Hemocytin

Overview
NameHemocytin
Smed IDSMED30006765
Length (bp)5302
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hemocytin (SMED30006765) t-SNE clustered cells

Violin plots show distribution of expression levels for Hemocytin (SMED30006765) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hemocytin (SMED30006765) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hemocytin (SMED30006765) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006765

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30006765SMESG000025547.1 SMESG000025545.1 SmedASXL_004582SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30006765SMESG000025547.1 SMESG000025545.1 SmedASXL_004582SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30006765SMESG000025547.1 SMESG000025545.1 Contig10526uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006765SMESG000025547.1 SMESG000025545.1 Contig10526newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006765SMESG000052241.1 SMESG000052069.1 SMESG000040582.1 SMESG000025545.1 SMESG000071376.1 SMESG000055178.1 SMESG000044360.1 SMESG000025547.1 SMESG000024583.1 SMESG000021657.1 SMESG000009751.1 SMESG000005594.1 Contig14068uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006765SMESG000052241.1 SMESG000052069.1 SMESG000040582.1 SMESG000025545.1 SMESG000071376.1 SMESG000055178.1 SMESG000044360.1 SMESG000025547.1 SMESG000024583.1 SMESG000021657.1 SMESG000009751.1 SMESG000005594.1 Contig14068newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30006765SMESG000025547.1 dd_Smed_v4_35076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006765SMESG000025547.1 dd_Smed_v4_35076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30006765SMESG000025547.1 dd_Smed_v6_35076_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30006765SMESG000025547.1 dd_Smed_v6_21309_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30006765SMESG000025547.1 OX_Smed_1.0.05552ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30006765SMESG000025545.1 SMESG000025547.1 OX_Smed_1.0.05553ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hemocytin vs. Ensembl Human
Match: MUC2 (mucin 2, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7512])

HSP 1 Score: 471.085 bits (1211), Expect = 3.453e-137
Identity = 365/1272 (28.69%), Postives = 570/1272 (44.81%), Query Frame = 2
Query:  653 TKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFL----GLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEF--MKYWKNPDPI--DPNTYYTTG-----RDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNG---TYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRL--LYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDP---KCPNGMEYMECKNLCSVSCFSLTQTNCSTEC------IDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTK--------------NDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKT-CVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGK--GIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC----PP---EKTFKTCINDCPKKC-----FKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFT--ENCLICVC-NENNFKCRPDPKCITSTT 4285
            T+   + +CS  G  +  TFDG     P         DC   + SY+ F       P +         ++ T  +   +L     + N +  S  +Y   +  +    + ++     L ++++ +  + +      +   CGLCG ++G  S S EF  ++   + +  EF  M+    PD +  DP            R  C  L   L   A   CQD          ++P+ PY   C+ + C C   G +  VC+ +A     F S QC+   G+  NWR+    P+ CP N  Y E GS C   C  L     C+     GCFCP+   ++    + CVP  QC C R +G+   +Y  G     DCE C C+  G + C  +  C GTC + G  H TTFD +     G C+Y +         N    +  +   C  ++   C K++ L      N    +  +  ++L+N++   LP  +     +      H  V +     +++      Q+ +TL +  Q QVQGLCGN+NG   DD   +SG +       A +W A + C   L       C+ + E   +A+ +C  L     PF  CH +VDP  + ++C++D C C  NE  +C C +++SY RAC   G+ L      +C+     CPN   ++     C  +C SL++ +  + C      +DGC C  +   D    +CV +++C C H   Y  +G     +   C C +G   C +               DCSN+T     K          +C+          C SGC CPDG +   +  CV + +CPC+ ++  Y + + I     +C + CTC  G+W C Q   C G+C  +G  HY TFDGKY+DF   CSYV V   CG+   +G F ++TEN+ CG  G +C+K+I  +     ++L    R  +  +E +         + R++   L++ + + II+ WDK  ++ I L P Y+  VCGLCGNFD   NNDF ++     ++ L F +SWK    CP     P+ C  N  R++WA+K C  +K+  F+ C   VD + +Y+ C+ D+CSCD GGDCEC C+A++++   C K G    WR+ +LCP+ C    PP   E  ++ C N   + C       SN++ + LE C   C +        I  E   KCV  ++C C +   D  Y PG      E C  CVC N +   CRP+   I + T
Sbjct:   29 TRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDC---RGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYS-EF--LSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERL---LTAEAFADCQD----------LVPLEPYLRACQQDRCRC--PGGDTCVCSTVA----EF-SRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHC-RLHGH---LYTPGQEITNDCEQCVCN-AGRWVCKDLP-CPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKGD----HNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFK--SDGSVLLNELQVNLP-HVTASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCHDKLDW-LDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNE--DCLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEAD--SHCLEGFAPVDGCGCPDHTFLDEK-GRCVPLAKCSCYHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRA------LSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKI---KVDC-NTCTCKRGRWVCTQ-AVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGH-----HVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPK-----DRPIYEEDLKKCVTADKCGCYV--EDTHYPPGASVPTEETCKSCVCTNSSQVVCRPEEGKILNQT 1232          

HSP 2 Score: 64.6994 bits (156), Expect = 1.876e-9
Identity = 87/375 (23.20%), Postives = 143/375 (38.13%), Query Frame = 2
Query:  530 GTGICVEPNVCQCPENFRGRNCETFFR-EPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCP-TKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRS-QLC--------APRECPANKEYSECGSSCSQNCEDL-ITDENCKSFCTAGCF--CPKDR 1609
            G G CV    C C  N    +     + + NT   K    + T+   +  CSI G  +  TFDG   +     S + V D   +  S   F   + N P     V C  ++ I      +            +  +  +   + +G +  ++    + +++D +  VFI    + K +VCGLCG FD  S  +++F   +   + +  +F   WK   P  P+   +T  + C+ LN    + A   C  +     S C + +   P+   C  + C C   G     C+ +A       + +CT  G  + WR+  LC         P EC     Y  CG+   + C  +     N       GC+  CPKDR
Sbjct:  810 GRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRS--NNDFTTRDHMVVSSELDFGNSWKEA-PTCPDV--STNPEPCS-LNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVAS-----YAQECTKEGACVFWRTPDLCPIFCDYYNPPHEC--EWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPKDR 1171          
BLAST of Hemocytin vs. Ensembl Human
Match: MUC2 (mucin 2, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7512])

HSP 1 Score: 470.7 bits (1210), Expect = 3.469e-135
Identity = 362/1264 (28.64%), Postives = 563/1264 (44.54%), Query Frame = 2
Query:  653 TKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFL----GLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEF--MKYWKNPDPI--DPNTYYTTG-----RDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNG---TYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRL--LYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDP---KCPNGMEYMECKNLCSVSCFSLTQTNCSTEC------IDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTK--------------NDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKT-CVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGK--GIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC----PP---EKTFKTCINDCPKKC-----FKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFT--ENCLICVC-NENNFKCRPD 4261
            T+   + +CS  G  +  TFDG     P         DC   + SY+ F       P +         ++ T  +   +L     + N +  S  +Y   +  +    + ++     L ++++ +  + +      +   CGLCG ++G  S S EF  ++   + +  EF  M+    PD +  DP            R  C  L   L   A   CQD          ++P+ PY   C+ + C C   G +  VC+ +A     F S QC+   G+  NWR+    P+ CP N  Y E GS C   C  L     C+     GCFCP+   ++    + CVP  QC C R +G+   +Y  G     DCE C C+ G      K   C GTC + G  H TTFD +     G C+Y +         N    +  +   C  ++   C K++ L      N   +   +  ++L+N++   LP  +     +      H  V +     +++      Q+ +TL +  Q QVQGLCGN+NG   DD   +SG +       A +W A + C   L       C+ + E   +A+ +C  L     PF  CH +VDP  + ++C++D C C  NE  +C C +++SY RAC   G+ L      +C+     CPN   ++     C  +C SL++ +  + C      +DGC C  +   D    +CV +++C C H   Y  +G     +   C C +G   C +               DCSN+T     K          +C+          C SGC CPDG +   +  CV + +CPC+ ++  Y + + I        + CTC  G+W C Q   C G+C  +G  HY TFDGKY+DF   CSYV V   CG+   +G F ++TEN+ CG  G +C+K+I  +     ++L    R  +  +E +         + R++   L++ + + II+ WDK  ++ I L P Y+  VCGLCGNFD   NNDF ++     ++ L F +SWK    CP     P+ C  N  R++WA+K C  +K+  F+ C   VD + +Y+ C+ D+CSCD GGDCEC C+A++++   C K G    WR+ +LCP+ C    PP   E  ++ C N   + C       SN++ + LE C   C +        I  E   KCV  ++C C +   D  Y PG      E C  CVC N +   CRP+
Sbjct:   29 TRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDC---RGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYS-EF--LSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERL---LTAEAFADCQD----------LVPLEPYLRACQQDRCRC--PGGDTCVCSTVA----EF-SRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHC-RLHGH---LYTPGQEITNDCEQCVCNAGRWV--CKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKGD----HNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKN--VVVFKSDGSVLLNELQVNLP-HVTASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCHDKLDW-LDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNE--DCLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEAD--SHCLEGFAPVDGCGCPDHTFLDEK-GRCVPLAKCSCYHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRA------LSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVD----CNTCTCKRGRWVCTQ-AVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGH-----HVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPK-----DRPIYEEDLKKCVTADKCGCYV--EDTHYPPGASVPTEETCKSCVCTNSSQVVCRPE 1224          

HSP 2 Score: 117.087 bits (292), Expect = 2.845e-25
Identity = 138/537 (25.70%), Postives = 225/537 (41.90%), Query Frame = 2
Query: 3149 GCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECG-NKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRV-------KGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALP-PQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSW----KSRVNCP--------AAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWR--SNELCPVMCPPEKTFKTC--INDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIE-AEGSNKCVKENECFCKLP-NSDKKYNPGEIFTENCLICVCNE--NNFKCRPDPKCITSTTSYCI--GSKL--------TKCENGVC---ARICNGIPE-CSDGSD-EANCXXXXXXXXXXXXXQPHCIYEGRIMQIGEVIKLESCLSVTCTDR--------RIVETRQNCDKTCQPNYVLKLYPDKCCE 4603
            GC    +C   C  WGD HY TFDG Y+ +   C+YV+V+ +    +  F +  +N  C  N   SC +++   +  Q V LI+ V    M+ +     +         G   ++  ++ ++   +  +++ ++ GLS  + LP  ++ N   G CG      ++D    +G   +N  A  D W     S+ +CP         A  VP   K+   +      +C  +K+  FA C  +V  + YY  C+ D+C    G   E  C +L A+ + C +  I   WR  ++  C V CP  + ++ C    +   K   S  NNTVL       VEGC CP   +  A G + CVK   C C  P N  +++  GE F  +C  CVC E  +   C+P  +C     ++C+  G+ L        T C   VC     +C   P  C  G + ++     +        ++  C++     Q G  +    C    CTD+         I  T   C+ +C P + L   P +CC+
Sbjct: 2108 GCCWHWECDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVE-EISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEV-LIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYN-GLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMP-GSSLE--CASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVL-------VEGCFCPEGTMNYAPGFDVCVK--TCGCVGPDNVPREF--GEHFEFDCKNCVCLEGGSGIICQPK-RCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWCESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCSPGFELMEAPGECCK 2626          

HSP 3 Score: 90.5077 bits (223), Expect = 3.329e-17
Identity = 111/463 (23.97%), Postives = 177/463 (38.23%), Query Frame = 2
Query: 1772 CSGTCVISGDPHYTTFDKRHIYVEGSCFYTMV-ATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDN--STFIQLVTTKNILVNKIPNRLP-----LQINDPLRLTIQEVAHDTVLIESYNG----IRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-----ATAECKSTLS------LSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSS--LCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQC-KSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWS--CTKNDCSN--VTFCPPGKEW--KECGHCDQTCENQDGFCLEKGCKS-GCFCPDGYLLSNKTCVPKHKCPCLW 3061
            C   C   GDPHY TFD  +   +G+C Y +V    PS+       +++ N HC  ++   C ++L ++    +    T   +     + VN+    LP     L++       + ++    VL+ SYNG    +R+ +H+           + +  +G CG     + DD    SGE+ +N    A  W     +   C  + S      ++  G    +   +      CQ +    F  CH  V P  +   C  D C   G+  +   C S+ +Y   C +  + L WR+ +   C  +CP+  EY  C      +C S +    +T  ++GC C +  M Y    + CV    C    +N     G   +  C +C C  G     C    CS   VT C     +   E    D  C      C    CK     CP G+ + +K  VP   CP  W
Sbjct: 2115 CDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDN---FGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLV-SYNGLSFSVRLPYHR-----------FGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSLE---CASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEGTMNYAPGFDVCVKTCGC-VGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKM-VPGRCCPFYW 2557          

HSP 4 Score: 64.6994 bits (156), Expect = 1.948e-9
Identity = 80/345 (23.19%), Postives = 133/345 (38.55%), Query Frame = 2
Query:  617 NTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCP-TKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRS-QLC--------APRECPANKEYSECGSSCSQNCEDL-ITDENCKSFCTAGCF--CPKDR 1609
            NT   K    + T+   +  CSI G  +  TFDG   +     S + V D   +  S   F   + N P     V C  ++ I      +            +  +  +   + +G +  ++    + +++D +  VFI    + K +VCGLCG FD  S  +++F   +   + +  +F   WK   P  P+   +T  + C+ LN    + A   C  +     S C + +   P+   C  + C C   G     C+ +A       + +CT  G  + WR+  LC         P EC     Y  CG+   + C  +     N       GC+  CPKDR
Sbjct:  840 NTCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRS--NNDFTTRDHMVVSSELDFGNSWKEA-PTCPDV--STNPEPCS-LNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVA-----SYAQECTKEGACVFWRTPDLCPIFCDYYNPPHEC--EWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPKDR 1171          

HSP 5 Score: 57.3806 bits (137), Expect = 3.097e-7
Identity = 83/380 (21.84%), Postives = 148/380 (38.95%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESV----TFLGLSNSSTNSNRNYISSIQHKNIG------DFNQIKGIGELEIL--YDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYY---TTGRDLCTGLNKDLVT-----TANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAP--RECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRF-WNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGG 1744
            C+  G  +  TFDG+        + +LV +      ++ ++ ++ Y+C   D V+C  +L++   ++ V      +         NR  ++ + +K  G        N +  I EL +L  Y+G              +  G CG     ++ S +    +GE + N       W   DP  P+  +   TT R   T       T     T + +CQ +     +QC  ++P   Y   C  +   C   G      +++ C+     +  C      ++WR+        ECP+++EY  CG +    C+   + +N  +    GCFCP+    +   + V    C C+   G   V    G  F+ DC+ C C +GG
Sbjct: 2119 CTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDN-YHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVA-LPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKGQCGTC--TNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFD--SCFMPG------SSLECASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQN-NTVLVEGCFCPEGTMNYAPGFDVCVKTCGCV---GPDNVPREFGEHFEFDCKNCVCLEGG 2482          
BLAST of Hemocytin vs. Ensembl Human
Match: MUC2 (mucin 2, oligomeric mucus/gel-forming [Source:NCBI gene;Acc:4583])

HSP 1 Score: 470.315 bits (1209), Expect = 8.695e-135
Identity = 362/1264 (28.64%), Postives = 563/1264 (44.54%), Query Frame = 2
Query:  653 TKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFL----GLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEF--MKYWKNPDPI--DPNTYYTTG-----RDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNG---TYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRL--LYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDP---KCPNGMEYMECKNLCSVSCFSLTQTNCSTEC------IDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTK--------------NDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKT-CVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGK--GIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC----PP---EKTFKTCINDCPKKC-----FKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFT--ENCLICVC-NENNFKCRPD 4261
            T+   + +CS  G  +  TFDG     P         DC   + SY+ F       P +         ++ T  +   +L     + N +  S  +Y   +  +    + ++     L ++++ +  + +      +   CGLCG ++G  S S EF  ++   + +  EF  M+    PD +  DP            R  C  L   L   A   CQD          ++P+ PY   C+ + C C   G +  VC+ +A     F S QC+   G+  NWR+    P+ CP N  Y E GS C   C  L     C+     GCFCP+   ++    + CVP  QC C R +G+   +Y  G     DCE C C+ G      K   C GTC + G  H TTFD +     G C+Y +         N    +  +   C  ++   C K++ L      N   +   +  ++L+N++   LP  +     +      H  V +     +++      Q+ +TL +  Q QVQGLCGN+NG   DD   +SG +       A +W A + C   L       C+ + E   +A+ +C  L     PF  CH +VDP  + ++C++D C C  NE  +C C +++SY RAC   G+ L      +C+     CPN   ++     C  +C SL++ +  + C      +DGC C  +   D    +CV +++C C H   Y  +G     +   C C +G   C +               DCSN+T     K          +C+          C SGC CPDG +   +  CV + +CPC+ ++  Y + + I        + CTC  G+W C Q   C G+C  +G  HY TFDGKY+DF   CSYV V   CG+   +G F ++TEN+ CG  G +C+K+I  +     ++L    R  +  +E +         + R++   L++ + + II+ WDK  ++ I L P Y+  VCGLCGNFD   NNDF ++     ++ L F +SWK    CP     P+ C  N  R++WA+K C  +K+  F+ C   VD + +Y+ C+ D+CSCD GGDCEC C+A++++   C K G    WR+ +LCP+ C    PP   E  ++ C N   + C       SN++ + LE C   C +        I  E   KCV  ++C C +   D  Y PG      E C  CVC N +   CRP+
Sbjct:   29 TRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDC---RGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYS-EF--LSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERL---LTAEAFADCQD----------LVPLEPYLRACQQDRCRC--PGGDTCVCSTVA----EF-SRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHC-RLHGH---LYTPGQEITNDCEQCVCNAGRWV--CKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKGD----HNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKN--VVVFKSDGSVLLNELQVNLP-HVTASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCHDKLDW-LDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNE--DCLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEAD--SHCLEGFAPVDGCGCPDHTFLDEK-GRCVPLAKCSCYHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRA------LSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVD----CNTCTCKRGRWVCTQ-AVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGH-----HVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPK-----DRPIYEEDLKKCVTADKCGCYV--EDTHYPPGASVPTEETCKSCVCTNSSQVVCRPE 1224          

HSP 2 Score: 116.701 bits (291), Expect = 3.470e-25
Identity = 137/536 (25.56%), Postives = 224/536 (41.79%), Query Frame = 2
Query: 3149 GCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECG-NKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRV-------KGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALP-PQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSW----KSRVNCP--------AAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWR--SNELCPVMCPPEKTFKTC--INDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIE-AEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNE--NNFKCRPDPKCITSTTSYCI--GSKL--------TKCENGVC---ARICNGIPE-CSDGSD-EANCXXXXXXXXXXXXXQPHCIYEGRIMQIGEVIKLESCLSVTCTDR--------RIVETRQNCDKTCQPNYVLKLYPDKCCE 4603
            GC    +C   C  WGD HY TFDG Y+ +   C+YV+V+ +    +  F +  +N  C  N   SC +++   +  Q V LI+ V    M+ +     +         G   ++  ++ ++   +  +++ ++ GLS  + LP  ++ N   G CG      ++D    +G   +N  A  D W     S+ +CP         A  VP   K+   +      +C  +K+  FA C  +V  + YY  C+ D+C    G   E  C +L A+ + C +  I   WR  ++  C V CP  + ++ C    +   K   S  NNTVL       VEGC CP   +  A G + CVK   C C  P++  +   GE F  +C  CVC E  +   C+P  +C     ++C+  G+ L        T C   VC     +C   P  C  G + ++     +        ++  C++     Q G  +    C    CTD+         I  T   C+ +C P + L   P +CC+
Sbjct: 4464 GCCWHWECDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVE-EISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEV-LIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYN-GLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMP-GSSLE--CASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVL-------VEGCFCPEGTMNYAPGFDVCVK--TCGCVGPDNVPR-EFGEHFEFDCKNCVCLEGGSGIICQPK-RCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWCESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCSPGFELMEAPGECCK 4982          

HSP 3 Score: 90.8929 bits (224), Expect = 2.596e-17
Identity = 111/463 (23.97%), Postives = 177/463 (38.23%), Query Frame = 2
Query: 1772 CSGTCVISGDPHYTTFDKRHIYVEGSCFYTMV-ATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDN--STFIQLVTTKNILVNKIPNRLP-----LQINDPLRLTIQEVAHDTVLIESYNG----IRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-----ATAECKSTLS------LSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSS--LCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQC-KSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWS--CTKNDCSN--VTFCPPGKEW--KECGHCDQTCENQDGFCLEKGCKS-GCFCPDGYLLSNKTCVPKHKCPCLW 3061
            C   C   GDPHY TFD  +   +G+C Y +V    PS+       +++ N HC  ++   C ++L ++    +    T   +     + VN+    LP     L++       + ++    VL+ SYNG    +R+ +H+           + +  +G CG     + DD    SGE+ +N    A  W     +   C  + S      ++  G    +   +      CQ +    F  CH  V P  +   C  D C   G+  +   C S+ +Y   C +  + L WR+ +   C  +CP+  EY  C      +C S +    +T  ++GC C +  M Y    + CV    C    +N     G   +  C +C C  G     C    CS   VT C     +   E    D  C      C    CK     CP G+ + +K  VP   CP  W
Sbjct: 4471 CDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDN---FGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLV-SYNGLSFSVRLPYHR-----------FGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSLE---CASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEGTMNYAPGFDVCVKTCGCV-GPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKM-VPGRCCPFYW 4913          

HSP 4 Score: 65.0846 bits (157), Expect = 1.697e-9
Identity = 80/345 (23.19%), Postives = 133/345 (38.55%), Query Frame = 2
Query:  617 NTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCP-TKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRS-QLC--------APRECPANKEYSECGSSCSQNCEDL-ITDENCKSFCTAGCF--CPKDR 1609
            NT   K    + T+   +  CSI G  +  TFDG   +     S + V D   +  S   F   + N P     V C  ++ I      +            +  +  +   + +G +  ++    + +++D +  VFI    + K +VCGLCG FD  S  +++F   +   + +  +F   WK   P  P+   +T  + C+ LN    + A   C  +     S C + +   P+   C  + C C   G     C+ +A       + +CT  G  + WR+  LC         P EC     Y  CG+   + C  +     N       GC+  CPKDR
Sbjct:  840 NTCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRS--NNDFTTRDHMVVSSELDFGNSWKEA-PTCPDV--STNPEPCS-LNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVA-----SYAQECTKEGACVFWRTPDLCPIFCDYYNPPHEC--EWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPKDR 1171          

