh_1coord: 670..698
e-value: 1.6
score: 16.0
coord: 700..728
e-value: 0.14
score: 21.3
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 666..692
score: 5.866
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 696..731
score: 11.473
IPR022683Peptidase C2, calpain, domain IIISMARTSM007202calcoord: 429..578
e-value: 5.9E-65
score: 231.8
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 618..795
e-value: 8.6E-46
score: 157.8
NoneNo IPR availableGENE3DG3DSA:2.60.120.380coord: 429..581
e-value: 5.4E-56
score: 190.8
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 273..423
e-value: 6.8E-52
score: 176.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 79..100
NoneNo IPR availablePANTHERPTHR10183CALPAINcoord: 99..763
NoneNo IPR availablePANTHERPTHR10183:SF396CALPAIN-A-RELATEDcoord: 99..763
NoneNo IPR availableCDDcd16196EFh_PEF_CalpA_Bcoord: 617..794
e-value: 4.3427E-81
score: 254.819
IPR022682Peptidase C2, calpain, large subunit, domain IIIPFAMPF01067Calpain_IIIcoord: 437..574
e-value: 3.6E-48
score: 163.4
IPR000169Cysteine peptidase, cysteine active sitePROSITEPS00139THIOL_PROTEASE_CYScoord: 161..172
IPR033883Calpain subdomain IIICDDcd00214Calpain_IIIcoord: 429..580
e-value: 4.15949E-56
score: 187.121
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 608..793
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 108..421
IPR036213Calpain large subunit, domain III superfamilySUPERFAMILYSSF49758Calpain large subunit, middle domain (domain III)coord: 430..581