HSP 5 Score: 57.7658 bits (138), Expect = 3.170e-7
Identity = 83/380 (21.84%), Postives = 148/380 (38.95%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESV----TFLGLSNSSTNSNRNYISSIQHKNIG------DFNQIKGIGELEIL--YDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYY---TTGRDLCTGLNKDLVT-----TANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAP--RECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRF-WNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGG 1744
            C+  G  +  TFDG+        + +LV +      ++ ++ ++ Y+C   D V+C  +L++   ++ V      +         NR  ++ + +K  G        N +  I EL +L  Y+G              +  G CG     ++ S +    +GE + N       W   DP  P+  +   TT R   T       T     T + +CQ +     +QC  ++P   Y   C  +   C   G      +++ C+     +  C      ++WR+        ECP+++EY  CG +    C+   + +N  +    GCFCP+    +   + V    C C+   G   V    G  F+ DC+ C C +GG
Sbjct: 4475 CTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDN-YHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVA-LPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKGQCGTC--TNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFD--SCFMPG------SSLECASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQN-NTVLVEGCFCPEGTMNYAPGFDVCVKTCGCV---GPDNVPREFGEHFEFDCKNCVCLEGG 4838          
BLAST of Hemocytin vs. Ensembl Human
Match: MUC2 (mucin 2, oligomeric mucus/gel-forming [Source:NCBI gene;Acc:4583])

HSP 1 Score: 470.315 bits (1209), Expect = 8.695e-135
Identity = 362/1264 (28.64%), Postives = 563/1264 (44.54%), Query Frame = 2
Query:  653 TKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFL----GLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEF--MKYWKNPDPI--DPNTYYTTG-----RDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNG---TYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRL--LYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDP---KCPNGMEYMECKNLCSVSCFSLTQTNCSTEC------IDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTK--------------NDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKT-CVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGK--GIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC----PP---EKTFKTCINDCPKKC-----FKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFT--ENCLICVC-NENNFKCRPD 4261
            T+   + +CS  G  +  TFDG     P         DC   + SY+ F       P +         ++ T  +   +L     + N +  S  +Y   +  +    + ++     L ++++ +  + +      +   CGLCG ++G  S S EF  ++   + +  EF  M+    PD +  DP            R  C  L   L   A   CQD          ++P+ PY   C+ + C C   G +  VC+ +A     F S QC+   G+  NWR+    P+ CP N  Y E GS C   C  L     C+     GCFCP+   ++    + CVP  QC C R +G+   +Y  G     DCE C C+ G      K   C GTC + G  H TTFD +     G C+Y +         N    +  +   C  ++   C K++ L      N   +   +  ++L+N++   LP  +     +      H  V +     +++      Q+ +TL +  Q QVQGLCGN+NG   DD   +SG +       A +W A + C   L       C+ + E   +A+ +C  L     PF  CH +VDP  + ++C++D C C  NE  +C C +++SY RAC   G+ L      +C+     CPN   ++     C  +C SL++ +  + C      +DGC C  +   D    +CV +++C C H   Y  +G     +   C C +G   C +               DCSN+T     K          +C+          C SGC CPDG +   +  CV + +CPC+ ++  Y + + I        + CTC  G+W C Q   C G+C  +G  HY TFDGKY+DF   CSYV V   CG+   +G F ++TEN+ CG  G +C+K+I  +     ++L    R  +  +E +         + R++   L++ + + II+ WDK  ++ I L P Y+  VCGLCGNFD   NNDF ++     ++ L F +SWK    CP     P+ C  N  R++WA+K C  +K+  F+ C   VD + +Y+ C+ D+CSCD GGDCEC C+A++++   C K G    WR+ +LCP+ C    PP   E  ++ C N   + C       SN++ + LE C   C +        I  E   KCV  ++C C +   D  Y PG      E C  CVC N +   CRP+
Sbjct:   29 TRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDC---RGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYS-EF--LSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERL---LTAEAFADCQD----------LVPLEPYLRACQQDRCRC--PGGDTCVCSTVA----EF-SRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHC-RLHGH---LYTPGQEITNDCEQCVCNAGRWV--CKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKGD----HNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKN--VVVFKSDGSVLLNELQVNLP-HVTASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCHDKLDW-LDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNE--DCLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEAD--SHCLEGFAPVDGCGCPDHTFLDEK-GRCVPLAKCSCYHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRA------LSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVD----CNTCTCKRGRWVCTQ-AVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGH-----HVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPK-----DRPIYEEDLKKCVTADKCGCYV--EDTHYPPGASVPTEETCKSCVCTNSSQVVCRPE 1224          

HSP 2 Score: 116.701 bits (291), Expect = 3.470e-25
Identity = 137/536 (25.56%), Postives = 224/536 (41.79%), Query Frame = 2
Query: 3149 GCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECG-NKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRV-------KGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALP-PQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSW----KSRVNCP--------AAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWR--SNELCPVMCPPEKTFKTC--INDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIE-AEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNE--NNFKCRPDPKCITSTTSYCI--GSKL--------TKCENGVC---ARICNGIPE-CSDGSD-EANCXXXXXXXXXXXXXQPHCIYEGRIMQIGEVIKLESCLSVTCTDR--------RIVETRQNCDKTCQPNYVLKLYPDKCCE 4603
            GC    +C   C  WGD HY TFDG Y+ +   C+YV+V+ +    +  F +  +N  C  N   SC +++   +  Q V LI+ V    M+ +     +         G   ++  ++ ++   +  +++ ++ GLS  + LP  ++ N   G CG      ++D    +G   +N  A  D W     S+ +CP         A  VP   K+   +      +C  +K+  FA C  +V  + YY  C+ D+C    G   E  C +L A+ + C +  I   WR  ++  C V CP  + ++ C    +   K   S  NNTVL       VEGC CP   +  A G + CVK   C C  P++  +   GE F  +C  CVC E  +   C+P  +C     ++C+  G+ L        T C   VC     +C   P  C  G + ++     +        ++  C++     Q G  +    C    CTD+         I  T   C+ +C P + L   P +CC+
Sbjct: 4464 GCCWHWECDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVE-EISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEV-LIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYN-GLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMP-GSSLE--CASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVL-------VEGCFCPEGTMNYAPGFDVCVK--TCGCVGPDNVPR-EFGEHFEFDCKNCVCLEGGSGIICQPK-RCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWCESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCSPGFELMEAPGECCK 4982          

HSP 3 Score: 90.8929 bits (224), Expect = 2.596e-17
Identity = 111/463 (23.97%), Postives = 177/463 (38.23%), Query Frame = 2
Query: 1772 CSGTCVISGDPHYTTFDKRHIYVEGSCFYTMV-ATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDN--STFIQLVTTKNILVNKIPNRLP-----LQINDPLRLTIQEVAHDTVLIESYNG----IRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-----ATAECKSTLS------LSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSS--LCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQC-KSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWS--CTKNDCSN--VTFCPPGKEW--KECGHCDQTCENQDGFCLEKGCKS-GCFCPDGYLLSNKTCVPKHKCPCLW 3061
            C   C   GDPHY TFD  +   +G+C Y +V    PS+       +++ N HC  ++   C ++L ++    +    T   +     + VN+    LP     L++       + ++    VL+ SYNG    +R+ +H+           + +  +G CG     + DD    SGE+ +N    A  W     +   C  + S      ++  G    +   +      CQ +    F  CH  V P  +   C  D C   G+  +   C S+ +Y   C +  + L WR+ +   C  +CP+  EY  C      +C S +    +T  ++GC C +  M Y    + CV    C    +N     G   +  C +C C  G     C    CS   VT C     +   E    D  C      C    CK     CP G+ + +K  VP   CP  W
Sbjct: 4471 CDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDN---FGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLV-SYNGLSFSVRLPYHR-----------FGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSLE---CASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEGTMNYAPGFDVCVKTCGCV-GPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKM-VPGRCCPFYW 4913          

HSP 4 Score: 65.0846 bits (157), Expect = 1.697e-9
Identity = 80/345 (23.19%), Postives = 133/345 (38.55%), Query Frame = 2
Query:  617 NTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCP-TKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRS-QLC--------APRECPANKEYSECGSSCSQNCEDL-ITDENCKSFCTAGCF--CPKDR 1609
            NT   K    + T+   +  CSI G  +  TFDG   +     S + V D   +  S   F   + N P     V C  ++ I      +            +  +  +   + +G +  ++    + +++D +  VFI    + K +VCGLCG FD  S  +++F   +   + +  +F   WK   P  P+   +T  + C+ LN    + A   C  +     S C + +   P+   C  + C C   G     C+ +A       + +CT  G  + WR+  LC         P EC     Y  CG+   + C  +     N       GC+  CPKDR
Sbjct:  840 NTCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRS--NNDFTTRDHMVVSSELDFGNSWKEA-PTCPDV--STNPEPCS-LNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVA-----SYAQECTKEGACVFWRTPDLCPIFCDYYNPPHEC--EWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPKDR 1171          

HSP 5 Score: 57.7658 bits (138), Expect = 3.170e-7
Identity = 83/380 (21.84%), Postives = 148/380 (38.95%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESV----TFLGLSNSSTNSNRNYISSIQHKNIG------DFNQIKGIGELEIL--YDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYY---TTGRDLCTGLNKDLVT-----TANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAP--RECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRF-WNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGG 1744
            C+  G  +  TFDG+        + +LV +      ++ ++ ++ Y+C   D V+C  +L++   ++ V      +         NR  ++ + +K  G        N +  I EL +L  Y+G              +  G CG     ++ S +    +GE + N       W   DP  P+  +   TT R   T       T     T + +CQ +     +QC  ++P   Y   C  +   C   G      +++ C+     +  C      ++WR+        ECP+++EY  CG +    C+   + +N  +    GCFCP+    +   + V    C C+   G   V    G  F+ DC+ C C +GG
Sbjct: 4475 CTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDN-YHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVA-LPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKGQCGTC--TNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFD--SCFMPG------SSLECASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQN-NTVLVEGCFCPEGTMNYAPGFDVCVKTCGCV---GPDNVPREFGEHFEFDCKNCVCLEGG 4838          
BLAST of Hemocytin vs. Ensembl Human
Match: MUC5AC (mucin 5AC, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7515])

HSP 1 Score: 457.988 bits (1177), Expect = 1.002e-130
Identity = 365/1270 (28.74%), Postives = 562/1270 (44.25%), Query Frame = 2
Query:  614 PNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYN--CPTKDFVNCDT-SLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDP--NTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDL-SQCTIL-PVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLI-NWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNG---TYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWH--QKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDP--KCPNGMEYMECKNLCSVSCFSLTQTN--CSTECI--DGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKN--------------DCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKT-CVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCG---KGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCP---PEKTFKTCINDCPKKCFKSNLNNTVLENCAKNC--VEGC--SCPTEY-IEAEGSNKCVKENECFCKLPN-------SDKKYNPGEIFT--ENCLICVCNENNFKC 4252
            P+   + +    N  +   ++CS  G  +  TFDG     P   + +    C +    + I    S     PT   V      ++I+    SV   G       S    +  IQ  +   + +++    L ++++   ++ +          CGLCG F+G   +S    +    +     EF    K  DP D   +      R+  TG           +C+++  G L S C  L  V  Y   CR +LC C +      VC  +A       S QCT  G L  +WR     P++CP N +Y EC S C+  C +      C+  C AGCFCP+    +    T CVP  +C C+  NG     Y  G ++  DC  C CS GG ++C ++  C GTC + G  H++TFD +   V G C Y  V TKP    +    +  +   C  ++   C KS++L        T + +  +  + +N+I  +LP+   +   +TI   +   ++ ++  G+++        Q+ + L    + Q  GLCGN+N    DD    SG +         ++ T      +  S+   C+ S E EK+A+ +C +L     PF  CH +V P  +   C  D C C     ++C C +++SY  AC   G+ L  WR      P   CP  M Y    + C  +C SL++ +  CS   I  DGC C      D    +CV  S C C H  +  P+G +  +    C CT+G  SC                 DC N T   PG        C ++C   D  C    C  GC CPDG +   +  C+    CPC+ ++ SY     I  G     + CTC+   W C  +  C+ +C  +GD HY TFDG+ + F   C Y +V + CG        F++VTEN+ CG  GT+C+K+I  +     ++L  G    +  +E+      +   + R +   L++ TD  ++L WDK  SI I L P+++ +VCGLCGNFD    NDF +++ +   ++L F +SWK   +CP A    D C +N  R++WA K C  +    FA C   V+   YY+ C++D C+CD GGDCEC CTA++A+  AC + G+  SWR+  +CP+ C    PE   +     C   C ++  N     +C ++   +EGC   CP E  I  E   +CV      C  P          K Y PG +    +NC  C+C E   +C
Sbjct:   61 PSLRTIPVVRASNPAHNG-RVCSTWGSFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNIQLRRSQESAAPTLSRVLMKVDGVVIQLTKGSVLVNGHPVLLPFSQSGVL--IQQSS--SYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSH---NTKLTPMEFGNLQKMDDPTDQCQDPVPEPPRNCSTGFG---------ICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCEDTDLLSCVCHTLA-----EYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSPCADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACV-YNG---AAYAPGATYSTDCTNCTCS-GGRWSCQEVP-CPGTCSVLGGAHFSTFDGKQYTVHGDCSY--VLTKPC--DSSAFTVLAELRRCGLTDSETCLKSVTLSLDGAQ--TVVVIKASGEVFLNQIYTQLPISAAN---VTIFRPSTFFIIAQTSLGLQLNLQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTFKTQAACPNIRNSFEDPCSLSVENEKYAQHWCSQLTDADGPFGRCHAAVKPGTYYSNCMFDTCNC--ERSEDCLCAALSSYVHACAAKGVQLGGWRDGVCTKPMTTCPKSMTYHYHVSTCQPTCRSLSEGDITCSVGFIPVDGCICPKGTFLDD-TGKCVQASNCPCYHRGSMIPNGESVHDSGAICTCTHGKLSCIGGQAPAPVCAAPMVFFDCRNAT---PGDTG---AGCQKSCHTLDMTCYSPQCVPGCVCPDGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVG----CNTCTCDSRMWRC-TDDPCLATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKVEVIGTDESQ-----EVPYTIRQMGIYLVVDTDIGLVLLWDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACACDSGGDCECFCTAVAAYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNP--RGDCLRDVRGLEGCYPKCPPEAPIFDEDKMQCVAT----CPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVEC 1268          

HSP 2 Score: 108.612 bits (270), Expect = 1.052e-22
Identity = 96/377 (25.46%), Postives = 156/377 (41.38%), Query Frame = 2
Query: 3182 CKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRD---LVSQLIIYTDSD----IILYWDKGLSIEIALPPQYQNQVCGLCGNFD------QNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVK-FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYG-IDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPT-EYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDP 4264
            C +WG  HYKTFDG  F F   C+YV  +  CG     F +     +           +       V+QL +G    V+ N  +P       + F     L+ Q   YT  +    ++L W+   S+ + L  +Y N+ CGLCG+F+      + L+++ K     + N  L  +D    +   P  +  P  C +          +C  + + + F+ C  +VD   Y + C  D C C+      C+C  L+ +   C   G +   WR  + CP  CP    +  C + C   C  SN  ++    C  +CV GC CP    ++  G   CV  ++C C    +   Y PG  ++ +C  C C+   + C+  P
Sbjct:   81 CSTWGSFHYKTFDGDVFRFPGLCNYVFSE-HCGAAYEDFNIQLRRSQ--ESAAPTLSRVLMKVDGVVIQLTKG---SVLVN-GHPV-----LLPFSQSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGN--LQKMDDPTDQCQDPVPEP-PRNCSTGF-------GICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCEDTDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSPCADTC--SNQEHS--RACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVY--NGAAYAPGATYSTDCTNCTCSGGRWSCQEVP 429          

HSP 3 Score: 103.605 bits (257), Expect = 3.554e-21
Identity = 94/409 (22.98%), Postives = 153/409 (37.41%), Query Frame = 2
Query: 3149 GCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNK-GTSCTKSIFFYYRNQVVQLIRGVRPKVMENENY-------PKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALP-PQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWK-------------------------SRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYG--IDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEY-IEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNF--KCRP 4258
            GC    +C   C  WGD HY TFDG Y+ F+  C+YV+V        G F+++ +N  CG + G SC +SI   Y    V L R     VM NE         P  R  G +  R  V       +  + + +  GL   + +P  ++ N   G CG    +  ++ ++  G    +       W                          S    P       +  +          +C  + +  F  C  V+   L+Y+ C+ D C      D + +C++L  + + C  +   ID+  R+  +CP  CP +K ++ C    P  C+ ++  +      A    EGC CP    + +  +  CV      C  P+ +     G     +C  C C    +   CRP
Sbjct: 4910 GCCHHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVMF-SGLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPICQLILSKVFEPCHTVIPPLLFYEGCVFDRCHMT---DLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGE-PVKVGHTVGMDCQECTCEAATWTLTCRP 5312          

HSP 4 Score: 62.3882 bits (150), Expect = 1.108e-8
Identity = 79/396 (19.95%), Postives = 141/396 (35.61%), Query Frame = 2
Query: 1796 GDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTD---NSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKT-QIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW---------------------ATAECKSTLSLSYLG---VCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKD-NCACESMASYGRACMKNGLTLKW--RSSSLCDPKCPNGMEYMECKNLCSVSCF-----SLTQTNCSTECIDGCQCKSNM-VYDTAVNQCVNI--SQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCT 2866
            GDPHY TFD  +     +C Y +V     + G+   ++ V N  C   +   C +S+ L++           +  V T  I+ N        + N    + +  +           G+++++      +E+   +F  +  +G CG    + +D+     G +  + +E++  W                      T    +T+  + +G   V   +          CQ +L + F  CH  + P  F + C  D C    +  D +  C S+  Y   C  + + + W  R+  +C   CP    Y  C       C+     SL     +    +GC C   M ++ T+   CV     +C   H       G T    C +C C    W+ T
Sbjct: 4925 GDPHYITFDGTYYTFLDNCTYVLVQQIVPVYGH--FRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNG---IVVSRIGVKMYATIPELGVQVMFSGLIFSVEVPFSKF-ANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPICQLILSKVFEPCHTVIPPLLFYEGCVFDRC----HMTDLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVK-VGHTVGMDCQECTCEAATWTLT 5309          
BLAST of Hemocytin vs. Ensembl Celegans
Match: T01D3.1 (pep chromosome:WBcel235:V:13689892:13703330:1 gene:WBGene00011326.1 transcript:T01D3.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T01D3.1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.096e-16
Identity = 42/110 (38.18%), Postives = 56/110 (50.91%), Query Frame = 2
Query:  272 CCNGWTGTDCQFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQG-CIRGKC-KNGDCLCDSGYEGERCDRAFCQYGCGTGICVEPNVCQCPENFRGRNC 595
            C +GW+G+DC  P C   C   G+CI+P+ C+CD  + G  CS        CI   C  G C  NG C C+ G++G RC    C      GIC  P  C C E++ G +C
Sbjct: 1157 CNDGWSGSDCSIPRCLTNCTGHGKCIQPNSCECDAGWMGETCSV-----TSCIDSQCTHGHCGTNGLCKCEDGWQGSRCQIPLCNSCSLNGICTRPGFCSCFEDYGGSDC 1261          

HSP 2 Score: 52.7582 bits (125), Expect = 3.493e-6
Identity = 45/157 (28.66%), Postives = 70/157 (44.59%), Query Frame = 2
Query:  269 KCCNGWTGTDCQFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADE-KPCIQGCIRGKCK--NGDCLCDSGYEGERCDRAFCQYGCGTGICVEPNVCQCPENFRGRNCETFFREPNTSNLK-ISDVINTKYKDYQLCSIMGGSYVTTFDGISI 727
            KC +GW G+ CQ P+C   C   G C  P  C C   + G+DCS  + D  + C   C  G C+     C C  G+ G  CD       C  G C         EN    + + ++ +P T+ L+ ++ V+N   + + + +    SY+ TF   S+
Sbjct: 1220 KCEDGWQGSRCQIPLCNS-CSLNGICTRPGFCSCFEDYGGSDCSKCVGDSCEACDFDCNHGICEPLTKTCSCAKGWMGGACDV------CSIGKC---------EN----SSQIYYIQPPTAELEDVNTVVNVFGEGFPITN--NNSYICTFGRTSV 1354          
BLAST of Hemocytin vs. Ensembl Celegans
Match: T01D3.6 (pep chromosome:WBcel235:V:13716824:13720402:1 gene:WBGene00011330.1 transcript:T01D3.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T01D3.6)

HSP 1 Score: 72.7886 bits (177), Expect = 1.934e-12
Identity = 99/427 (23.19%), Postives = 171/427 (40.05%), Query Frame = 2
Query: 3110 NCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMV------------------DSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALP--PQYQNQ--VCGLCGNFDQNLNNDFKSKAGNY---------ENN----ILAFVDSW---KSRVNCPAAKDVPDMCKSNHERQ---AWADKMCGTMKNVK-----FADCQKVVDTEL--YYQKCLSDTCSCDRGGDCECLCTALSAFYSACK----KYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYI---EAEGSNKCVKENECFCKLPNSDKKYNPGEIF-TENCLI 4222
            NC+ K      + G + + K   +C S GD HY T+DG  FD+   C YV                    +   GKG    ++    ++  N     T  +    +  +V  ++ + P    N+N    RV      R   S   I  D  +++ +    S+ + +P  P++     +CGL GN D    +D  +K G+          ENN     +   D+W   K  +  P  ++  +    ++      A A + C  ++  +     F  CQ + +  L  +Y  C+ D C      +    CT  + F   C+    +  ++ +WR+   CP+ CP      TC + CP  C +        E C + CV+GC C   Y+      GS KC++ ++C C + +    + PG+ + T+NC I
Sbjct:  165 NCICKPGYTARRNGRDCDMKVQQACMS-GDPHYVTYDGLRFDYQGTCPYVFSQPCTTLPAPYLWYSVRAKNELPGKGYHISQVSEVEVDLHN----LTIHVDGRSKTALVNGVQVLTPWYFPNKNTWTVRV------RFSGSTFTIENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNNTNCDVATASQTCYPIQQAEMGLGTFGACQGLGNDTLEDFYYNCIYDICR-----NPAFKCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACPLNAHPSTCTSSCPSTCAEP-----FPEYCDQGCVDGCECDPGYVIDNTVTGSIKCIRLDQCGC-VDSDGNAHRPGKPWVTQNCTI 569          

HSP 2 Score: 55.8398 bits (133), Expect = 3.390e-7
Identity = 97/459 (21.13%), Postives = 154/459 (33.55%), Query Frame = 2
Query: 1790 ISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQ-EVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQ----DQVQGLCGNYNGNSEDD---------ATKSSGELTTN--------------DNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCH-MSVDP-NPFIQQCEHDICLCGGNEKDNCACESMASYGRACM----KNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVN---QCVNISQCQC--SHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKC 3049
            +SGDPHY T+D      +G+C Y  V ++P  T       +            Y    +S    D  N T      +K  LVN +    P    +    T++   +  T  IE+  G+ + +     + + +P+  +      + GL GN +G   DD         A KSS +   N              D  L +      C +  +L     C  +   +         +    F +C  +  D    F   C +DIC           C     + + C     +  +   WR+   C   CP       C + C  +C       C   C+DGC+C    V D  V    +C+ + QC C  S  NA+ P      + C              ++C N      G  W +   C     + DG C+       C C +GY      C   ++C
Sbjct:  190 MSGDPHYVTYDGLRFDYQGTCPY--VFSQPCTTLPAPYLWYSVRAKNELPGKGYHISQVSEVEVDLHNLTIHVDGRSKTALVNGVQVLTPWYFPNKNTWTVRVRFSGSTFTIENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNNTNCDVATASQTCYPIQQAEMGLGTFGACQGLGNDTLEDFYYNCIYDIC-----RNPAFKCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACPLNAHPSTCTSSCPSTCAEPFPEYCDQGCVDGCECDPGYVIDNTVTGSIKCIRLDQCGCVDSDGNAHRPGKPWVTQNCT-----------IYHECQN------GTMWSDYRPC-----SDDGSCVLNSIDMQCKCNNGYRGDGYNCTDINEC 619          
BLAST of Hemocytin vs. Ensembl Celegans
Match: T01D3.6 (pep chromosome:WBcel235:V:13716849:13720402:1 gene:WBGene00011330.1 transcript:T01D3.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T01D3.6)

HSP 1 Score: 70.0922 bits (170), Expect = 1.311e-11
Identity = 101/439 (23.01%), Postives = 173/439 (39.41%), Query Frame = 2
Query: 3110 NCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMV------------------DSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALP--PQYQNQ--VCGLCGNFDQNLNNDFKSKAGNY---------ENN----ILAFVDSW---------KSRVNCPAAKDVPD----MCKSNHERQAWAD-----KMCGTMKNVK-----FADCQKVVDTEL--YYQKCLSDTCSCDRGGDCECLCTALSAFYSACK----KYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYI---EAEGSNKCVKENECFCKLPNSDKKYNPGEIF-TENCLI 4222
            NC+ K      + G + + K   +C S GD HY T+DG  FD+   C YV                    +   GKG    ++    ++  N     T  +    +  +V  ++ + P    N+N    RV      R   S   I  D  +++ +    S+ + +P  P++     +CGL GN D    +D  +K G+          ENN     +   D+W           + NC   + + +    +  S    Q+ AD     + C  ++  +     F  CQ + +  L  +Y  C+ D C      +    CT  + F   C+    +  ++ +WR+   CP+ CP      TC + CP  C +        E C + CV+GC C   Y+      GS KC++ ++C C + +    + PG+ + T+NC I
Sbjct:  165 NCICKPGYTARRNGRDCDMKVQQACMS-GDPHYVTYDGLRFDYQGTCPYVFSQPCTTLPAPYLWYSVRAKNELPGKGYHISQVSEVEVDLHN----LTIHVDGRSKTALVNGVQVLTPWYFPNKNTWTVRV------RFSGSTFTIENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNNTNCVSTSISLAQSCADVATASQTCYPIQQAEMGLGTFGACQGLGNDTLEDFYYNCIYDICR-----NPAFKCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACPLNAHPSTCTSSCPSTCAEP-----FPEYCDQGCVDGCECDPGYVIDNTVTGSIKCIRLDQCGC-VDSDGNAHRPGKPWVTQNCTI 581          

HSP 2 Score: 56.225 bits (134), Expect = 2.467e-7
Identity = 100/472 (21.19%), Postives = 157/472 (33.26%), Query Frame = 2
Query: 1790 ISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQ-EVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQ----DQVQGLCGNYNGNSEDDATKSSGELTT--------NDNELAV-----SWAT----------------------AECKSTLSLSYLGVCAKSYEYEKFAKEFCQ-RLLYEPFNSCH-MSVDP-NPFIQQCEHDICLCGGNEKDNCACESMASYGRACM----KNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVN---QCVNISQCQC--SHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKC 3049
            +SGDPHY T+D      +G+C Y  V ++P  T       +            Y    +S    D  N T      +K  LVN +    P    +    T++   +  T  IE+  G+ + +     + + +P+  +      + GL GN +G   DD    +G +          N+N         +W T                        C ST S+S    CA      +      Q  +    F +C  +  D    F   C +DIC           C     + + C     +  +   WR+   C   CP       C + C  +C       C   C+DGC+C    V D  V    +C+ + QC C  S  NA+ P      + C              ++C N      G  W +   C     + DG C+       C C +GY      C   ++C
Sbjct:  190 MSGDPHYVTYDGLRFDYQGTCPY--VFSQPCTTLPAPYLWYSVRAKNELPGKGYHISQVSEVEVDLHNLTIHVDGRSKTALVNGVQVLTPWYFPNKNTWTVRVRFSGSTFTIENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNNTNCVST-SISLAQSCADVATASQTCYPIQQAEMGLGTFGACQGLGNDTLEDFYYNCIYDIC-----RNPAFKCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACPLNAHPSTCTSSCPSTCAEPFPEYCDQGCVDGCECDPGYVIDNTVTGSIKCIRLDQCGCVDSDGNAHRPGKPWVTQNCT-----------IYHECQN------GTMWSDYRPC-----SDDGSCVLNSIDMQCKCNNGYRGDGYNCTDINEC 631          
BLAST of Hemocytin vs. Ensembl Celegans
Match: apx-1 (Anterior pharynx in excess protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41990])

HSP 1 Score: 66.6254 bits (161), Expect = 1.067e-10
Identity = 46/131 (35.11%), Postives = 59/131 (45.04%), Query Frame = 2
Query:  266 RKCCNGWTGTDCQFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCI--QGCIRGKCKN---GDCLCDSGYEGERCD--------RAFCQYGCGTGICVEPNV------CQCPENFRGRNCET 601
            R+C  GW+G DC  PIC   C N GRC+ P++C C   F+G  C       + C+   GC+ G C N     C C  G+ G+RCD           C  G   GIC   +       C CP  F G  C+T
Sbjct:  161 RRCSAGWSGEDCSNPICAGGCSNRGRCVAPNQCSCADGFNGTRC-------EQCLPRAGCVNGDCVNETPNTCKCRDGFIGDRCDIDIKICSLEKPCANG---GICSIDSSSSTGYKCHCPFEFVGSQCKT 281          
BLAST of Hemocytin vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 64.3142 bits (155), Expect = 1.051e-9
Identity = 41/117 (35.04%), Postives = 54/117 (46.15%), Query Frame = 2
Query:  269 KCCNGWTGTDCQFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGC-IRGKC-KNGDCLCDSGYEGERCDRAFCQYGC-GTGIC-----VEPNVCQCPENFRGRNC 595
            +C +GW   DC    CQ  C NG  C++   CQC   + G++C+     +K C  GC  RGKC  +G C C SG+ GE C    C   C G G C          C+C     G +C
Sbjct:  462 QCESGWDSVDCSQQACQ--CVNGD-CLDDGSCQCWKGWRGSNCT-----DKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSEWSCRCQAGSTGVDC 570          

HSP 2 Score: 60.4622 bits (145), Expect = 1.550e-8
Identity = 37/122 (30.33%), Postives = 52/122 (42.62%), Query Frame = 2
Query:  263 KRKCCNGWTGTDCQFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFR-----IADEKPCIQGCIRGKC-KNGDCLCDSGYEGERCDRAFCQYGC--GTGICVEPNVCQCPENFRGRNCETF 604
            K  C  G+TG  C   +C  +C   G       C C   F G +C  R     +AD         RG+C  +G C C+ G+ GE C+   C +      G+CV    C C + +RG +C  F
Sbjct:  273 KCHCAPGFTGRTCDEAVCPVVCSGNG-VFSGGICVCKSGFKGKECEMRHNWCEVADCNG------RGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVN-GTCYCMDGWRGNDCSVF 386          

HSP 3 Score: 55.8398 bits (133), Expect = 3.627e-7
Identity = 30/92 (32.61%), Postives = 41/92 (44.57%), Query Frame = 2
Query:  326 CKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGCIRGKC-KNGDCLCDSGYEGERCDRAFCQYGC-GTGICVEPNVCQCPENFRGRNC 595
            C   G+ I+ D CQC+  +   DCS     ++ C   C+ G C  +G C C  G+ G  C    C  GC   G C     C+C   + G NC
Sbjct:  450 CSAHGQLID-DICQCESGWDSVDCS-----QQAC--QCVNGDCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENC 533          
BLAST of Hemocytin vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0075753)

HSP 1 Score: 436.032 bits (1120), Expect = 4.529e-124
Identity = 349/1276 (27.35%), Postives = 576/1276 (45.14%), Query Frame = 2
Query:  641 DVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSN-------------RNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPD-----PIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSI---CRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLI--NWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATK-PSITGNQVL--KIWVQNTHCMKSNDAYCTKSLSLQFGDTDNS-TFIQLVTTKNILVNKIP-NRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLG--VCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSS-SLCDPKCPNGMEYMECKNLCSVSCFSL-TQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTR---KEKCND-CNCTNGVWSCTKNDCSNVTFCPPGKE---------WKECGHC----DQTCENQDGFCLEKG-CKSGCFCPDGYLL--SNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQ--LIRGVRPKVMENENYP----KDRV--KGRISFRDLVSQLIIYTDS---DIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPE-KTFKTCINDCPKKCFKSNLNNTVLENC--AKNCVEGC---SCPTEYIEAEGSNK-CVKENEC--FCKLPNSDKKYNPGEIFTENCLICVCNENNFKC 4252
            D++  K     LC+  GG  + TFDG+  + PL  S+ L+ D +S   ++ I   +   CP      C  +L I   S   TF  L+ +   +                 +   QH  I     ++ +G L++ +D ++ V + A   M   V GLCG  DG+ +  ++  +  G+ +  V  F   W+  D      ++ +     G D C    +  +  A ++C+ +   +     I P   Y ++   C ++ C+C N     S      C   +  + +C   G  +   WR+    P  C   + Y  CG +    C+  +     K  C  GCFCP+        C+ +  CPC  +       +    + K++C  C C K G + C + + C   C   GDPHY TFD +     G C Y ++ T+  S+    V       ++ +    +D  CTK+++++F   D + + I+L      +VN  P  +LP  +     + I+  +   + +E  +GIR+ W   +++ I  P   + Q QGLCG +N N++DD     G++ T     A  W T +     + ++ G   C  + E +  A++FC  +L + F  CH  V+P  F + C +D C C  +E   C C  +++YG  CM+ G+   WR S   C  KCP G  + EC + C++SC  L ++ +C  EC++GC+C     Y     +CV    C C+ +   +  G       EK  D C CT+GVW C   +  +    PP  E         + E   C     +TC+N D +  +   C  GC C +GY+   S   CV    C C  + KSY +   I     +C + C C  G W C +   C  +C  WGD+H+ TFDG  FDF   C YV+       G G F +  +N+ CG  G +C+KS+         +  L+        +    P    +D V  KG  +F    + + +  +     + + WD+G  + + L  +++ +V GLCGN++ N  +D ++ +   E + + F  +WK + +C A     D CK + ER+ WA   CG +K+  F +C   V  E ++++C+ DTC+CD+GGDCECLCTA++A+  AC + GI+  WRS   CP+ C P    +K C   C  +   + L+  + E     +NC+EGC    C   +I    + + CV + EC   C + +    Y     FT++C  C C++    C
Sbjct:  473 DIVIDKTPRPALCTTWGGINMKTFDGLVFKAPLSCSHTLITDKVSG--TFDIILKA---CPYGSGYGCAHTLKILWQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQI----DLESVG-LKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPN--TDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFGMDSC---EQSKLQKAVSVCERLLANEKLGDCIKP-FNYDALIRTCMADYCNCANREHPESC----NCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCDSDLALPASKGACNEGCFCPEGTVQYKEACITRELCPCSLRGKE----FKPESTVKKNCNTCTC-KNGQWRCTEDK-CGARCGAVGDPHYQTFDGKRYDFMGKCSYHLLKTQNTSVEAENVACSGAVSESMNFAAPDDPSCTKAVTIRFILRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLG-EVLIRRASSTFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEGDVETAVEPFADKWRTKDTCQFKAETHQGPHPCTLNPEKKAQAEKFCDWILQDIFQDCHFLVEPEQFYEDCLYDTCAC-KDEMSKCFCPILSAYGTECMRQGVKTGWRMSVKECAVKCPLGQVFDECGDGCALSCDDLPSKGSCKRECVEGCRCPHGE-YVNEDGECVPKKMCHCNFDGMSFRPGYKEVRPGEKFLDLCTCTDGVWDCQDAEPGDKDKYPPSSELRSKCAKQPYAEFTKCAPKEPKTCKNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANCSCHHAGKSYDDGEKIK---EDC-NLCECRAGNWKCSK-NGCESTCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNGDG-FSITIQNVLCGTMGVTCSKSLEIALTGHAEESLLLSADSAYSTDPNKTPIKKLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMGLETSPMLFGHAWKLQPHCSAPVAPIDACKKHPERETWAQLKCGALKSDLFKECHAEVPLERFWKRCIFDTCACDQGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRDCVPKAECKPVCMVRDGKTFYEGDITFTDSCATCRCSKRKEIC 1713          

HSP 2 Score: 210.305 bits (534), Expect = 5.683e-54
Identity = 153/487 (31.42%), Postives = 237/487 (48.67%), Query Frame = 2
Query: 2882 NVTFCPP----GKEWKECG-HCDQTCENQDGFCLEKG-CKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDC----GKGIGFFKLVTENIE-CGNKGTSCTKS--IFFYYRN---QVVQLIRGVRPKVMEN--ENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLS-IEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDV---PDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWR-SNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPT-EYIEAEGSNKCVKENECFCKLPNSD-----KKYNPGEIFTENCLICVCNENNFKCR 4255
            N+  CP     G+ ++ CG + + TC++       KG C  GCFCP+G +   + C+ +  CPC    K +  +S +     NC + CTC  G+W C  E KC   C + GD HY+TFDGK +DF+ KCSY ++ +       + +     V+E++        SCTK+  I F  R+    V++L +G+   V +      PK    G +  R   S  +    +D I  W  G+S + I  PP  + Q  GLCG F+ N  +DF +  G+ E  +  F D W+++  C    +    P  C  N E++A A+K C  +    F DC  +V+ E +Y+ CL DTC+C +    +C C  LSA+ + C + G+   WR S + C V CP  + F  C + C   C   +L +    +C + CVEGC CP  EY+  +G  +CV +  C C           K+  PGE F +   +C C +  + C+
Sbjct:  750 NLEICPISCGFGRVYQACGPNVEPTCDSDLALPASKGACNEGCFCPEGTVQYKEACITRELCPCSLRGKEFKPESTVKK---NC-NTCTCKNGQWRC-TEDKCGARCGAVGDPHYQTFDGKRYDFMGKCSYHLLKTQNTSVEAENVACSGAVSESMNFAAPDDPSCTKAVTIRFILRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLGEVLIRRASSTFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEGDVETAVEPFADKWRTKDTCQFKAETHQGPHPCTLNPEKKAQAEKFCDWILQDIFQDCHFLVEPEQFYEDCLYDTCAC-KDEMSKCFCPILSAYGTECMRQGVKTGWRMSVKECAVKCPLGQVFDECGDGCALSC--DDLPSK--GSCKRECVEGCRCPHGEYVNEDG--ECVPKKMCHCNFDGMSFRPGYKEVRPGEKFLD---LCTCTDGVWDCQ 1221          

HSP 3 Score: 141.739 bits (356), Expect = 4.455e-33
Identity = 130/488 (26.64%), Postives = 214/488 (43.85%), Query Frame = 2
Query: 1502 EYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTY--CVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQF-GDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDT---------VLIESYN-GIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKC-PNGMEYMECKNLCSVSC------FSLTQTNCSTE-CIDGCQ---CKSNMVY-DTAVNQCVNISQCQ----CSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDC 2878
            E+++C     + C+++       S C  GC C +   ++ +   CV    C C    G S   Y  G   K DC +CEC + G + C+K  GC  TC + GD H+TTFD      +G+C Y  V  K          I +QN  C  +    C+KSL +   G  + S    L+ + +   +  PN+ P++    LR ++    H+          V++E     +++ W + T++ + L   ++ +V GLCGNYNGNS DD    S  L T+      +W   +   +  ++ +  C K  E E +A+  C  L  + F  CH  V    F ++C  D C C       C C ++A+Y  AC + G+ ++WRS   C  +C P+  +Y  C   C+V          + +  C+ E C++GC    C+   +Y +     CV  ++C+          +Y    T  + C  C C+     C+   C
Sbjct: 1248 EFTKCAPKEPKTCKNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANCSC-HHAGKS---YDDGEKIKEDCNLCEC-RAGNWKCSK-NGCESTCSVWGDSHFTTFDGHDFDFQGACDY--VLAKGVFDNGDGFSITIQNVLC-GTMGVTCSKSLEIALTGHAEES----LLLSADSAYSTDPNKTPIK---KLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMGLETSPMLFGHAWKL-QPHCSAPVAPIDACKKHPERETWAQLKCGALKSDLFKECHAEVPLERFWKRCIFDTCACDQGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRDCVPKAECKPVCMVRDGKTFYEGDITFTDSCATCRCSKRKEICSGVKC 1718          

HSP 4 Score: 116.316 bits (290), Expect = 2.538e-25
Identity = 170/781 (21.77%), Postives = 297/781 (38.03%), Query Frame = 2
Query:  719 ISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVN---CDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLN--KDLVTTANNMCQDVFGGDLSQCTILPVIPYQSI----CRSELCHCL--NAGQNISVCANIACSMGSFKSYQCTLNG--KLINWRSQLCAPRECPANKEYSEC-GSSCSQNCEDLITDE--NCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSND------AYCTKSLSLQFGDTDNSTFIQLVTTK----NILVNKIP-NRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQI-EITLPEF-YQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP-----------FNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMEC--------------------KNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNC-TNGVWSCTKNDC 2878
            I+I++   G+ ++++      P  ++ FN  Y    +  +N   C  S ++    +  T L +S                   G + Q+  IG +++   G  + FI       ++V GLCGY++GN     + ++ +G+ I N  +F   W +             +D C  L   +++   A  +C  +     ++C     + Y+      C    C+C+  N G   +   NI   + SF     ++N   +L  WR+       CP+   +++C    C  +C+++  D+       C  GC+CP+     G  CVP  +C                    +DC                      C   G   Y T+D++     G+C Y +++    + G    +++V    C K           C KSL +  GD  +   +Q V  K     +LV+     ++P +  D      Q V  + VL    + + +    +  I  + +P   Y  +++GLCG+ NGN+ +D   +  +     + +  SW   E K  L    L         E   KE C  L  E            F  C ++VDP  ++  C+ DIC  G  ++    C ++A+Y + C ++G+   WR   LC  +CP+ M Y  C                    KN   V      +   S+E  +GC C    V D    QCV    C    +  + P    +K+KC +C C + G  +C +  C
Sbjct: 2756 ITIQDTEAGNELILL------PHLKLKFNG-YEFTVQQLINSPICKASFVVSQPGK--TLLAVST----------------KYGFWVQLDDIGIVKV---GISSKFI-------RTVDGLCGYYNGNQK--DDKRSPDGQIIPNTEKFGDSWYD---------KRIPKDQCGDLKCPREMQAKALQLCNIIHHPTFARCH--KAVNYKQFLNNYCLEAACNCMMANNGDPAACKCNI---LESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGPNCVPISEC--------------------KDC---------------------VCNSLGASKYMTYDRKSFSFNGNCTY-LLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGD--HVIHVQRVPQKPKSLQVLVDGFEVKKIPYK--DSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGVDVIQ-SWQADEPKLGLVEECLS--------EDVPKEHCIPLPPEKDPCLQFYNAELFGKCPLAVDPIAYVSACQQDICKPGNTQQG--VCVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPCGCAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGG--QCVPEIACTKCDDGLHLPDEKWKKDKCTECQCDSKGKTTCVEKKC 3426          

HSP 5 Score: 104.76 bits (260), Expect = 7.727e-22
Identity = 88/380 (23.16%), Postives = 153/380 (40.26%), Query Frame = 2
Query: 3182 CKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQL--IRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDS-DIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCK-SNHERQAWADKMCGTMK-------------NVKFADCQKVVDTELYYQKCLSDTCSC-DRGGDCECLCTALSAFYSACKKYGI--DYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPD 4261
            C +WG  + KTFDG  F     CS+ ++     K  G F ++ +    G+ G  C  ++   +++ +     + G        +  P       +    +   + I  +S  + L WD    + +   PQ   +V GLCG  D + N D  S+ G     + AF D+W+        +D  ++C+  N     +    C   K             N K  DC K  + +   + C++D C+C +R     C C A++     C   GI  ++ WR+ E+CP+ C   + ++ C  +    C     ++  L      C EGC CP   ++ + +  C+    C C L    K++ P     +NC  C C    ++C  D
Sbjct:  485 CTTWGGINMKTFDGLVFKAPLSCSHTLITD---KVSGTFDIILKACPYGS-GYGCAHTLKILWQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPNTDLTSRTGKKLATVKAFADAWR-------VEDRSELCQVENSAEMEFGMDSCEQSKLQKAVSVCERLLANEKLGDCIKPFNYDALIRTCMADYCNCANREHPESCNCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCD----SDLALPASKGACNEGCFCPEGTVQYKEA--CITRELCPCSL--RGKEFKPESTVKKNCNTCTCKNGQWRCTED 845          

HSP 6 Score: 86.6557 bits (213), Expect = 2.035e-16
Identity = 107/453 (23.62%), Postives = 179/453 (39.51%), Query Frame = 2
Query: 2927 HCDQTCENQDG---FCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGN-------KGTSCTKSIFFYYRNQVVQLIR-GVRPKVMEN--ENYPKDRVKGR---ISFRDLVSQLIIYT--DSDIILYWD-KGLSIEIALPP-QYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSR------VNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVK-FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKC----FKSNLNNTVLENCA--------KNCV-----EGCSCPTEYIEAEGSNKCVKENEC 4153
             C+ +C+N  G     L   C  GC+CP+G +     CVP  +C                         C CN                 S G + Y T+D K F F   C+Y++       G+  F++     +C         +G SC KS+     + V+ + R   +PK ++   + +   ++  +   IS R +V + ++ +  +S + L    + L   + +P  +Y +++ GLCG+ + N  ND +      +  +   + SW++       V    ++DVP   K +          C    N + F  C   VD   Y   C  D C    G   + +C AL+A+   C ++GI  +WR  +LCP  CP +  ++ C   C K C      S  +   L+N A        + C+     EGC CP   +   G  +CV E  C
Sbjct: 2987 RCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGPNCVPISEC-----------------------KDCVCN-----------------SLGASKYMTYDRKSFSFNGNCTYLLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQRVPQKPKSLQVLVDGFEVKKIPYKDSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGV-DVIQSWQADEPKLGLVEECLSEDVP---KEHCIPLPPEKDPCLQFYNAELFGKCPLAVDPIAYVSACQQDICK--PGNTQQGVCVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPC--GCAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGG--QCVPEIAC 3389          

HSP 7 Score: 75.8702 bits (185), Expect = 4.912e-13
Identity = 77/347 (22.19%), Postives = 135/347 (38.90%), Query Frame = 2
Query: 1781 TCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTH--CMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPL---RLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQ-CEHDICLC---GGNEKDNCACESMASYGRACMKNGLTLK---WRSSSLCDPKCPNGMEYMEC-KNLCSVSCFSLTQTNCST---ECIDGCQCKSNMVYDTAVNQCVNISQCQ 2773
             C ISG   +TTFD   ++  G C + +     S +       W  + H  C       C K +++Q  DT+    + L+    +  N     +   IN P+      + +     + + +  G  +       +++ +   +   V GLCG YNGN +DD     G++  N  +   SW        +     G      E +  A + C  + +  F  CH +V+   F+   C    C C      +   C C  + S+ + C+     ++   WR+ + C+  CP+ + + +C K  C  SC ++   +C      C  GC C    V       CV IS+C+
Sbjct: 2702 VCEISGK-SFTTFDGT-VFKYGPCSHILARDIHSSS-------WSISVHQQCSDETRKVCHKVITIQ--DTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSWYDKR----IPKDQCGDLKCPREMQAKALQLCNIIHHPTFARCHKAVNYKQFLNNYCLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGP--NCVPISECK 3031          

HSP 8 Score: 61.6178 bits (148), Expect = 9.584e-9
Identity = 83/343 (24.20%), Postives = 133/343 (38.78%), Query Frame = 2
Query: 3206 YKTFDGKYFDFVSKCSYVMVD---------------SDCGKGIGFFKLVTENIECGNKGTSCT--KSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQK-CLSDTCSC---DRGGDCECLCTALSAFYSACKKYGIDY---SWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENC---AKNCVEGCSCPTEYIEAEGSNKCVKENEC 4153
            + TFDG  F +   CS+++                 SD  + +    +  ++ E GN+       K  F  Y   V QLI           N P  +    +S +   + L + T     +  D    +++ +  ++   V GLCG ++ N  +D +S  G    N   F DSW  +      KD     K   E QA A ++C  + +  FA C K V+ + +    CL   C+C   + G    C C  L +F   C          +WR+   C + CP          DC K+  + + +N   ++C      C  GC CP   +  +G N CV  +EC
Sbjct: 2710 FTTFDGTVFKY-GPCSHILARDIHSSSWSISVHQQCSDETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLI-----------NSPICKASFVVS-QPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSWYDKR---IPKDQCGDLKCPREMQAKALQLCNIIHHPTFARCHKAVNYKQFLNNYCLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVH----TDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVR-KGPN-CVPISEC 3030          
BLAST of Hemocytin vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0333020)

HSP 1 Score: 435.647 bits (1119), Expect = 5.316e-124
Identity = 349/1276 (27.35%), Postives = 576/1276 (45.14%), Query Frame = 2
Query:  641 DVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSN-------------RNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPD-----PIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSI---CRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLI--NWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATK-PSITGNQVL--KIWVQNTHCMKSNDAYCTKSLSLQFGDTDNS-TFIQLVTTKNILVNKIP-NRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLG--VCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSS-SLCDPKCPNGMEYMECKNLCSVSCFSL-TQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTR---KEKCND-CNCTNGVWSCTKNDCSNVTFCPPGKE---------WKECGHC----DQTCENQDGFCLEKG-CKSGCFCPDGYLL--SNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQ--LIRGVRPKVMENENYP----KDRV--KGRISFRDLVSQLIIYTDS---DIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPE-KTFKTCINDCPKKCFKSNLNNTVLENC--AKNCVEGC---SCPTEYIEAEGSNK-CVKENEC--FCKLPNSDKKYNPGEIFTENCLICVCNENNFKC 4252
            D++  K     LC+  GG  + TFDG+  + PL  S+ L+ D +S   ++ I   +   CP      C  +L I   S   TF  L+ +   +                 +   QH  I     ++ +G L++ +D ++ V + A   M   V GLCG  DG+ +  ++  +  G+ +  V  F   W+  D      ++ +     G D C    +  +  A ++C+ +   +     I P   Y ++   C ++ C+C N     S      C   +  + +C   G  +   WR+    P  C   + Y  CG +    C+  +     K  C  GCFCP+        C+ +  CPC  +       +    + K++C  C C K G + C + + C   C   GDPHY TFD +     G C Y ++ T+  S+    V       ++ +    +D  CTK+++++F   D + + I+L      +VN  P  +LP  +     + I+  +   + +E  +GIR+ W   +++ I  P   + Q QGLCG +N N++DD     G++ T     A  W T +     + ++ G   C  + E +  A++FC  +L + F  CH  V+P  F + C +D C C  +E   C C  +++YG  CM+ G+   WR S   C  KCP G  + EC + C++SC  L ++ +C  EC++GC+C     Y     +CV    C C+ +   +  G       EK  D C CT+GVW C   +  +    PP  E         + E   C     +TC+N D +  +   C  GC C +GY+   S   CV    C C  + KSY +   I     +C + C C  G W C +   C  +C  WGD+H+ TFDG  FDF   C YV+       G G F +  +N+ CG  G +C+KS+         +  L+        +    P    +D V  KG  +F    + + +  +     + + WD+G  + + L  +++ +V GLCGN++ N  +D ++ +   E + + F  +WK + +C A     D CK + ER+ WA   CG +K+  F +C   V  E ++++C+ DTC+CD+GGDCECLCTA++A+  AC + GI+  WRS   CP+ C P    +K C   C  +   + L+  + E     +NC+EGC    C   +I    + + CV + EC   C + +    Y     FT++C  C C++    C
Sbjct:  472 DIVIDKTPRPALCTTWGGINMKTFDGLVFKAPLSCSHTLITDKVSG--TFDIILKA---CPYGSGYGCAHTLKILWQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQI----DLESVG-LKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPN--TDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFGMDSC---EQSKLQKAVSVCERLLANEKLGDCIKP-FNYDALIRTCMADYCNCANREHPESC----NCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCDSDLALPASKGACNEGCFCPEGTVQYKEACITRELCPCSLRGKE----FKPESTVKKNCNTCTC-KNGQWRCTEDK-CGARCGAVGDPHYQTFDGKRYDFMGKCSYHLLKTQNTSVEAENVACSGAVSESMNFAAPDDPSCTKAVTIRFILRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLG-EVLIRRASSTFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEGDVETAVEPFADKWRTKDTCQFKAETHQGPHPCTLNPEKKAQAEKFCDWILQDIFQDCHFLVEPEQFYEDCLYDTCAC-KDEMSKCFCPILSAYGTECMRQGVKTGWRMSVKECAVKCPLGQVFDECGDGCALSCDDLPSKGSCKRECVEGCRCPHGE-YVNEDGECVPKKMCHCNFDGMSFRPGYKEVRPGEKFLDLCTCTDGVWDCQDAEPGDKDKYPPSSELRSKCAKQPYAEFTKCAPKEPKTCKNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANCSCHHAGKSYDDGEKIK---EDC-NLCECRAGNWKCSK-NGCESTCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNGDG-FSITIQNVLCGTMGVTCSKSLEIALTGHAEESLLLSADSAYSTDPNKTPIKKLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMGLETSPMLFGHAWKLQPHCSAPVAPIDACKKHPERETWAQLKCGALKSDLFKECHAEVPLERFWKRCIFDTCACDQGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRDCVPKAECKPVCMVRDGKTFYEGDITFTDSCATCRCSKRKEIC 1712          

HSP 2 Score: 210.305 bits (534), Expect = 5.878e-54
Identity = 153/487 (31.42%), Postives = 237/487 (48.67%), Query Frame = 2
Query: 2882 NVTFCPP----GKEWKECG-HCDQTCENQDGFCLEKG-CKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDC----GKGIGFFKLVTENIE-CGNKGTSCTKS--IFFYYRN---QVVQLIRGVRPKVMEN--ENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLS-IEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDV---PDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWR-SNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPT-EYIEAEGSNKCVKENECFCKLPNSD-----KKYNPGEIFTENCLICVCNENNFKCR 4255
            N+  CP     G+ ++ CG + + TC++       KG C  GCFCP+G +   + C+ +  CPC    K +  +S +     NC + CTC  G+W C  E KC   C + GD HY+TFDGK +DF+ KCSY ++ +       + +     V+E++        SCTK+  I F  R+    V++L +G+   V +      PK    G +  R   S  +    +D I  W  G+S + I  PP  + Q  GLCG F+ N  +DF +  G+ E  +  F D W+++  C    +    P  C  N E++A A+K C  +    F DC  +V+ E +Y+ CL DTC+C +    +C C  LSA+ + C + G+   WR S + C V CP  + F  C + C   C   +L +    +C + CVEGC CP  EY+  +G  +CV +  C C           K+  PGE F +   +C C +  + C+
Sbjct:  749 NLEICPISCGFGRVYQACGPNVEPTCDSDLALPASKGACNEGCFCPEGTVQYKEACITRELCPCSLRGKEFKPESTVKK---NC-NTCTCKNGQWRC-TEDKCGARCGAVGDPHYQTFDGKRYDFMGKCSYHLLKTQNTSVEAENVACSGAVSESMNFAAPDDPSCTKAVTIRFILRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLGEVLIRRASSTFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEGDVETAVEPFADKWRTKDTCQFKAETHQGPHPCTLNPEKKAQAEKFCDWILQDIFQDCHFLVEPEQFYEDCLYDTCAC-KDEMSKCFCPILSAYGTECMRQGVKTGWRMSVKECAVKCPLGQVFDECGDGCALSC--DDLPSK--GSCKRECVEGCRCPHGEYVNEDG--ECVPKKMCHCNFDGMSFRPGYKEVRPGEKFLD---LCTCTDGVWDCQ 1220          

HSP 3 Score: 141.739 bits (356), Expect = 4.569e-33
Identity = 130/488 (26.64%), Postives = 214/488 (43.85%), Query Frame = 2
Query: 1502 EYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGT--YCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQF-GDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDT---------VLIESYN-GIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKC-PNGMEYMECKNLCSVSC------FSLTQTNCSTE-CIDGCQ---CKSNMVY-DTAVNQCVNISQCQ----CSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDC 2878
            E+++C     + C+++       S C  GC C +   ++ +   CV    C C    G S   Y  G   K DC +CEC + G + C+K  GC  TC + GD H+TTFD      +G+C Y  V  K          I +QN  C  +    C+KSL +   G  + S    L+ + +   +  PN+ P++    LR ++    H+          V++E     +++ W + T++ + L   ++ +V GLCGNYNGNS DD    S  L T+      +W   +   +  ++ +  C K  E E +A+  C  L  + F  CH  V    F ++C  D C C       C C ++A+Y  AC + G+ ++WRS   C  +C P+  +Y  C   C+V          + +  C+ E C++GC    C+   +Y +     CV  ++C+          +Y    T  + C  C C+     C+   C
Sbjct: 1247 EFTKCAPKEPKTCKNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANCSC-HHAGKS---YDDGEKIKEDCNLCEC-RAGNWKCSK-NGCESTCSVWGDSHFTTFDGHDFDFQGACDY--VLAKGVFDNGDGFSITIQNVLC-GTMGVTCSKSLEIALTGHAEES----LLLSADSAYSTDPNKTPIK---KLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMGLETSPMLFGHAWKL-QPHCSAPVAPIDACKKHPERETWAQLKCGALKSDLFKECHAEVPLERFWKRCIFDTCACDQGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRDCVPKAECKPVCMVRDGKTFYEGDITFTDSCATCRCSKRKEICSGVKC 1717          

HSP 4 Score: 116.316 bits (290), Expect = 2.353e-25
Identity = 170/781 (21.77%), Postives = 297/781 (38.03%), Query Frame = 2
Query:  719 ISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVN---CDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLN--KDLVTTANNMCQDVFGGDLSQCTILPVIPYQSI----CRSELCHCL--NAGQNISVCANIACSMGSFKSYQCTLNG--KLINWRSQLCAPRECPANKEYSEC-GSSCSQNCEDLITDE--NCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSND------AYCTKSLSLQFGDTDNSTFIQLVTTK----NILVNKIP-NRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQI-EITLPEF-YQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP-----------FNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMEC--------------------KNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNC-TNGVWSCTKNDC 2878
            I+I++   G+ ++++      P  ++ FN  Y    +  +N   C  S ++    +  T L +S                   G + Q+  IG +++   G  + FI       ++V GLCGY++GN     + ++ +G+ I N  +F   W +             +D C  L   +++   A  +C  +     ++C     + Y+      C    C+C+  N G   +   NI   + SF     ++N   +L  WR+       CP+   +++C    C  +C+++  D+       C  GC+CP+     G  CVP  +C                    +DC                      C   G   Y T+D++     G+C Y +++    + G    +++V    C K           C KSL +  GD  +   +Q V  K     +LV+     ++P +  D      Q V  + VL    + + +    +  I  + +P   Y  +++GLCG+ NGN+ +D   +  +     + +  SW   E K  L    L         E   KE C  L  E            F  C ++VDP  ++  C+ DIC  G  ++    C ++A+Y + C ++G+   WR   LC  +CP+ M Y  C                    KN   V      +   S+E  +GC C    V D    QCV    C    +  + P    +K+KC +C C + G  +C +  C
Sbjct: 2755 ITIQDTEAGNELILL------PHLKLKFNG-YEFTVQQLINSPICKASFVVSQPGK--TLLAVST----------------KYGFWVQLDDIGIVKV---GISSKFI-------RTVDGLCGYYNGNQK--DDKRSPDGQIIPNTEKFGDSWYD---------KRIPKDQCGDLKCPREMQAKALQLCNIIHHPTFARCH--KAVNYKQFLNNYCLEAACNCMMANNGDPAACKCNI---LESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGPNCVPISEC--------------------KDC---------------------VCNSLGASKYMTYDRKSFSFNGNCTY-LLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGD--HVIHVQRVPQKPKSLQVLVDGFEVKKIPYK--DSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGVDVIQ-SWQADEPKLGLVEECLS--------EDVPKEHCIPLPPEKDPCLQFYNAELFGKCPLAVDPIAYVSACQQDICKPGNTQQG--VCVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPCGCAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGG--QCVPEIACTKCDDGLHLPDEKWKKDKCTECQCDSKGKTTCVEKKC 3425          

HSP 5 Score: 104.76 bits (260), Expect = 7.924e-22
Identity = 88/380 (23.16%), Postives = 153/380 (40.26%), Query Frame = 2
Query: 3182 CKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQL--IRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDS-DIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCK-SNHERQAWADKMCGTMK-------------NVKFADCQKVVDTELYYQKCLSDTCSC-DRGGDCECLCTALSAFYSACKKYGI--DYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPD 4261
            C +WG  + KTFDG  F     CS+ ++     K  G F ++ +    G+ G  C  ++   +++ +     + G        +  P       +    +   + I  +S  + L WD    + +   PQ   +V GLCG  D + N D  S+ G     + AF D+W+        +D  ++C+  N     +    C   K             N K  DC K  + +   + C++D C+C +R     C C A++     C   GI  ++ WR+ E+CP+ C   + ++ C  +    C     ++  L      C EGC CP   ++ + +  C+    C C L    K++ P     +NC  C C    ++C  D
Sbjct:  484 CTTWGGINMKTFDGLVFKAPLSCSHTLITD---KVSGTFDIILKACPYGS-GYGCAHTLKILWQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPNTDLTSRTGKKLATVKAFADAWR-------VEDRSELCQVENSAEMEFGMDSCEQSKLQKAVSVCERLLANEKLGDCIKPFNYDALIRTCMADYCNCANREHPESCNCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCD----SDLALPASKGACNEGCFCPEGTVQYKEA--CITRELCPCSL--RGKEFKPESTVKKNCNTCTCKNGQWRCTED 844          

HSP 6 Score: 87.0409 bits (214), Expect = 1.903e-16
Identity = 107/453 (23.62%), Postives = 179/453 (39.51%), Query Frame = 2
Query: 2927 HCDQTCENQDG---FCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGN-------KGTSCTKSIFFYYRNQVVQLIR-GVRPKVMEN--ENYPKDRVKGR---ISFRDLVSQLIIYT--DSDIILYWD-KGLSIEIALPP-QYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSR------VNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVK-FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKC----FKSNLNNTVLENCA--------KNCV-----EGCSCPTEYIEAEGSNKCVKENEC 4153
             C+ +C+N  G     L   C  GC+CP+G +     CVP  +C                         C CN                 S G + Y T+D K F F   C+Y++       G+  F++     +C         +G SC KS+     + V+ + R   +PK ++   + +   ++  +   IS R +V + ++ +  +S + L    + L   + +P  +Y +++ GLCG+ + N  ND +      +  +   + SW++       V    ++DVP   K +          C    N + F  C   VD   Y   C  D C    G   + +C AL+A+   C ++GI  +WR  +LCP  CP +  ++ C   C K C      S  +   L+N A        + C+     EGC CP   +   G  +CV E  C
Sbjct: 2986 RCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGPNCVPISEC-----------------------KDCVCN-----------------SLGASKYMTYDRKSFSFNGNCTYLLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQRVPQKPKSLQVLVDGFEVKKIPYKDSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGV-DVIQSWQADEPKLGLVEECLSEDVP---KEHCIPLPPEKDPCLQFYNAELFGKCPLAVDPIAYVSACQQDICK--PGNTQQGVCVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPC--GCAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGG--QCVPEIAC 3388          

HSP 7 Score: 75.8702 bits (185), Expect = 4.790e-13
Identity = 77/347 (22.19%), Postives = 135/347 (38.90%), Query Frame = 2
Query: 1781 TCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTH--CMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPL---RLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQ-CEHDICLC---GGNEKDNCACESMASYGRACMKNGLTLK---WRSSSLCDPKCPNGMEYMEC-KNLCSVSCFSLTQTNCST---ECIDGCQCKSNMVYDTAVNQCVNISQCQ 2773
             C ISG   +TTFD   ++  G C + +     S +       W  + H  C       C K +++Q  DT+    + L+    +  N     +   IN P+      + +     + + +  G  +       +++ +   +   V GLCG YNGN +DD     G++  N  +   SW        +     G      E +  A + C  + +  F  CH +V+   F+   C    C C      +   C C  + S+ + C+     ++   WR+ + C+  CP+ + + +C K  C  SC ++   +C      C  GC C    V       CV IS+C+
Sbjct: 2701 VCEISGK-SFTTFDGT-VFKYGPCSHILARDIHSSS-------WSISVHQQCSDETRKVCHKVITIQ--DTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSWYDKR----IPKDQCGDLKCPREMQAKALQLCNIIHHPTFARCHKAVNYKQFLNNYCLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGP--NCVPISECK 3030          

HSP 8 Score: 61.2326 bits (147), Expect = 1.042e-8
Identity = 83/343 (24.20%), Postives = 133/343 (38.78%), Query Frame = 2
Query: 3206 YKTFDGKYFDFVSKCSYVMVD---------------SDCGKGIGFFKLVTENIECGNKGTSCT--KSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQK-CLSDTCSC---DRGGDCECLCTALSAFYSACKKYGIDY---SWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENC---AKNCVEGCSCPTEYIEAEGSNKCVKENEC 4153
            + TFDG  F +   CS+++                 SD  + +    +  ++ E GN+       K  F  Y   V QLI           N P  +    +S +   + L + T     +  D    +++ +  ++   V GLCG ++ N  +D +S  G    N   F DSW  +      KD     K   E QA A ++C  + +  FA C K V+ + +    CL   C+C   + G    C C  L +F   C          +WR+   C + CP          DC K+  + + +N   ++C      C  GC CP   +  +G N CV  +EC
Sbjct: 2709 FTTFDGTVFKY-GPCSHILARDIHSSSWSISVHQQCSDETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLI-----------NSPICKASFVVS-QPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSWYDKR---IPKDQCGDLKCPREMQAKALQLCNIIHHPTFARCHKAVNYKQFLNNYCLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVH----TDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVR-KGPN-CVPISEC 3029          
BLAST of Hemocytin vs. Ensembl Fly
Match: cv-2 (gene:FBgn0000395 transcript:FBtr0071610)

HSP 1 Score: 105.145 bits (261), Expect = 2.378e-22
Identity = 114/466 (24.46%), Postives = 178/466 (38.20%), Query Frame = 2
Query: 2819 EKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKG-------------------CKSGCFCPDGYLLSNKT------CVPKHKCP---------------CLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQE---------------------QKCV---GSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENE-NYPKDRVKG--RISFRDLV--SQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAG--NYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKN----------VKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYS-WRSNELCPV 3970
            ++C  C C     +C+K  C  V  CP  K+ K    C   C     F    G                   C + C C +G  +  +       C P+ + P               C      Y N      GP  C S C CN G   C Q                      Q+CV   G+C  +GD H++TFDGK+F F   C Y++  SDC       +L  E    G +  S  K++    RN  V L + +R KV       P   V G   ++   L     +++ ++  + L W+    +++++P +++ ++CGLCGNF+ +  +D   K G  + ++ +  F +SWK           P  C    E  A A   C   K+            F +C + ++ E Y   C  D C C  G   +C C + +A+   C++ G+    WRS   CP 
Sbjct:  203 DRCLVCQCRGTQLTCSKKTCP-VLPCPMSKQIKRPDECCPRCPQNHSFLPVPGKCLFNKSVYPEKTQFMPDRC-TNCTCLNGTSVCQRPTCPILECAPEFQEPDGCCPRCAVAEVRSECSLDGIVYQNNETWDMGP--CRS-CRCNGGTIRCAQMRCPAVKCRANEELKQPPGECCQRCVETAGTCTVFGDPHFRTFDGKFFSFQGSCKYLLA-SDCMGKTFHIRLTNEGR--GTRRASWAKTVTLSLRNLKVNLGQRMRVKVNGTRVTLPYFVVAGGQNVTIERLANGGAVMLRSEMGLTLEWNGAGFLQVSVPAKFKKRLCGLCGNFNGSSRDDLTGKDGRSHGDDEVWHFANSWKV--------GGPKSCSRKREFLA-ATPTCDKRKSNFYCHPLSVPALFGECNERLNPENYKAACRMDVCECPSG---DCHCDSFAAYAHECRRLGVQLPDWRSATNCPA 648          

HSP 2 Score: 99.7525 bits (247), Expect = 1.130e-20
Identity = 76/282 (26.95%), Postives = 129/282 (45.74%), Query Frame = 2
Query: 1775 SGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLP-LQINDPLRLTIQEVAHD-TVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDN--ELAVSWATAECKS-TLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP--FNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLC 2596
            +GTC + GDPH+ TFD +    +GSC Y +     S    +   I + N     +  A   K+++L   +      + L     + VN     LP   +     +TI+ +A+   V++ S  G+ + W+    +++++P  ++ ++ GLCGN+NG+S DD T   G    +D     A SW     KS +    +L   A +   +K    F    L  P  F  C+  ++P  +   C  D+C C      +C C+S A+Y   C + G+ L  WRS++ C
Sbjct:  380 AGTCTVFGDPHFRTFDGKFFSFQGSCKYLLA----SDCMGKTFHIRLTNEG-RGTRRASWAKTVTLSLRNLK----VNLGQRMRVKVNGTRVTLPYFVVAGGQNVTIERLANGGAVMLRSEMGLTLEWNGAGFLQVSVPAKFKKRLCGLCGNFNGSSRDDLTGKDGRSHGDDEVWHFANSWKVGGPKSCSRKREFL---AATPTCDKRKSNFYCHPLSVPALFGECNERLNPENYKAACRMDVCEC---PSGDCHCDSFAAYAHECRRLGVQLPDWRSATNC 646          
BLAST of Hemocytin vs. Ensembl Fly
Match: Ten-a (gene:FBgn0267001 transcript:FBtr0308221)

HSP 1 Score: 79.7221 bits (195), Expect = 3.142e-14
Identity = 41/113 (36.28%), Postives = 54/113 (47.79%), Query Frame = 2
Query:  272 CCNGWTGTDCQFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGCIR-GKCKNGDCLCDSGYEGERCDRAFCQYGCGT-GICVEPN---VCQCPENFRGRNC 595
            C   WTG DC   +C   C   G C E  +C+C+  ++G  C     D+ PC   C   G+CKNG C+C  G+ G  C    C+ GC   G C   N    C C E + GR+C
Sbjct:  712 CERHWTGPDCSQAVCSLDCGRNGVC-ESGKCRCNSGWTGNLC-----DQLPCDSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLENGEYRCDCIEGWAGRDC 818          

HSP 2 Score: 65.0846 bits (157), Expect = 7.060e-10
Identity = 37/115 (32.17%), Postives = 54/115 (46.96%), Query Frame = 2
Query:  272 CCNGWTGTDC-----QFPICQQLC-KNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGCIR-GKCKNGDCLCDSGYEGERCDRAFCQYGCGTGICVEPNVCQCPENFRGRNC 595
            C  GW G DC     Q   C   C ++G   +E  +C C+  ++G DCS     +  C   C R G C++G C C+SG+ G  CD+  C   C      +   C C + + GR+C
Sbjct:  674 CKAGWQGEDCGTIDQQVYQCLPGCSEHGTYDLETGQCVCERHWTGPDCS-----QAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPCDSRCSEHGQCKNGTCVCSQGWNGRHC 783          

HSP 3 Score: 63.1586 bits (152), Expect = 3.178e-9
Identity = 36/116 (31.03%), Postives = 53/116 (45.69%), Query Frame = 2
Query:  263 KRKCCNGWTGTDCQFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIAD-EKPCIQGCIRGKCKNGDCLCDSGYEGERCDRAFC--QYGCGTGICVEPNVCQCPENFRGRNCET 601
            K  C +G+ G DC   +C  LC   G       C C+  + GA+C   + + E P       G+C  G+C C+ G++G  CD+  C      G G CV    C C   ++G +C T
Sbjct:  574 KCDCIDGYQGVDCSKSVCPVLCSAHGH-YGGGVCHCEEGWKGAECDIPVGECEVPNCSS--HGRCIEGECHCERGWKGPYCDQHDCLDPLCSGHGTCVAGQ-CYCKAGWQGEDCGT 685          

HSP 4 Score: 59.6918 bits (143), Expect = 3.232e-8
Identity = 34/114 (29.82%), Postives = 47/114 (41.23%), Query Frame = 2
Query:  272 CCNGWTGTDC-QFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGCIRG---KCKNGDCLCDSGYEGERCDRAFCQYGCG-TGICVEPNVCQCPENFRGRNCE 598
            C  GW G  C Q      LC   G C+   +C C   + G DC         C+ GC        + G C+C+  + G  C +A C   CG  G+C E   C+C   + G  C+
Sbjct:  642 CERGWKGPYCDQHDCLDPLCSGHGTCV-AGQCYCKAGWQGEDCGTIDQQVYQCLPGCSEHGTYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVC-ESGKCRCNSGWTGNLCD 753          
BLAST of Hemocytin vs. Ensembl Fly
Match: Ten-a (gene:FBgn0267001 transcript:FBtr0299860)

HSP 1 Score: 79.7221 bits (195), Expect = 3.142e-14
Identity = 41/113 (36.28%), Postives = 54/113 (47.79%), Query Frame = 2
Query:  272 CCNGWTGTDCQFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGCIR-GKCKNGDCLCDSGYEGERCDRAFCQYGCGT-GICVEPN---VCQCPENFRGRNC 595
            C   WTG DC   +C   C   G C E  +C+C+  ++G  C     D+ PC   C   G+CKNG C+C  G+ G  C    C+ GC   G C   N    C C E + GR+C
Sbjct:  712 CERHWTGPDCSQAVCSLDCGRNGVC-ESGKCRCNSGWTGNLC-----DQLPCDSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLENGEYRCDCIEGWAGRDC 818          

HSP 2 Score: 65.0846 bits (157), Expect = 7.060e-10
Identity = 37/115 (32.17%), Postives = 54/115 (46.96%), Query Frame = 2
Query:  272 CCNGWTGTDC-----QFPICQQLC-KNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGCIR-GKCKNGDCLCDSGYEGERCDRAFCQYGCGTGICVEPNVCQCPENFRGRNC 595
            C  GW G DC     Q   C   C ++G   +E  +C C+  ++G DCS     +  C   C R G C++G C C+SG+ G  CD+  C   C      +   C C + + GR+C
Sbjct:  674 CKAGWQGEDCGTIDQQVYQCLPGCSEHGTYDLETGQCVCERHWTGPDCS-----QAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPCDSRCSEHGQCKNGTCVCSQGWNGRHC 783          

HSP 3 Score: 63.1586 bits (152), Expect = 3.178e-9
Identity = 36/116 (31.03%), Postives = 53/116 (45.69%), Query Frame = 2
Query:  263 KRKCCNGWTGTDCQFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIAD-EKPCIQGCIRGKCKNGDCLCDSGYEGERCDRAFC--QYGCGTGICVEPNVCQCPENFRGRNCET 601
            K  C +G+ G DC   +C  LC   G       C C+  + GA+C   + + E P       G+C  G+C C+ G++G  CD+  C      G G CV    C C   ++G +C T
Sbjct:  574 KCDCIDGYQGVDCSKSVCPVLCSAHGH-YGGGVCHCEEGWKGAECDIPVGECEVPNCSS--HGRCIEGECHCERGWKGPYCDQHDCLDPLCSGHGTCVAGQ-CYCKAGWQGEDCGT 685          

HSP 4 Score: 59.6918 bits (143), Expect = 3.232e-8
Identity = 34/114 (29.82%), Postives = 47/114 (41.23%), Query Frame = 2
Query:  272 CCNGWTGTDC-QFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGCIRG---KCKNGDCLCDSGYEGERCDRAFCQYGCG-TGICVEPNVCQCPENFRGRNCE 598
            C  GW G  C Q      LC   G C+   +C C   + G DC         C+ GC        + G C+C+  + G  C +A C   CG  G+C E   C+C   + G  C+
Sbjct:  642 CERGWKGPYCDQHDCLDPLCSGHGTCV-AGQCYCKAGWQGEDCGTIDQQVYQCLPGCSEHGTYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVC-ESGKCRCNSGWTGNLCD 753          
BLAST of Hemocytin vs. Ensembl Zebrafish
Match: vwf (von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-070103-1])

HSP 1 Score: 500.745 bits (1288), Expect = 3.363e-145
Identity = 371/1281 (28.96%), Postives = 568/1281 (44.34%), Query Frame = 2
Query:  629 LKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIE-------TASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGL---NKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNG-KLINWRSQ-LCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWAT-AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSC--FSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTF------------------CPPGKEWKECG-------HCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQL----IRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPP---------EKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCS--CPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTEN------CLICVCNENNFKCRPDPKCITSTTS 4288
            L +SD++    +    CS+    ++ TFDG+  E P   S +L  DC  R+ S+ I  + S+    +  V      M E       T S+    L L  +S++    Y        +G            I  D   N+ +          CGLCG +  N     E+    G   ++  +F   W      +P          C       KD ++   +M   V     +   ++    + S+C S++CHC +AG+         C      S  C   G  L NW +Q  C+P+ CP   EYS+C  +CS +C+++   E CK  C  GC CP  +  +G  CV   QC C          Y       +DC  C C + G + C    GC G C+++G  HY TFD +     G C Y +     S + + V    ++   C    DA CT+S++L+F D  N T + L     + V+ +  + PL IN PLR  IQ     +V +   + + + W  + ++ + L   Y  Q+ GLCGNYNGN  DD     G + T       SW   A+C   + +     C+ + +  +FA+E C  LL   F  CH  V+P P+++ C +D+C C   ++  C C++++SY  AC   G+ + WRS   C+  CP+   Y  C ++C+ +C   SL  T C   C +GC C   +    A  +CV    C C H    +       +  + C C +G   CT N+ +  T                   CPP  +  EC         C +TC+N +  C+  GC SGC CP G +   K C+P+ +CPC  + + Y +   I     +C + C C + +W C  E+ C G C++ GD HY +FDG  F F   C YV+    C    G F+++ EN  CG  G  C+KSI   Y   ++ +    +R  RP + E E    + V+  + +       I+     I + WD G  I + +  QY+ +VCGLCGNFD + NND  S +   E +   F +SWK R +C  A  V   C ++  +    ++ C  + +  F DC  VVD E Y+  C  DTCSC   GDC C C  ++A+   C + G+  +WRSN+LCP+ C           E  + TC + CP  C      +    +C  +CVEGC   CP  ++  E   KCV+ ++C   + +  ++ + G+ F  N      C IC C  N   C P P  +T  TS
Sbjct:   15 LNLSDLL--LVEGSARCSLFSRQHIHTFDGVIYEFPGDCSYMLAGDC--RQRSFSILGDFSHG--KRKGVTVFLGEMFELHLSVDGTLSQGAERLPLPYASSSVFAGY-------ELGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHSNQTCGLCGNY--NYLAEDEYSAQEGFLTDDPYDFANSWAMKGADEPCKRVLPPSQSCNSTGESTKDQMSACESMRSSVLFMHCAH--LVDPAAFVSVCESDVCHC-SAGKEC------VCQAMLEYSRACASRGITLSNWHTQSQCSPK-CPVGMEYSDCTPTCSTSCQNVNIQEVCKEECVDGCICPAGKVLDGDRCVDVSQCSCTHAGRR----YPPASYISQDCNTCVC-RHGSWECTN-EGCPGECLVTGQSHYKTFDNKFFTFSGICHYLLAKDCQSNSFSAV----IETAQCADDQDAICTRSITLRFKDLANQT-VHLKHGGVVSVDGMDVQTPL-INGPLR--IQNTVLSSVRLRYGHDLHLDWDGRGRVLLRLKPAYAGQMCGLCGNYNGNQGDDFLTVGGLVETRVEAFGNSWKMNADCDD-VQMQNSDPCSLNPKRVRFAEEACAVLLSMKFEPCHYMVNPEPYVKNCRYDVCACADGQE--CLCDAVSSYAVACAARGVLVNWRSHGYCELTCPDAQVYEMCGSVCNQTCRSLSLPDTGCDGVCEEGCFCPRGLFLSDA-GECVPPQHCSCHHNGEIFEPNDMIGDHHSICVCESGSMHCTSNEATGSTLSDLFFDEQSPSRGRRSLSCPPPLQRFECESARDAGIECAKTCQNLELDCVSLGCVSGCMCPPGTVRYRKDCIPQEQCPCYHNSRPYESGQSITV---DC-NTCVCEQRQWKCS-ERVCDGVCRAIGDTHYISFDGLKFSFPGPCQYVLAQDYCNGLDGTFRVLVENSACGIAGYRCSKSITVLYMGGLIVMEHGEVRMKRPVLKETE---VEIVRSGLYY-------IVLLGKHISITWDTGTRISLQISGQYRGKVCGLCGNFDGSQNNDLLSSSNQMEVDAADFGNSWKVRPSCADAVSVVSQCSTDLVKLVTVEQSCRVLTSAIFRDCNSVVDPEPYWDICTQDTCSCPSVGDCACFCNTIAAYAHECAQKGLPVNWRSNDLCPLSCEDLNKESGVQCEWRYNTCASACPSTC-----QHPEPLSCPISCVEGCHAVCPPGHLLDEVLRKCVEPSQCQVCV-HDGQRVSHGKQFILNHEDPRLCQICHCESNTLTCGPCP--VTGLTS 1229          

HSP 2 Score: 77.7962 bits (190), Expect = 1.436e-13
Identity = 67/297 (22.56%), Postives = 120/297 (40.40%), Query Frame = 2
Query: 1772 CSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWAT-AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSC 2659
            C  +C+ S   H  +F    + V+ +C Y ++ +  +       ++ +  T C  S +  C KSL L+ G T     + L     + V  +   +P +        I  + H  +  E +           +  + +    +    GLCG+ + + +     S G +TT+ +    +WA  +EC   +    + +C    E      + C  L  E F+ CH  V    +IQ C    C      + N  C+ + +Y   C + G+ + WR+SSLC   C + MEY  C++ C   C
Sbjct: 1947 CPCSCMGSSTSHVVSFSGAALKVKSACSYLLLRSGGA-------ELVLHTTACQSSPNQICMKSLELREGGTS----VVLQDDMKVTVGGVLTAVPFRTERVTVTQIGSILHQ-LRSEQHGFTLTFTPHSNEFMLNMDIAMKPNTTGLCGSCS-DDQSGLLLSDGSVTTDPDVYLQAWALGSEC---VQHQEIQLCPAGLE------KACDVLSSEVFSHCHALVPVQDYIQICRSVAC------QPNALCDLVTAYSTVCRQQGVCVDWRTSSLCPMSCSDSMEYAACRSGCLEQC 2215          

HSP 3 Score: 75.0998 bits (183), Expect = 1.071e-12
Identity = 87/397 (21.91%), Postives = 159/397 (40.05%), Query Frame = 2
Query: 3170 CVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTS-CTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKG-----------------LSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSN------LNNTVLEN----CAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTEN---CLICVC-NENNFKCRPDP 4264
            C  SC     +H  +F G      S CSY+++ S      G  +LV     C +     C KS+         +L  G    V++++   K  V G ++     ++ +  T    IL+  +                  L+++IA+ P       GLCG+   + +    S  G+   +   ++ +W     C   +++  +C +  E      K C  + +  F+ C  +V  + Y Q C S  C  +       LC  ++A+ + C++ G+   WR++ LCP+ C     +  C + C ++C +S       + + +L+     C     EGC CP   +  E  +KCV    C   + +S K +   E +      C++CVC ++    C   P
Sbjct: 1947 CPCSCMGSSTSHVVSFSGAALKVKSACSYLLLRS------GGAELVLHTTACQSSPNQICMKSL---------ELREGGTSVVLQDDM--KVTVGGVLTAVPFRTERVTVTQIGSILHQLRSEQHGFTLTFTPHSNEFMLNMDIAMKPN----TTGLCGSCSDDQSGLLLSD-GSVTTDPDVYLQAWALGSECVQHQEI-QLCPAGLE------KACDVLSSEVFSHCHALVPVQDYIQICRSVACQPNA------LCDLVTAYSTVCRQQGVCVDWRTSSLCPMSCSDSMEYAACRSGCLEQCGQSQFTPGDMMGDGLLKANGSVCLNTPTEGCFCPEGSVLME--DKCVDREACSQCVEHSGKTHQFMESWNPEDNPCVLCVCLDQQRINCTALP 2306          
BLAST of Hemocytin vs. Ensembl Zebrafish
Match: vwf (von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-070103-1])

HSP 1 Score: 496.508 bits (1277), Expect = 6.820e-145
Identity = 369/1264 (29.19%), Postives = 561/1264 (44.38%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIE-------TASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIP--YQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNG-KLINWRSQ-LCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWAT-AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSC--FSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTF------------------CPPGKEWKECG-------HCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQL----IRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPP---------EKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCS--CPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTEN------CLICVCNENNFKCRPDPKCITSTTS 4288
            CS+    ++ TFDG+  E P   S +L  DC  R+ S+ I  + S+    +  V      M E       T S+    L L  +S++    Y        +G            I  D   N+ +          CGLCG +  N     E+    G   ++  +F   W      +P          C    +   +T  + C+ +    L       V P  + S+C S++CHC +AG+         C      S  C   G  L NW +Q  C+P+ CP   EYS+C  +CS +C+++   E CK  C  GC CP  +  +G  CV   QC C          Y       +DC  C C + G + C    GC G C+++G  HY TFD +     G C Y +     S + + V    ++   C    DA CT+S++L+F D  N T + L     + V+ +  + PL IN PLR  IQ     +V +   + + + W  + ++ + L   Y  Q+ GLCGNYNGN  DD     G + T       SW   A+C   + +     C+ + +  +FA+E C  LL   F  CH  V+P P+++ C +D+C C   ++  C C++++SY  AC   G+ + WRS   C+  CP+   Y  C ++C+ +C   SL  T C   C +GC C   +    A  +CV    C C H    +       +  + C C +G   CT N+ +  T                   CPP  +  EC         C +TC+N +  C+  GC SGC CP G +   K C+P+ +CPC  + + Y +   I     +C + C C + +W C  E+ C G C++ GD HY +FDG  F F   C YV+    C    G F+++ EN  CG  G  C+KSI   Y   ++ +    +R  RP + E E    + V+  + +       I+     I + WD G  I + +  QY+ +VCGLCGNFD + NND  S +   E +   F +SWK R +C  A  V   C ++  +    ++ C  + +  F DC  VVD E Y+  C  DTCSC   GDC C C  ++A+   C + G+  +WRSN+LCP+ C           E  + TC + CP  C      +    +C  +CVEGC   CP  ++  E   KCV+ ++C   + +  ++ + G+ F  N      C IC C  N   C P P  +T  TS
Sbjct:   17 CSLFSRQHIHTFDGVIYEFPGDCSYMLAGDC--RQRSFSILGDFSHG--KRKGVTVFLGEMFELHLSVDGTLSQGAERLPLPYASSSVFAGY-------ELGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHSNQTCGLCGNY--NYLAEDEYSAQEGFLTDDPYDFANSWAMKGADEPCKRVLPPSQSCNSTGE---STKMSACESMRSSVLFMHCAHLVDPAAFVSVCESDVCHC-SAGKEC------VCQAMLEYSRACASRGITLSNWHTQSQCSPK-CPVGMEYSDCTPTCSTSCQNVNIQEVCKEECVDGCICPAGKVLDGDRCVDVSQCSCTHAGRR----YPPASYISQDCNTCVC-RHGSWECTN-EGCPGECLVTGQSHYKTFDNKFFTFSGICHYLLAKDCQSNSFSAV----IETAQCADDQDAICTRSITLRFKDLANQT-VHLKHGGVVSVDGMDVQTPL-INGPLR--IQNTVLSSVRLRYGHDLHLDWDGRGRVLLRLKPAYAGQMCGLCGNYNGNQGDDFLTVGGLVETRVEAFGNSWKMNADCDD-VQMQNSDPCSLNPKRVRFAEEACAVLLSMKFEPCHYMVNPEPYVKNCRYDVCACADGQE--CLCDAVSSYAVACAARGVLVNWRSHGYCELTCPDAQVYEMCGSVCNQTCRSLSLPDTGCDGVCEEGCFCPRGLFLSDA-GECVPPQHCSCHHNGEIFEPNDMIGDHHSICVCESGSMHCTSNEATGSTLSDLFFDEQSPSRGRRSLSCPPPLQRFECESARDAGIECAKTCQNLELDCVSLGCVSGCMCPPGTVRYRKDCIPQEQCPCYHNSRPYESGQSITV---DC-NTCVCEQRQWKCS-ERVCDGVCRAIGDTHYISFDGLKFSFPGPCQYVLAQDYCNGLDGTFRVLVENSACGIAGYRCSKSITVLYMGGLIVMEHGEVRMKRPVLKETE---VEIVRSGLYY-------IVLLGKHISITWDTGTRISLQISGQYRGKVCGLCGNFDGSQNNDLLSSSNQMEVDAADFGNSWKVRPSCADAVSVVSQCSTDLVKLVTVEQSCRVLTSAIFRDCNSVVDPEPYWDICTQDTCSCPSVGDCACFCNTIAAYAHECAQKGLPVNWRSNDLCPLSCEDLNKESGVQCEWRYNTCASACPSTC-----QHPEPLSCPISCVEGCHAVCPPGHLLDEVLRKCVEPSQCQVCV-HDGQRVSHGKQFILNHEDPRLCQICHCESNTLTCGPCP--VTGLTS 1215          
BLAST of Hemocytin vs. Ensembl Zebrafish
Match: scospondin (subcommissural organ spondin [Source:ZFIN;Acc:ZDB-GENE-051114-1])

HSP 1 Score: 455.292 bits (1170), Expect = 4.114e-130
Identity = 324/1138 (28.47%), Postives = 512/1138 (44.99%), Query Frame = 2
Query:  956 IGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSM----------GSFKSY--QCTLNGKLINWRSQ-LCAPRECPANKEYSECGSSCSQNCEDLITDE--NCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFD-KRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIE-ITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSC------FSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDG---FCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRG----------VRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCP--AAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKS-NLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKC 4252
            +GDF  ++    + + +D +  +++        +  GLCG ++ N     +F    G   +    F   W+  D                G + DL   +N++   +     S C +L   P+     S   H ++ G  I  C  + CS+           +  SY  +C     +I+WR +  C  R CP  + +S+C SSC   C          C+  C  GC CP+  + +   CV +  CPC  +  +    Y  G + ++ C  C C + G + C+  + C   C + G  H TTFD KR+      C +T V        ++ L I +    C    +A C + +S+    T   T + +    ++LVN   N LP+   D   L ++  +   +LI+++ G +++WH    +  ITL   +  +V+GLCG  + +  DD T   G++  +    A  +    C +  +++    C    +  + A+  C  +    F +CH  VD  PF++ C  ++C CG   + +C C  + +Y   C + G  L WR+ + C  +C  G  Y EC  LC  SC      +S      S  C+ GCQC   +  D A  QCV +  C C   +  +P+GS+    CN C C  GVW+CT   C  +  C PG        C +TC + +     C E     GC CP+G +L    CV   +CPC  + + Y     I        + C C E +W C Q   C G+C + GD HY TFDG+++ F+  C YV+V     +  G F +  EN+ CG+ G +CTKS+     N  + L+RG            PK         +RV     F  L S+L       + L WD G+ + + L P    +V GLCGNFD +  NDF ++ G  E+    F +SWK   +CP  A +D+ D C  N  R  WA K C  +    F+ C   V  + YY  C+ D C CD GGDCECLCTA++A+   C + G+   WRS ELCP+ C     ++ C   C   C  + +L++++    A +CVEGC CP   +  +  + C+  ++C C+   S   +  G + T++C  C C+   ++C
Sbjct:  289 LGDFVFVESGLGVRLKFDMENTIYLTVTAEHLTNTRGLCGVYNNNP--DDDFTTSTGSVSQYAASFGNSWRVQDQQQSQVCSDAAE---LGHSCDL---SNDV--SLRRDAESACHLLKETPF-----SHCHHQVDPGPYIDTCLYLFCSLEVKDRDTAVCDTLASYVRECAQQHIIISWRRRGFCGTRVCPRGQVFSDCVSSCPATCASPRPPAAGQCRDECVGGCECPQGVYLHAGQCVRRDDCPCFHRRHS----YSAGQTIRQRCNTCVC-RAGQWECSTEK-CEAQCSVLGAMHITTFDQKRYGLQTADCRFTAVED----FVDKKLSIIIGAGPCA-GGEAGCLREMSI----TALHTTLTVTDAGSVLVNGHRNPLPVVTGD---LLVRRASSSVLLIQAF-GAQLMWHLDGPLLFITLQPGFAHKVRGLCGTLSWSQHDDFTTPEGDVENSAASFAAKFIVGSCPAPSAMTS-DPCGTLTQRRQLAERVCSVIHSNVFQACHDVVDREPFMRLCVSEVCSCG--PQASCHCSVLTAYATHCAQEGALLSWRNHTFCPVQCSGGQVYQECGRLCGTSCADLWDGWSCEPDEGSRVCVSGCQCPDGLAQD-AQGQCVPVHMCPCKSGDTLHPAGSSINNNCNTCVCARGVWNCTDLSCPELNQC-PGSLIFSPRSCLRTCSSPNSPLDACTEP--IHGCICPEGTVLLGDQCVKPDECPCHHNGRLYFTNDTISKD----CNTCVCREQRWHCGQA-LCSGTCVATGDPHYITFDGRHYSFLGDCEYVLVQ----ESSGLFSVSAENVPCGSTGVTCTKSVTLTIGNTAIHLLRGKAVTVNGIPVTLPKSYSGSGLILERVG---LFVSLSSRL------GVTLLWDGGMRVYVRLMPHLHGRVGGLCGNFDGDAENDFTTRQGIMESTPELFGNSWKISPSCPDVADQDLRDPCFINPHRVTWAKKKCAVINQEIFSSCHSEVPYQQYYDWCVFDACGCDSGGDCECLCTAVAAYAEECNRRGVYVRWRSQELCPLQCENGLVYEACGAACSPACPSTPSLSDSLCS--ALSCVEGCFCPQGTVYHD--DACISPSQCPCEWDGS--VFPAGAMVTQHCQNCSCSAGLWQC 1361          

HSP 2 Score: 201.445 bits (511), Expect = 5.138e-51
Identity = 154/533 (28.89%), Postives = 232/533 (43.53%), Query Frame = 2
Query: 1586 GCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWA-TAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFS---LTQTNCST-ECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCT---------------------------------KNDCSNVT------FCPPGKEWKECGHCDQTCENQDGF--CLEKGCKSGCFCPDGYLLSNKTCVPKHK 3046
            GC CP+     G  CV   +CPC   NG    +Y    +  +DC  C C +   ++C +   CSGTCV +GDPHY TFD RH    G C Y +V        + +  +  +N  C  S    CTKS++L  G+T     I L+  K + VN IP  LP   +      I E     V + S  G+ +LW    ++ + L      +V GLCGN++G++E+D T   G + +       SW  +  C           C  +     +AK+ C  +  E F+SCH  V    +   C  D C C       C C ++A+Y   C + G+ ++WRS  LC  +C NG+ Y  C   CS +C S   L+ + CS   C++GC C    VY    + C++ SQC C  + + +P+G+   + C +C+C+ G+W C                                  ++DC + +       CPP       G C       DG   C ++  +   FCP  +  +N  CVP HK
Sbjct:  951 GCICPEGTVLLGDQCVKPDECPC-HHNGR---LYFTNDTISKDCNTCVCREQ-RWHCGQAL-CSGTCVATGDPHYITFDGRHYSFLGDCEYVLVQES-----SGLFSVSAENVPC-GSTGVTCTKSVTLTIGNT----AIHLLRGKAVTVNGIPVTLPKSYSG--SGLILERVGLFVSLSSRLGVTLLWDGGMRVYVRLMPHLHGRVGGLCGNFDGDAENDFTTRQGIMESTPELFGNSWKISPSCPDVADQDLRDPCFINPHRVTWAKKKCAVINQEIFSSCHSEVPYQQYYDWCVFDACGCDSGGDCECLCTAVAAYAEECNRRGVYVRWRSQELCPLQCENGLVYEACGAACSPACPSTPSLSDSLCSALSCVEGCFCPQGTVYHD--DACISPSQCPCEWDGSVFPAGAMVTQHCQNCSCSAGLWQCVGSPCPPPSPCKDSEFRCSGGSERCIPAVWVCDNEDDCGDGSDEVCPITCPPEHFRCSGGACLPVELRCDGHPDCADQSDED--FCPPKFRCANGRCVPGHK 1461          

HSP 3 Score: 165.236 bits (417), Expect = 4.102e-40
Identity = 109/393 (27.74%), Postives = 173/393 (44.02%), Query Frame = 2
Query: 1736 KGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVN--KIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAE------CKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPK-CPNGMEYMECKNLCSVSCFS---LTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDC 2878
            +GG+    +    S TC+     H+ TFD++H + +GSC Y + +   S  G   + I   +T C  S    C K L +  G       +  +   N+ VN   +P   PL  N    +++  +  D V +ES  G+R+ +  +  I +T+   +    +GLCG YN N +DD T S+G ++        SW   +      C     L +    +      + A+  C  L   PF+ CH  VDP P+I  C +  C     ++D   C+++ASY R C +  + + WR    C  + CP G  + +C + C  +C S        C  EC+ GC+C   +       QCV    C C H    Y +G T +++CN C C  G W C+   C
Sbjct:  182 RGGLLRGVRDPQASSTCMSWSGTHFRTFDRKHFHFQGSCTYLLAS---STDGTWAVYI---STVCETS--GRCRKDLRMMLG-----LGLVSIHKDNMTVNGLAVPQGEPLFQNG---VSVHWLG-DFVFVESGLGVRLKFDMENTIYLTVTAEHLTNTRGLCGVYNNNPDDDFTTSTGSVSQYAASFGNSWRVQDQQQSQVCSDAAELGHSCDLSNDVSLRRDAESACHLLKETPFSHCHHQVDPGPYIDTCLYLFCSLEVKDRDTAVCDTLASYVRECAQQHIIISWRRRGFCGTRVCPRGQVFSDCVSSCPATCASPRPPAAGQCRDECVGGCECPQGVYLH--AGQCVRRDDCPCFHRRHSYSAGQTIRQRCNTCVCRAGQWECSTEKC 555          

HSP 4 Score: 114.775 bits (286), Expect = 8.575e-25
Identity = 86/367 (23.43%), Postives = 154/367 (41.96%), Query Frame = 2
Query: 3179 SCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVN-----CPAAKDVPDMCKSNHE--RQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPV-MCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTE-YIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKC 4252
            +C SW   H++TFD K+F F   C+Y++  S  G    +   V E      K       +     ++    + G+   V + E       +  +S   L   + + +   + L +D   +I + +  ++     GLCG ++ N ++DF +  G+      +F +SW+ +       C  A ++   C  +++   +  A+  C  +K   F+ C   VD   Y   CL   CS +       +C  L+++   C +  I  SWR    C   +CP  + F  C++ CP  C  ++        C   CV GC CP   Y+ A    +CV+ ++C C   +    Y+ G+   + C  CVC    ++C
Sbjct:  197 TCMSWSGTHFRTFDRKHFHFQGSCTYLLASSTDGTWAVYISTVCETSGRCRKDLRMMLGLGLVSIHKDNMTVNGL--AVPQGEPL----FQNGVSVHWLGDFVFVESGLGVRLKFDMENTIYLTVTAEHLTNTRGLCGVYNNNPDDDFTTSTGSVSQYAASFGNSWRVQDQQQSQVCSDAAELGHSCDLSNDVSLRRDAESACHLLKETPFSHCHHQVDPGPYIDTCLYLFCSLEVKDRDTAVCDTLASYVRECAQQHIIISWRRRGFCGTRVCPRGQVFSDCVSSCPATC--ASPRPPAAGQCRDECVGGCECPQGVYLHA---GQCVRRDDCPCF--HRRHSYSAGQTIRQRCNTCVCRAGQWEC 550          

HSP 5 Score: 95.1301 bits (235), Expect = 8.220e-19
Identity = 104/412 (25.24%), Postives = 165/412 (40.05%), Query Frame = 2
Query:  542 CVEPNVCQCPENFRGR-NCETFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCP-TKDFVNCDTSLMIETASESVTFLGLSNSSTNS-----NRNYISS-IQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDL--ITDENCKSF-CTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKG 1741
            CV+P+ C C  N R     +T  ++ NT   +       +      C   G  +  TFDG           +LV      + S  +F  S+ N P     V C  S+ +   + ++  L     + N       ++Y  S +  + +G F  +     + +L+DG   V++     +   V GLCG FDG++   ++F    G        F   WK   P  P+      RD C  +N   VT A   C  +     S C + +P   Y   C  + C C + G    +C  +A       + +C   G  + WRSQ   P +C     Y  CG++CS  C     ++D  C +  C  GCFCP+   ++   C+   QCPC   +G+   V+  G    + C+ C CS G
Sbjct:  965 CVKPDECPCHHNGRLYFTNDTISKDCNTCVCREQRWHCGQALCSGTCVATGDPHYITFDGRHYSFLGDCEYVLV------QESSGLFSVSAENVPCGSTGVTCTKSVTLTIGNTAIHLLRGKAVTVNGIPVTLPKSYSGSGLILERVGLFVSLSSRLGVTLLWDGGMRVYVRLMPHLHGRVGGLCGNFDGDA--ENDFTTRQGIMESTPELFGNSWKI-SPSCPDVADQDLRDPCF-INPHRVTWAKKKCAVINQEIFSSCHSEVPYQQYYDWCVFDACGCDSGGDCECLCTAVA-----AYAEECNRRGVYVRWRSQELCPLQCENGLVYEACGAACSPACPSTPSLSDSLCSALSCVEGCFCPQGTVYHDDACISPSQCPC-EWDGS---VFPAGAMVTQHCQNCSCSAG 1357          

HSP 6 Score: 53.9138 bits (128), Expect = 2.387e-6
Identity = 31/97 (31.96%), Postives = 45/97 (46.39%), Query Frame = 2
Query: 1463 SQLCAPRECPANKEYSECGSSCSQNCEDLITDENCK--SFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGV 1747
            ++ C  R CPA +E+  C + C Q C DL     C   + C  GC CP  +      CV   QC C+  +G    V+  G S ++DC  C C+   +
Sbjct: 3700 TKPCGDRGCPAGQEFVSCSNECPQRCSDLQQGIQCHTNTECQPGCRCPHGQLLQDGVCVQTWQCDCVDASGQ---VWASGSSHQQDCNTCSCTDAQI 3793          

HSP 7 Score: 53.9138 bits (128), Expect = 2.662e-6
Identity = 33/99 (33.33%), Postives = 50/99 (50.51%), Query Frame = 2
Query: 2597 DPKCPNGMEYMECKNLCSVSCFSLTQT---NCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENA-YYPSGSTRKEKCNDCNCTNGVWSCTKNDCS 2881
            D  CP G E++ C N C   C  L Q    + +TEC  GC+C    +    V  CV   QC C   +   + SGS+ ++ CN C+CT+   +C+ + C+
Sbjct: 3705 DRGCPAGQEFVSCSNECPQRCSDLQQGIQCHTNTECQPGCRCPHGQLLQDGV--CVQTWQCDCVDASGQVWASGSSHQQDCNTCSCTDAQITCSNHTCA 3801          
BLAST of Hemocytin vs. Ensembl Zebrafish
Match: muc5.2 (mucin 5.2 [Source:ZFIN;Acc:ZDB-GENE-121108-1])

HSP 1 Score: 425.246 bits (1092), Expect = 1.783e-120
Identity = 369/1255 (29.40%), Postives = 549/1255 (43.75%), Query Frame = 2
Query:  671 QLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYIS-SIQHKNI---GDFNQIK-GIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNP--DPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPK----DRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIR--ILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWA-TAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP--FNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDPKCPNGMEYMECKNLCSVSCFSLT--QTNC--STECIDGCQCKSNMVYDTAVNQCVNISQCQC-SHENAYYPSGSTRKEKCNDCNCTNGVWSCTKND----------CSNVTFCPPGKEWKECGHCDQTCENQD-GFCLEKGCKSGCFCPDGYLLSNKT-CVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFF--KLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC-----PP---EKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGC--SCPTEY-IEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTE------NCLICVCNENNFKCRPDPKCI 4273
            ++CS  G  +  TFDG   + P   + +L + C +    + I          +D VN   S          T + +++S    +   +S  I  K I   G    IK     + I ++   ++ I      K   CGLCG ++G+              I   TE  +    P  D  D NT       +C    + L +   + C DV    +          ++  C S++C C  +        +  C+  +  S QCT   G+   WR++   P+ CP N +Y ECG  C   C D      CK  C  GCFCP+    D    G  CVP  +CPC+        VY  G S+++ C+ C C+ G  + C  +  C GTC + G  H TTFD +     G+C Y +  TK S   +    +      C  +    C  S++L    T        V T N      P  LP  I  P+ +    +   + +I   N +R  I      Q+ I      + ++ GLCGNYN    DD     G         A  W  T      L  ++   C+ S + EK AK++C RL  +   F++CH  + P  + ++C +D C C    K  C C ++++Y  AC   G+ L+ W  S  C+ +C   M++      C ++C SL+  +  C  S   +DGC C S   Y      CV   QC C S +    PS  +  +    C C  G   C+  +          CSN     PGK+  EC    +TC+ QD   C+  GC SGC CPD  L   +  CV + KCPC+ +  +Y +   +     +C + CTC  G W C  E++C G+C  +G+ H+ TFDGK + F   C  ++V   C      +  +LVTENI CG  GT C+KSI  ++    + L      +V+E+        + +I    + +  +I     + L WD   S+ + L P+++ +VCGLCGNFD N NNDF    G    + + F +SWKS   CP   +V + C+ N  R AWA K C  + +  F+DC   VD+  YY  C+ DTC+CD GGDC+C CTA++A+ + C+K G   +WRS  +CP+ C     PP   E  +KTC + C K C   N + T         +EGC   CP+E     E + KCV E EC        K Y  G++  +       C   VC  N    R   KC+
Sbjct:   73 RICSTWGNFHFKTFDGHFFQLPDTCNYVLAVMCDAAISDFNIQMQ-------RDTVNGSISFGSVIVKLDGTVIKITDSGIMMDDQVVSVPINQKGIKIEGSPTSIKISRYGMTIFWEEDNSIAIELAEKYKGLTCGLCGNYNGDKDDDMPESGPATWKISTPTESCEDVILPPKDQCDQNTM------VC---QQYLSSPGFSGCYDVMDMKI----------FEKACVSDMCQCYGS-------HDCLCNTLTEISRQCTHAGGQPGTWRTEQLCPKMCPINLQYMECGGPCKSTCSDPTAHLMCKDHCVDGCFCPEGTVEDDIGQGG-CVPVNECPCVHDG----TVYKSGESYQQACKKCFCAAGH-WTCTYL-DCPGTCSVVGGSHVTTFDGKSFTFSGNCDYIL--TKHS--NDSDFAVVGNLAKCEPARTDTCLNSVTLVISGTTIGFTSDGVVTLN---GNSPFNLPAVIG-PVSIFQPSL---SFIIADLNSLRLEIQLAPVMQLYIVASTEEKGKMTGLCGNYNDVQSDDFKTDLGITEGTAISFANFWKKTPYSCPDLENTFDNPCSLSVDTEKLAKDWCSRLTNQSGAFSACHSEICPKIYYERCVYDTCKCADIRK--CICAAVSTYAHACAARGIILQGWMDSDPCESECSENMKHSYGMTGCGLTCRSLSGQENTCQGSFTPVDGCVC-SEGTYLNEEGICVPADQCPCYSGDQVTKPSEVSHVDGLT-CTCKLGKLHCSNPETCVAPMVLFKCSNYE---PGKKGTEC---QRTCQKQDINNCVSTGCVSGCMCPDNLLADGQGGCVEREKCPCVHNGVTYSSGEQV---QEDC-NTCTCRNGMWDC-TEKECYGTCTIYGEGHFMTFDGKKYSFHGDCEQILVHDYCNTDQSPYSLRLVTENIPCGTSGTICSKSINLFFGRYKLILSEEKEIQVVESNG---TDYQYQIHTAGIYN--VIEVKGLLNLIWDSKTSVMLQLHPKFKGKVCGLCGNFDGNANNDFMKHDGEEVTDPVVFGNSWKSNPGCPDVSNVMNPCEKNPHRSAWAIKQCSIITSPVFSDCHSRVDSGPYYDACVKDTCACDSGGDCDCFCTAVAAYAAECRKTGACVAWRSPSICPLFCDYYNNPPSECEWHYKTCGSTCMKTC--RNPSGTCSNQIP--LLEGCFPQCPSERPFLREDNRKCVTEAECLSLCTYDGKIYTTGDVMYDTTDGNGTCFTAVCGSNGEIIRSINKCM 1252          

HSP 2 Score: 92.4337 bits (228), Expect = 6.210e-18
Identity = 124/538 (23.05%), Postives = 206/538 (38.29%), Query Frame = 2
Query: 1754 CAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTD---NSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAE-CKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSS----LCDPKCPNGMEYMEC----KNLCSVSCFSLTQTNCSTECIDGCQCKSNM-VYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTF--------CPPGKEWKE-----CGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKC--------PCLWSDKSYLNQSVIYTGP------------------------TNCLSK-CT-CNEGKWGCEQEQKCVGSCK 3187
            C     CS  C   GDPHY+TFD  +   +G C Y +V     I     + + V+N +C  +N   C  S+ +++   +    S   Q+  + N +V     ++P  +N+   +T   +A    + E  + I ++ HQ  +I +    +++   +G CG  + ++ +D  +  G +  +  ++A  WA +  C+S            S        + C+ +  + F SCH  V    + + C++D+C       D  AC S+ +Y + C    + + WR S      C   C +   Y  C    +  CS     +   N     ++GC C  N  +  +  +QC     C         P G  R+         + V +CT   CS+ +F        CP  K   E       +C  TC      C  K       C  GY LS +  +P+H C         C+ ++  Y     I T P                          C+ K CT C+EG    EQE +C G+CK
Sbjct: 5466 CCTKYECSCQCSGWGDPHYSTFDGTYYVFQGICDYVLVQ---EIIPRYNISVHVKNNYCEATNKYACQDSVIVKYKGYEIKLASNTEQIQVSVNDVV-----KVPTFLNEDFSITTSGMAVILNIKEIKSEI-VVSHQGFKINLPF-SYFKGNTEGQCGVCDNDATNDCRRPDGTIDQSCEQMAALWADSPGCESPTP-------HPSEPIPTCTAQVCEVIKSDLFKSCHDIVPYQSYYEACKYDVCY---KRNDTMACASLEAYAQLCGLKSVCVDWRGSDDLNGQCGYNCGDHKVYQACGPKVEKTCSTRYNEMFADNGDQTFMEGCFCPENTYLLSSTTDQCTPTCDC-------IGPDGLPRQPG------DSWVVNCTTYKCSSESFGVVQEPMNCPKIKPCHEGYKSVIENCCPTCVCDTSLCPMK-------CDVGYELSEE--IPEHHCCPHCVPKDVCVHNNTEYQPGVKIPTEPCMECHCHMDKDKDMDEDRHSKLHTVTCVKKVCTPCSEGFELVEQEGECCGTCK 5961          

HSP 3 Score: 90.1225 bits (222), Expect = 2.524e-17
Identity = 106/486 (21.81%), Postives = 176/486 (36.21%), Query Frame = 2
Query: 3149 GCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWD-KGLSIEIALPPQ----------YQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRS----NELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCP-TEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNF----------KCRPDPKCITSTTSYCIGSKLTKCENGVCARICNGIPECSDGSDEANCXXXXXXXXXXXXXQPH------CIYEGRIMQIGEVIKLESCLSVTC 4510
            GC  + +C   C  WGD HY TFDG Y+ F   C YV+V     +          NI    K   C  +  +  ++ V+   +G   K+  N    +  V   +     +++    T S + +  + K +  EI +  Q          ++    G CG  D +  ND +   G  + +       W     C +    P     +        ++C  +K+  F  C  +V  + YY+ C  D C   +  D    C +L A+   C    +   WR     N  C   C   K ++ C     K C  +  N    +N  +  +EGC CP   Y+ +  +++C     C C  P+   +  PG+ +  NC    C+  +F          K +P  +   S    C  + +  C+  +C   C+   E S+   E +C              PH      C++     Q G  I  E C+   C
Sbjct: 5465 GCCTKYECSCQCSGWGDPHYSTFDGTYYVFQGICDYVLVQEIIPR---------YNISVHVKNNYCEATNKYACQDSVIVKYKGYEIKLASNTEQIQVSVNDVVKVPTFLNEDFSITTSGMAVILNIKEIKSEIVVSHQGFKINLPFSYFKGNTEGQCGVCDNDATNDCRRPDGTIDQSCEQMAALWADSPGCESPTPHP-----SEPIPTCTAQVCEVIKSDLFKSCHDIVPYQSYYEACKYDVCY--KRNDTMA-CASLEAYAQLCGLKSVCVDWRGSDDLNGQCGYNCGDHKVYQACGPKVEKTC-STRYNEMFADNGDQTFMEGCFCPENTYLLSSTTDQCTP--TCDCIGPDGLPR-QPGDSWVVNCTTYKCSSESFGVVQEPMNCPKIKPCHEGYKSVIENCCPTCV--CDTSLCPMKCDVGYELSEEIPEHHCC-------------PHCVPKDVCVHNNTEYQPGVKIPTEPCMECHC 5914          

HSP 4 Score: 76.2554 bits (186), Expect = 4.007e-13
Identity = 120/483 (24.84%), Postives = 185/483 (38.30%), Query Frame = 2
Query:  290 GTDCQFPICQQLCKNGGRCIEPD---RC-QCDPKFSGADCSFRIADEKPCIQGCIRGKCKNGDCLCDSGYEGERCDRAFCQYGCGTGICVEPNVCQCPEN-FRGRNCETFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVID-CLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTF----LGLSNSS-----TNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWK-NPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPREC------PANKE--YSECGSSCSQNCEDLITDENCKSFCTAGCF--CPKDRFW---NGTYCVPKPQC 1648
            G  C   + +  C N   C+ P    +C   +P   G +C      +K  I  C+   C +G C+C      +           G G CVE   C C  N     + E    + NT   +      T+ + Y  C+I G  +  TFDG           ILV D C + +  Y +   +  N P      C TS  I + S ++ F    L LS         ++  +Y   I    I +  ++KG+  L +++D K +V +      K  VCGLCG FDGN+  +++F   +GE + +   F   WK NP   D +             N      A   C  +     S C + +   PY   C  + C C + G     C  +A       + +C   G  + WRS    P  C      P+  E  Y  CGS+C + C +     + +     GCF  CP +R +   +   CV + +C
Sbjct:  759 GLTCTCKLGKLHCSNPETCVAPMVLFKCSNYEPGKKGTECQRTC--QKQDINNCVSTGCVSG-CMCPDNLLAD-----------GQGGCVEREKCPCVHNGVTYSSGEQVQEDCNTCTCRNGMWDCTEKECYGTCTIYGEGHFMTFDGKKYSFHGDCEQILVHDYCNTDQSPYSLRLVTE-NIP------CGTSGTICSKSINLFFGRYKLILSEEKEIQVVESNGTDYQYQIHTAGIYNVIEVKGL--LNLIWDSKTSVMLQLHPKFKGKVCGLCGNFDGNA--NNDFMKHDGEEVTDPVVFGNSWKSNPGCPDVSNVMNPCEK-----NPHRSAWAIKQCSIITSPVFSDCHSRVDSGPYYDACVKDTCACDSGGDCDCFCTAVAAY-----AAECRKTGACVAWRSPSICPLFCDYYNNPPSECEWHYKTCGSTCMKTCRNPSGTCSNQIPLLEGCFPQCPSERPFLREDNRKCVTEAEC 1206          

HSP 5 Score: 64.3142 bits (155), Expect = 1.656e-9
Identity = 104/409 (25.43%), Postives = 154/409 (37.65%), Query Frame = 2
Query:  503 DRAFCQYGC-----GTGICVEPNVCQCPENFRGRNCETFFREPNTSNLKISDVINTKYKDYQ-LCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTK-DFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKN---------IGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVF--GGDLSQC--TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLIN-WRSQLCAPRECPANKEYSECGSSCSQNCEDLITDEN-CKSFCTA--GCFCPKDRFWNGT-YCVPKPQCPC 1654
            D  FC  G      G G CV  N C C  +         +++        +      Y D    CS++GGS+VTTFDG S      G+   ++   S    + +  N +   P + D      +L+I   +   T  G+   + NS  N  + I   +         I D N ++    LEI       ++I A    K  + GLCG +  N   S +FK   G +      F  +WK      P+   T   D    L+ D    A + C  +    G  S C   I P I Y+  C  + C C +  + I       C+  S  ++ C   G ++  W        EC  N ++S   + C   C  L   EN C+   T   GC C +  + N    CVP  QCPC
Sbjct:  352 DGCFCPEGTVEDDIGQGGCVPVNECPCVHDGTVYKSGESYQQACKKCFCAAGHWTCTYLDCPGTCSVVGGSHVTTFDGKSFT--FSGNCDYILTKHSNDSDFAVVGNLAKCEPARTDTCLNSVTLVISGTTIGFTSDGVVTLNGNSPFNLPAVIGPVSIFQPSLSFIIADLNSLR----LEIQLAPVMQLYIVASTEEKGKMTGLCGNY--NDVQSDDFKTDLGITEGTAISFANFWKKTPYSCPDLENTF--DNPCSLSVDTEKLAKDWCSRLTNQSGAFSACHSEICPKIYYER-CVYDTCKCADIRKCI-------CAAVSTYAHACAARGIILQGWMDSDPCESECSENMKHSYGMTGCGLTCRSLSGQENTCQGSFTPVDGCVCSEGTYLNEEGICVPADQCPC 742          
BLAST of Hemocytin vs. Ensembl Zebrafish
Match: muc5.3 (mucin 5.3 [Source:ZFIN;Acc:ZDB-GENE-040426-1562])

HSP 1 Score: 419.853 bits (1078), Expect = 1.003e-118
Identity = 364/1261 (28.87%), Postives = 565/1261 (44.81%), Query Frame = 2
Query:  674 LCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYIS------SIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDL-SQCT-ILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTY---CVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMV----ATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIES-YNGIR--ILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLL--YEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDPKCPNGMEYMEC----------KNLCSVSCFSLTQTNCS----TECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTK----NDCS------NVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLL-SNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRG----VRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC----PP---EKTFKTCINDCPKKCFKSNLNNTVLENCAKN--CVEGC--SCPTEY-IEAEGSNKCVKENECFCKLPNSDKKYNPGEIF--TENCLICVCNENNFKCRPD 4261
            +CS  G  +  TFDG   + P   + IL   C S    + +           + +N + ++   T     T + LS  S + N   ++       +  + +  +  IK    L  +++   +  I      +   CGLCG F+G   + +EF +       +V+++   WK   P +      T  +    LN++      N C+D+F   + S C  ++ +  +  +C  +LCHC ++     +C  IA       S QC    GK   WR++   P  CP    YS+CG+ C+  C +    + C   C  GCFCP    ++  +   C+P  +C C+        +Y  G ++  +C  C C +G  ++C  I+ C  +C + G  H TTFD +     G C Y +      T+ ++ G+ V         C  +    C K++++   D    T I + ++ N+ VN+I  +LPL  +    +++ + +   ++IE+   G+R  I      Q+ IT    YQ +  GLCGNYN    DD T   G       + A +W T      +  S+   C+ S E E++A+ +C  L      F  CH  V+P  +   C +D C C  +E  +C C +++SY  AC   G+ L+ WR     D  C   M+Y E              C  +C SL+Q + S       +DGC C     Y      CV  + C C         G T  +    C C  G  SC+      +C+      N +   PG E  EC    ++C   D  C+  GC SGC CP G +   N  C+ K +CPC+ +  +Y +   I     +C + C+C   +W C   Q C  +C  +GD HY+TFD K + F   C Y +V   C    G F+++TENI CG+ GT+C+K+I  +  +  ++L  G    VR    E   Y           R +   L+I T + ++L WD+  +I I L P+Y  +VCGLCGN+D N NNDF ++        L F +SWK   +CP A  + D C  N  R+AWA + C  + +  F+ C   VD   +Y  C+ D C+CD GGD EC CTA++A+  AC + G   +WRS ++CP+ C    PP   E  +K C   C K C   +      E C+     +EGC   CP E  +  E + KCVK+ EC C +    + Y  GE    TENC  C C+     C  D
Sbjct:   64 ICSTWGNYHYKTFDGDYFQLPSTCNYILTSHCSSSYEDFNVQLR-------HELLNNEPTVSKITMKLQGTIIELSRDSLSVNGQTVTLPYSSAEVFIERVTSYISIKAALGLVAMWNEDDSFMIRLDEKYRNQTCGLCGDFNGIP-VYNEFVSGGSSL--SVSDYGNLWKLDGPTE------TCTEDTMFLNENC--GDENFCRDIFSSPVFSDCRGLVSIDSFVQVCIQDLCHCNSSSGAFCLCDTIA-----EYSRQCVHAGGKPEEWRTEYFCPHPCPETMVYSQCGNPCTDTCTNSERGQVCAQHCIDGCFCPPGTVYDDIHQSGCIPYTECSCVLGGK----IYASGENYTSNCRDCTCDQGQ-WDC-YIKDCPHSCSVEGGSHITTFDGKAYTFHGDCTYVLSKHCSGTEFTVLGDLV--------KCGLTETETCLKAITVALFD--GITVINVDSSGNVEVNRIVAQLPLFTSS---VSVFKPSSFYIIIEAPLIGLRLEIQLVPIMQLYITANSVYQGETCGLCGNYNNMEADDFTTIGGLREGTALDFANTWKTRASCPDVKRSFENPCSLSTENEQYAQHWCSLLSDSSSVFAPCHTEVNPEVYKANCIYDSCNCERSE--DCMCAALSSYAHACAARGILLEGWR-----DAAC---MKYTETCAATTVYSYQMTSCGRTCRSLSQADGSCTHDHVLVDGCGCAEGK-YMNENGDCVEAAACSCYDSGKVVALGETISKDGGSCICQQGKLSCSGVSNGEECTEPMRFFNCSSASPGSEGAEC---QKSCNTLDMACISTGCVSGCVCPSGLVSDGNGGCIDKDQCPCIHNGHTYQSGESIKI---DC-NTCSCQNRRWTCTTNQ-CSATCSIYGDGHYRTFDDKRYVFSGNCEYSLVQDFCNSTSGTFRVITENIPCGSTGTTCSKAIKLFLGSNELRLTDGSFQVVRRDAGEEIPY---------QMRTMGLYLVIETKNGLMLIWDRKTTIHIKLGPEYNGRVCGLCGNYDGNANNDFTTRTQAVAVQALDFANSWKLS-SCPDATLIQDPCAHNPYREAWAQRQCSIITSSVFSACHSQVDPSPFYDACVRDACACDSGGDYECFCTAVTAYAQACNEAGACVAWRSPKICPLFCDYYNPPGECEWHYKPCGAPCMKTCRNPD------EQCSNQIPALEGCYPQCPQEQPVFDEDNMKCVKQEECGCFV--DMEHYEVGEQVPTTENCQSCNCSSTGVICEFD 1245          
BLAST of Hemocytin vs. Ensembl Xenopus
Match: ENSXETT00000006505.1 (SCO-spondin [Source:NCBI gene;Acc:100497129])

HSP 1 Score: 497.278 bits (1279), Expect = 1.227e-143
Identity = 367/1295 (28.34%), Postives = 574/1295 (44.32%), Query Frame = 2
Query:  626 NLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYI-SSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILP----VIPYQSICRSELCH-CLNAGQ-------------------NISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLIT--DENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQK-TQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCST-----ECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCEN--QDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGR-ISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPA--AKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENC-AKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPKCITSTTSYCIGSKLTKCENGVC---ARICNGIPECSDGSDE 4381
            +  +  V   + + +  C   GG +  TFDG        G+    +   S   S    + S   CP       + +L +E  +     + ++  +      ++ + I    +GDF  I+    + + +DG+ NV++   L  +    GLCG +  N     +F  + G    +   F   W+     D NT   T                N+ CQ  F   +     +P      P   + +  +C  CL + Q                     S  A   C   +  + +C     +I+WR      ++CP  KEYS+C SSC  +C  + +  D  C+  C +GC CP   +     CV + +CPC  +       Y  G + K+ C  C C +GG ++C + + C+  C + GDPHY TFD++     G+C Y +V  +  + G   L I  +N  C       C +++++    T + T I+L T  +  VN     LP    D   L+++ V+   +L++++ G  +LW  +     ITL   + ++V+GLCG +N N  DD T   G++ T+    A  +  +AEC      ++   C    +  +FA+E C  +L     +CH  V+  PF Q C +D+C C  N+  NC C ++++Y R C + G  + WR+ + C  +C  G  YMEC   C  +C  L      +      C+ GC C   +V D +  QCV  + CQC H    +  GS  ++ C  C C NGVW+CT + C    +CP G      G C  TC++  ++G C +     GC CP+G  L + +CV    CPC    K Y     I        + C C    W C   Q C G C + GD HY TFDG+ F F+  C YV+   +     G F +  EN+ CG  G +CTKS+     N +V ++RG    +      P     G  I+        +  +   + + WD G  + + L P ++ +V GLCGNFD +  NDF S+ G  E     F +SW+  + CP   A D    C  N  R  WA K CG +    FA C + V  + YY  C+ DTC CD GGDCECLCTA++ +   C + G+   WR+ +LCP+ C     ++ C   CP+ C   NL      +C + +CVEGC CP   +  EG  +C+  ++C C        +  G      C  C C    ++C  +P    S+ S+C  ++     +  C   A +C+   +C DGSDE
Sbjct:  171 STALVGVSPQQRRLFSTCVTWGGFHFRTFDGKHFH--FHGTCTYTL--ASSLDSTWAVYISEELCPQPTL---EVTLGLERVTVRRREVSVNGVTVPEGVPHLQNGINILWLGDFLFIESGLGVRVKFDGRNNVYVTVTLDQRGRTRGLCGVY--NEDPQDDFTEVGGNVSPHAAGFANSWRI---QDSNTQVRT----------------NSFCQFHFSMLIYH--FMPSSRCATPRAHLAKPTICFLCLFSSQVDPSGYYETCMYTYCQHSGGASDRAGAVCETFTSYARECAQQKIIIDWRRAGFCEKKCPNGKEYSDCMSSCPASCAAVGSYEDGQCRDECVSGCECPAGLYLEQGVCVKEEECPCFHRRQR----YSPGDTIKQRCNQCVC-RGGRWHCTQDK-CAAQCSVVGDPHYVTFDRKRYSFHGTCDYILV--QDYVDGK--LLITAENVACGSKGSVSCLRAITV----TAHKTSIRLSTKGDYTVNGREVTLPFLSPD---LSVRWVSSSFLLLQTF-GAYVLWSLEFPAAHITLQPVFSNKVRGLCGTFNWNQNDDFTTPEGDIETSSFSFANKFKVSAECPDVGPFTF-DPCGTYAQRREFAEEACAVILSP---ACHDLVEWEPFHQLCLYDVCGCAPNK--NCLCSAVSAYARQCAQEGAIMSWRNQTFCPVQCTGGQMYMECTPPCRKTCADLRMAGTGSCQELEGCVAGCNCPEGLVLDES-GQCVPPNMCQCHHGAETHQPGSKIQQNCKSCVCENGVWNCTGSSCPEAAYCP-GNMVYSPGSCLLTCDSLERNGTCSDT--LDGCVCPEGTALLD-SCVLPEDCPCHHHGKLYHPNDTIVKD----CNTCVCKNRHWSCTDLQ-CSGVCTATGDPHYVTFDGRSFTFLGDCQYVLAREN----GGLFTVTAENVPCGTSGITCTKSVVVMIGNMIVHMLRGKEVTINGISVRPPKIYSGNGITLERAGLFTMFISQMGLTVLWDGGTRVYVKLDPAFRGRVSGLCGNFDGDTENDFTSRQGIVEPTADLFGNSWRMSLMCPEVNADDFEHPCTENSHRVTWARKKCGVLLQSLFAACHQEVPCQQYYDWCVYDTCGCDSGGDCECLCTAIATYAEQCNQRGVYIRWRTQDLCPMQCDNGMVYEACGPACPQTC--KNLGLAPDPHCNSLSCVEGCFCPAGKVLHEG--RCLDPSDCPCYW--GGMPFPTGAAIKHGCKNCTCEAGKWQCPTEP---CSSPSHCADNEFACHLSERCVPNAWVCDNEDDCGDGSDE 1388          

HSP 2 Score: 90.8929 bits (224), Expect = 2.104e-17
Identity = 103/415 (24.82%), Postives = 161/415 (38.80%), Query Frame = 2
Query:  542 CVEPNVCQCPENFRGRNC-ETFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDC---LSRKPSYRIFFNSSYNCP-TKDFVNCDTSLMIETASESVTFL-----GLSNSSTNSNRNYIS-SIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCED--LITDENCKSF-CTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKG 1741
            CV P  C C  + +  +  +T  ++ NT   K      T  +   +C+  G  +  TFDG S           + DC   L+R+ +  +F  ++ N P     + C  S+++   +  V  L      ++  S    + Y    I  +  G F        L +L+DG   V++      +  V GLCG FDG++   ++F +  G        F   W+    + P          CT  N   VT A   C  +     + C   +P   Y   C  + C C + G    +C  IA       + QC   G  I WR+Q   P +C     Y  CG +C Q C++  L  D +C S  C  GCFCP  +  +   C+    CPC        + +  G + K  C+ C C  G
Sbjct:  949 CVLPEDCPCHHHGKLYHPNDTIVKDCNTCVCKNRHWSCTDLQCSGVCTATGDPHYVTFDGRSF--------TFLGDCQYVLARE-NGGLFTVTAENVPCGTSGITCTKSVVVMIGNMIVHMLRGKEVTINGISVRPPKIYSGNGITLERAGLFTMFISQMGLTVLWDGGTRVYVKLDPAFRGRVSGLCGNFDGDT--ENDFTSRQGIVEPTADLFGNSWRM-SLMCPEVNADDFEHPCT-ENSHRVTWARKKCGVLLQSLFAACHQEVPCQQYYDWCVYDTCGCDSGGDCECLCTAIA-----TYAEQCNQRGVYIRWRTQDLCPMQCDNGMVYEACGPACPQTCKNLGLAPDPHCNSLSCVEGCFCPAGKVLHEGRCLDPSDCPCYWGG----MPFPTGAAIKHGCKNCTCEAG 1341          

HSP 3 Score: 54.6842 bits (130), Expect = 2.028e-6
Identity = 41/139 (29.50%), Postives = 61/139 (43.88%), Query Frame = 2
Query: 2540 GRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQT---NCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSH-ENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTC 2944
            G+ C      ++  +   CD  C  GME++EC N C   C    Q         C  GC+C   ++    V  CV +S C+C+  +   +  GS+ +E CN+C C NG   CT N C  +       +W +   C  TC
Sbjct: 3870 GKECPGEKYHVRICNPKPCDEGCLPGMEHVECANKCPRHCSDYQQGIVCQNGELCEAGCRCPEGLLEQDGV--CVPVSHCECTDTQGQSWTPGSSLQEDCNNCTCLNGHLVCTNNTCPRLDC--QWSQWSKWSQCSVTC 4004          
BLAST of Hemocytin vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 462.996 bits (1190), Expect = 9.543e-133
Identity = 348/1247 (27.91%), Postives = 534/1247 (42.82%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDC----LSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIE-TASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWK------------NPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQ--CTLNGKLI-NWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQ--TNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNV------------TFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVS--QLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCP--AAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPP----------EKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCS--CPTEYIEAEGSNKCVKENEC-FCKLPNSDKKYNPGEIFTEN----CLICVCNENNFKC 4252
            CS+ G +++ TFDG   +     S +L  DC     S    YR     S +    ++   D  L ++ TA++    + +  +S   N  ++ S      G +          +  D   NV +  P       CGLCG +  N     +F    G   EN  +F   W              P      +  T  +D          ++A   C  +   D          PY +IC  ++C C            + C   +F  Y   C  +G +  NW +       CP   EY+EC S C + C+ L  +E C+  C  GC CP  +  +G  C+P  +C CI         Y  G + +RDC  C C + G + C+    C G C ++G  H+ +FD +H    G C Y ++AT      +    + ++   C    DA CT+S SL+  D  N T I+L     + ++     LPL +   LR  IQ      V +     +++ W    ++ I L   Y   + GLCGNYNGN  DD    SG + T+  +   SW      + L       C  + +  +F++E C  L+   F SCH  V+P P+++ C +D+C C   ++  C C ++++Y  AC + G+ + WR+   C  +C  G  Y +C + C+ +C SL+    +C   C++GC C   + Y     +CV  S C C ++   +          + C C NG+  C+ +D  +V              CP          C +TC+N +  C+  GC SGC CPDG +     C+   +CPC  + K Y   S +     +C + C C   KW C  E  C  +C + G +HY TFDG  + F   C YV+    CG   G F+++  N  CG  G  CTK I   +RN  ++L           + + K  +    SF  L S    I+   + + + WDKG+ + + L   Y+++VCGLCGNFD   NND  S     E + + F +SWK    C    A     +CK N  +Q  A+  C  +    FA+C KVV+ E Y++ C  DTC+C+  GDC C C +L+A+   C + GI+  WRS+ LCP  C            E  + +C   CP  C      +    NC   CVEGC   CP   I  E S  C++  +C  C +      +    I   +    C +C C   N +C
Sbjct:   30 CSLFGENHIQTFDGTFYDFYGDCSYMLAGDCNKHSFSLLADYRNGKKKSVSLYLGEYF--DIHLFLDGTATQGEKHISMPYAS---NGIFLES----EAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNY--NQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPD----------PYIAICEDDMCECAE---------ELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTCQSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKR----YPPGSAIRRDCNSCTC-QNGAWECSN-EDCPGECFVTGQSHFKSFDNKHFTFSGICQY-LLATD---AMDSTFSVTIETVQCADDIDAVCTRSASLRLLDMHNIT-IKLKHGGGVSLDGQDILLPL-VQGFLR--IQTTVLSAVRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDCTDLMKQDTDPCNLNPKRARFSEEVCFALMDSAFQSCHNEVNPAPYLKNCRYDVCSCSNGKE--CLCSALSTYAAACSRKGILIDWRTPEFCPIQCSEGKIYQQCGSPCNQTCRSLSHPDVDCREFCMEGCYCPPGL-YTNEDGECVPKSDCSCYYDGELFQPDDVFSNHYSMCYCENGLMHCSTSDVPSVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGCISGCTCPDGMVRHKSKCMFPQRCPCFHAGKEYAPGSSV---EIDC-NTCVCENRKWKC-TENICDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGTFRILVGNEGCGFSGEKCTKRITILFRNGEIELTN--------EQIHIKKPLSDETSFDVLKSGNYFILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADFGAVSPLSLCKDNLMKQMAAENACNILMGDLFAECAKVVNPEPYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTC-----QHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC 1211          

HSP 2 Score: 194.512 bits (493), Expect = 7.578e-49
Identity = 166/584 (28.42%), Postives = 262/584 (44.86%), Query Frame = 2
Query: 2891 FCPPGKEWKEC-GHCDQTCE--NQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNK-GTSCTKSI---FFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYT-DSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCP-AAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCN--------------ENNFKCRPDPKCITSTTSYCIGSKLTKCENGVCARIC-NGIPECSDGSDEANCX----XXXXXXXXXXXXQPHCIYEGRIMQIGEVIKLESCLSVTCTDRRIVETRQNCDKTC 4558
             CP G E+ EC   C +TC+  N +  C E+ C  GC CPDG +L    C+P  +C C+ S K Y   S I     +C S CTC  G W C  E  C G C   G +H+K+FD K+F F   C Y++           F +  E ++C +     CT+S         N  ++L  G     ++ ++     V+G +  +  V   +  T   D+ + WD    + I L P Y   + GLCGN++ N  +DF + +G  E ++  F +SWK   +C    K   D C  N +R  +++++C  + +  F  C   V+   Y + C  D CSC  G   ECLC+ALS + +AC + GI   WR+ E CP+ C   K ++ C + C + C   +  +    +C + C+EGC CP      E   +CV +++C C      + + P ++F+ +  +C C               + +  CRP    I          K T  E   CA+ C N   EC      + CT      + K+      +  C + G+    G  ++++ C +  C +R+   T   CD TC
Sbjct:  289 LCPFGMEYNECVSPCVKTCQSLNINEVCQEQ-CIDGCSCPDGKVLDGDRCIPVFECSCIHSGKRYPPGSAIRR---DCNS-CTCQNGAWECSNED-CPGECFVTGQSHFKSFDNKHFTFSGICQYLLATDAMDST---FSVTIETVQCADDIDAVCTRSASLRLLDMHNITIKLKHGGGVS-LDGQDILLPLVQGFLRIQTTVLSAVRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDCTDLMKQDTDPCNLNPKRARFSEEVCFALMDSAFQSCHNEVNPAPYLKNCRYDVCSCSNGK--ECLCSALSTYAAACSRKGILIDWRTPEFCPIQCSEGKIYQQCGSPCNQTCRSLSHPDV---DCREFCMEGCYCPPGLYTNE-DGECVPKSDCSCYY--DGELFQPDDVFSNHYSMCYCENGLMHCSTSDVPSVKRSLDCRPPLNKIICPAD---NPKATGIE---CAKTCQNYELECVSHGCISGCTCPDGMVRHKSKCMFPQRCPCFHAGKEYAPGSSVEID-CNTCVCENRKWKCTENICDATC 847          

HSP 3 Score: 97.8265 bits (242), Expect = 1.660e-19
Identity = 101/383 (26.37%), Postives = 155/383 (40.47%), Query Frame = 2
Query: 1772 CSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQ-EVAHDTVLIESYNGIRILWHQKTQIEITL-PEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAE-CKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCF-SLTQTNCSTECIDGCQCKSNMVYDTAVN-QCVNISQC-QCS----HENAYYPSGSTRKEKCNDCNCT-NGVWSCTKNDCSNV 2887
            C   C+ S   H  TFD     + G+C Y +   +        +K+ + N  C  +N   C KS+ ++     N   I L +   + VN     LP   ND   +T+  E+ H+ V I     +        +  + L P  +  +  GLCG  + N+ +D T S G +TT+ ++    W   +    T        C +    E      C+ +L + F +CH    P P+   CE     C G +     CE +A+Y   C  NG+ + WR+   C  +CP  M Y  C   C+  C  +L  T CS    +GC C      D  VN +CVN   C QC+     E+    +       C+ C C  N + +CT   C  V
Sbjct: 1951 CPCMCMGSSTRHIVTFDGLDFKLMGACSYVLFHDE-----VHDVKVILHNAECNTTNHQTCMKSVEVKH----NKYSILLSSNMQVSVNGDIVPLPYA-NDNFEVTLYGEIVHE-VKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLGRTCETKPDKACTQPISSE------CKIMLSKTFEACHTIFPPKPYFTVCEE--ASCHGQD----ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEG---DVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTV 2307          

HSP 4 Score: 90.1225 bits (222), Expect = 3.355e-17
Identity = 122/505 (24.16%), Postives = 192/505 (38.02%), Query Frame = 2
Query: 2954 DGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKG-TSCTKSI--------FFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQL-IIYT----DSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQ--AWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTEN---CLICVCNEN---NFKCRPDPKCITSTTSYCIGSKLTKCENGVCAR---IC-------NGIPECSDG 4372
            D + L   C S    PDG     KT +  HK  C    K   + ++           C C   +W C     C+GS       H  TFDG  F  +  CSYV+   +    +   K++  N EC      +C KS+             N  V +   + P    N+N+ +  + G I     + QL  ++T    +++ +L  +         P  +  +  GLCG  DQN  NDF    G+   +   F+  W           +   C++  ++         C  M +  F  C  +   + Y+  C   +C    G D   +C  ++A+   C+  G+  +WR+ + CP+ CP    +  C   C K+C K+ LN T+   C+ +  EGC CP   +   G  KCV E  C        +++   E +      C IC+C EN   N    P P     T   C   +L K     C     +C       N +P C +G
Sbjct: 1896 DKWMLTDKCHSVTCLPDG-----KTLLESHKVNCEKIPKPMCHNNL---PAMKIEETCGC---RWTCPC--MCMGS----STRHIVTFDGLDFKLMGACSYVLFHDE----VHDVKVILHNAECNTTNHQTCMKSVEVKHNKYSILLSSNMQVSVNGDIVPLPYANDNF-EVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLN---------PAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWT------VVDSLGRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKT-LNGTL---CSDSSTEGCFCPEGDVIVNG--KCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTCDVNPVPHCENG 2351          

HSP 5 Score: 82.8037 bits (203), Expect = 5.824e-15
Identity = 88/377 (23.34%), Postives = 148/377 (39.26%), Query Frame = 2
Query:  677 CSIMGGS--YVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTN--------SNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFA--PLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCP-CIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKI 1765
            C  MG S  ++ TFDG+  +     S +L  D +      ++  +++  C T +   C  S+ ++    S+        S N        +N N+  ++  + + +  +I  +G     +    N F+    P        GLCG  D N+   ++F   +G    + ++F+K W   D +        GR   T  +K      ++ C+ +       C TI P  PY ++C    CH    GQ+I       C + +   + C +NG  INWR+    P ECP    Y  C   C++ C   +    C    T GCFCP+        CV +  C  C  + G    +    +     C IC C +  + NC  +
Sbjct: 1953 CMCMGSSTRHIVTFDGLDFKLMGACSYVLFHDEVH---DVKVILHNA-ECNTTNHQTCMKSVEVKHNKYSILLSSNMQVSVNGDIVPLPYANDNFEVTLYGEIVHEV-KIPQLG-FVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTV--NDFTLSDGSVTTDSSKFIKEWTVVDSL--------GRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASCH----GQDI-------CEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAM 2302          
BLAST of Hemocytin vs. Ensembl Xenopus
Match: igsf10 (immunoglobulin superfamily member 10 [Source:Xenbase;Acc:XB-GENE-6072998])

HSP 1 Score: 456.062 bits (1172), Expect = 2.511e-131
Identity = 319/1004 (31.77%), Postives = 475/1004 (47.31%), Query Frame = 2
Query: 1334 CRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTY---CVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQK--TQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTL-KWRSSSLCDPK---CPNGMEYMECKNLCSVSCFSLTQTNCSTEC----IDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKN------------DCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKT-CVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKG--IGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCP---PEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNEN 4240
            C+ +LCHC N   +  +C+ +A       S QC    G+ +NWR++   P+ CP N EY ECGS+C   C +      C   C  GC+CPK   ++  Y   C+P  +CPCI         Y  G S+   C  C CS G  +NC  +  CS TC + G  H TT+D+ H  + G C Y +      +   +   +  +   C  S    C KS+ +     +  T I++    ++ VN I  +LPL         I +     +++E+  G+++        Q+ +TL   +Q +  GLCGN+N   +DD     G L       A SW A A+C + +   Y   C+ S E E++A  +C  +     PF +CH  V P  F + C  D C C  +E  +C C +++SY R C+  G+ L +W+S + C      CP  + Y      C  +C S  + + +       +DGC C      D +  +CV  + C C ++ +  PSG    +    C+CT G  +C  +            DC+N      G E      C ++C+  D  C    C SGC CPDG L   K  C+ + +CPC  +  +Y     I     NC    TC   KW C  E  C+G+C  +GD HY TFDGK + F   C Y +V  +CG+      F+++TENI CG  GT+C+K+I  Y R+  + L       V  +   P  +V   I +  +   L+I +DS +IL WDK  SI I L   ++ +VCGLCGN+D + NNDF +++ +   + + F +SWK    CP A    D C +N  R++WA K C  +    F+ C   +D   YY  C+SD+C+CD GGDCEC+CTA++A+  AC + GI  SWR+  +CPV C    PE   +     C   C K+  N T   NC  N + G       +EA           C+C    +   YN   I+T+ CL  +C EN
Sbjct:  176 CQQDLCHCDNKMSSTCICSTLA-----EYSRQCAHAGGQPVNWRTKHFCPKNCPLNMEYRECGSACPNTCTNPERAALCNEHCLEGCYCPKGTVFDDVYNTGCIPVDRCPCITGGE----TYSSGESYSTPCSTCVCSSGK-WNCKDLP-CSSTCSVEGGSHVTTYDQTHYNIHGECNYVLT----KMCDGRAFTVVTEIRKCGLSESESCLKSIMILLNGQE--TNIEIKPDGSVYVNTIYTQLPLST---ASFIIFQPTSFYIIVETNFGLQVTAQLTPLMQVYVTLHPAFQTKTCGLCGNFNSIQKDDFLTVYGILEGTAASFANSWKAQADCPN-IKNDYTDPCSLSIENEQYASHWCGLISDPNGPFAACHSKVSPRRFQKICMFDSCSCEKSE--DCMCAALSSYIRVCLSKGVILTEWQSHTPCSKYSKYCPESLHYTSSMKTCQPTCRSRFEPDITCNIKFLPVDGCSCTKGFFMDDS-GKCVPETACPCYYKGSAVPSGQVVHDNGKQCSCTQGQLNCIGDNKPECTAPMVYFDCNNAAKGTKGAE------CQKSCQILDTQCYRTNCVSGCVCPDGLLSDGKGGCIHEDQCPCEHNGATYQPGESIKVKCNNC----TCKNRKWECTNE-PCLGTCAVYGDGHYITFDGKQYTFNGNCEYSLVQDNCGRSDSSSSFRVITENIPCGTTGTTCSKAIKIYLRSFELSLANEQFDIVKRD---PDAKVPYTIRYMGIY--LVIESDSGLILLWDKKTSIFIKLTKDFEGKVCGLCGNYDGDGNNDFTTRSLSVVGDPVEFGNSWKLNPTCPDANTTRDPCSANPYRKSWAQKQCSIINGKAFSACHSQLDPSQYYDACVSDSCACDSGGDCECMCTAIAAYALACGEAGICVSWRTPSICPVFCDYYNPEGECEWHYKPCGHSCMKTCRNPT--GNCLYN-LPG-------LEA-----------CYCMYNGTKYNYN-DVIYTKGCLSAICKEN 1117          

HSP 2 Score: 95.9005 bits (237), Expect = 6.253e-19
Identity = 90/373 (24.13%), Postives = 145/373 (38.87%), Query Frame = 2
Query: 1781 TCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHD-TVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMK-NGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTN-CSTECIDGCQCKSNMVYDTAVNQ-CVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNV 2887
             C   G+ ++  FD       G+C Y   +   S    +   I +Q T  + SN      ++ +      N   +Q V  K +LV+      P        L +Q  +H+ ++ I S  G+ ++ +    + + L E Y +Q  GLCG+YNG S  +     G   T                                 +F     Q+L            + N  I+ C+ D+C C       C C ++A Y R C    G  + WR+   C   CP  MEY EC + C  +C +  +   C+  C++GC C    V+D   N  C+ + +C C      Y SG +    C+ C C++G W+C    CS+ 
Sbjct:    2 VCSTWGNFNFKNFDGDIFRFPGTCNYVYASHCKS--DYEDFNIQIQRTG-ISSNPVMNKITIKI------NGVVVQ-VNKKTVLVDGKAVHFPYN-----GLGVQIESHEFSIKISSKLGLVLMLNDDNSLLLELDEKYANQTCGLCGDYNGISVHNEFIKQGVHITE-------------------------------TQFGN--LQKL--------DGPTEQNSKIEACQQDLCHCDNKMSSTCICSTLAEYSRQCAHAGGQPVNWRTKHFCPKNCPLNMEYRECGSACPNTCTNPERAALCNEHCLEGCYCPKGTVFDDVYNTGCIPVDRCPCITGGETYSSGESYSTPCSTCVCSSGKWNCKDLPCSST 318          

HSP 3 Score: 93.9745 bits (232), Expect = 2.103e-18
Identity = 79/302 (26.16%), Postives = 119/302 (39.40%), Query Frame = 2
Query: 3149 GCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWD----------KGLSIEIALP-PQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRV-----------NCPAAKDVP-DMCKSNH-----ERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWR--SNELC 3964
            GC    +C   C  WGD HY TFDG Y+ F+  C+YV+V     K   F  LV       + G SC +SI  YY+N  V L R +    M N    + R     +     +  I  T + I +  +           G+   I LP  ++     G CG    NL ++ +   G    +     + WK  V             P     P    +S H             +C  + +  FADC +++  + YY+ C+ D+C   R G+    C +L  + S C   G+  +WR  +N LC
Sbjct: 1610 GCCFHYECQCVCSGWGDPHYITFDGIYYTFLDNCTYVLVQQIIPKYDNFRVLVDNYFCAASDGLSCPQSIIIYYKNNEVLLTRQLFQGKMAN----RIRFNNDWTTPGFTTNGITVTSAGINMIVEIPEIGAYISFSGMIFLIKLPYSKFGYNTEGQCGTCSNNLTDECRLPDGEIVQDCSKMANEWKVNVPEKPYCNLTKPTLPPYTSTPVSPTRSTHGTTPVPPTCPPSLICNVILSEIFADCHEIIPPKHYYEGCVFDSC---RAGNESMQCASLEVYASLCISNGVCVNWRNKTNGLC 1904          

HSP 4 Score: 90.5077 bits (223), Expect = 2.864e-17
Identity = 91/380 (23.95%), Postives = 154/380 (40.53%), Query Frame = 2
Query: 3182 CKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQ-NLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGID-YSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNK-CVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPKCITSTTSYCIGSKLT 4312
            C +WG+ ++K FDG  F F   C+YV   S C      F +  +    G         I       VVQ+ +       +  ++P + +  +I   +    + I +   ++L  +   S+ + L  +Y NQ CGLCG+++  +++N+F  +           V   +++       D P                  T +N K   CQ+             D C CD      C+C+ L+ +   C   G    +WR+   CP  CP    ++ C + CP  C  +N     L  C ++C+EGC CP   +  +  N  C+  + C C      + Y+ GE ++  C  CVC+   + C+  P   +ST S   GS +T
Sbjct:    3 CSTWGNFNFKNFDGDIFRFPGTCNYVYA-SHCKSDYEDFNIQIQRT--GISSNPVMNKITIKINGVVVQVNKKTVLVDGKAVHFPYNGLGVQIESHEF--SIKISSKLGLVLMLNDDNSLLLELDEKYANQTCGLCGDYNGISVHNEFIKQG----------VHITETQFGNLQKLDGP------------------TEQNSKIEACQQ-------------DLCHCDNKMSSTCICSTLAEYSRQCAHAGGQPVNWRTKHFCPKNCPLNMEYRECGSACPNTC--TNPERAAL--CNEHCLEGCYCPKGTVFDDVYNTGCIPVDRCPCI--TGGETYSSGESYSTPCSTCVCSSGKWNCKDLP--CSSTCSVEGGSHVT 328          

HSP 5 Score: 62.003 bits (149), Expect = 1.351e-8
Identity = 75/300 (25.00%), Postives = 116/300 (38.67%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCP-TKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWK-NPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPREC----PANK---EYSECGSSCSQNCED 1546
            C++ G  +  TFDG            LV D   R  S   F   + N P       C  ++ I   S  ++           + +       + +G +  I+    L +L+D K ++FI      +  VCGLCG +DG+   +++F   +   + +  EF   WK NP   D N    T RD C+  N    + A   C  + G   S C + L    Y   C S+ C C + G    +C  IA       +  C   G  ++WR+    P  C    P  +    Y  CG SC + C +
Sbjct:  787 CAVYGDGHYITFDGKQYTFNGNCEYSLVQDNCGRSDSSSSFRVITENIPCGTTGTTCSKAIKIYLRSFELSLANEQFDIVKRDPDAKVPYTIRYMGIYLVIESDSGLILLWDKKTSIFIKLTKDFEGKVCGLCGNYDGDG--NNDFTTRSLSVVGDPVEFGNSWKLNPTCPDAN----TTRDPCSA-NPYRKSWAQKQCSIINGKAFSACHSQLDPSQYYDACVSDSCACDSGGDCECMCTAIAA-----YALACGEAGICVSWRTPSICPVFCDYYNPEGECEWHYKPCGHSCMKTCRN 1074          
BLAST of Hemocytin vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 457.218 bits (1175), Expect = 8.191e-131
Identity = 348/1261 (27.60%), Postives = 533/1261 (42.27%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDC----LSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIE-TASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWK------------NPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQ--CTLNGKLI-NWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQ--TNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCS--------------------------NVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVS--QLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCP--AAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPP----------EKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCS--CPTEYIEAEGSNKCVKENEC-FCKLPNSDKKYNPGEIFTEN----CLICVCNENNFKC 4252
            CS+ G +++ TFDG   +     S +L  DC     S    YR     S +    ++   D  L ++ TA++    + +  +S   N  ++ S      G +          +  D   NV +  P       CGLCG +  N     +F    G   EN  +F   W              P      +  T  +D          ++A   C  +   D          PY +IC  ++C C            + C   +F  Y   C  +G +  NW +       CP   EY+EC S C + C+ L  +E C+  C  GC CP  +  +G  C+P  +C CI         Y  G + +RDC  C C + G + C+    C G C ++G  H+ +FD +H    G C Y ++AT      +    + ++   C    DA CT+S SL+  D  N T I+L     + ++     LPL +   LR  IQ      V +     +++ W    ++ I L   Y   + GLCGNYNGN  DD    SG + T+  +   SW      + L       C  + +  +F++E C  L+   F SCH  V+P P+++ C +D+C C   ++  C C ++++Y  AC + G+ + WR+   C  +C  G  Y +C + C+ +C SL+    +C   C++GC C   + Y     +CV  S C C ++   +          + C C NG+  C+ +D                            N   CP          C +TC+N +  C+  GC SGC CPDG +     C+   +CPC  + K Y   S +     +C + C C   KW C  E  C  +C + G +HY TFDG  + F   C YV+    CG   G F+++  N  CG  G  CTK I   +RN  ++L           + + K  +    SF  L S    I+   + + + WDKG+ + + L   Y+++VCGLCGNFD   NND  S     E + + F +SWK    C    A     +CK N  +Q  A+  C  +    FA+C KVV+ E Y++ C  DTC+C+  GDC C C +L+A+   C + GI+  WRS+ LCP  C            E  + +C   CP  C      +    NC   CVEGC   CP   I  E S  C++  +C  C +      +    I   +    C +C C   N +C
Sbjct:   30 CSLFGENHIQTFDGTFYDFYGDCSYMLAGDCNKHSFSLLADYRNGKKKSVSLYLGEYF--DIHLFLDGTATQGEKHISMPYAS---NGIFLES----EAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNY--NQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPD----------PYIAICEDDMCECAE---------ELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTCQSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKR----YPPGSAIRRDCNSCTC-QNGAWECSN-EDCPGECFVTGQSHFKSFDNKHFTFSGICQY-LLATD---AMDSTFSVTIETVQCADDIDAVCTRSASLRLLDMHNIT-IKLKHGGGVSLDGQDILLPL-VQGFLR--IQTTVLSAVRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDCTDLMKQDTDPCNLNPKRARFSEEVCFALMDSAFQSCHNEVNPAPYLKNCRYDVCSCSNGKE--CLCSALSTYAAACSRKGILIDWRTPEFCPIQCSEGKIYQQCGSPCNQTCRSLSHPDVDCREFCMEGCYCPPGL-YTNEDGECVPKSDCSCYYDGELFQPDDVFSNHYSMCYCENGLMHCSTSDVPSGYFPESFFNQPPARVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGCISGCTCPDGMVRHKSKCMFPQRCPCFHAGKEYAPGSSV---EIDC-NTCVCENRKWKC-TENICDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGTFRILVGNEGCGFSGEKCTKRITILFRNGEIELTN--------EQIHIKKPLSDETSFDVLKSGNYFILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADFGAVSPLSLCKDNLMKQMAAENACNILMGDLFAECAKVVNPEPYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTC-----QHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC 1225          

HSP 2 Score: 97.8265 bits (242), Expect = 1.641e-19
Identity = 101/383 (26.37%), Postives = 155/383 (40.47%), Query Frame = 2
Query: 1772 CSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQ-EVAHDTVLIESYNGIRILWHQKTQIEITL-PEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAE-CKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCF-SLTQTNCSTECIDGCQCKSNMVYDTAVN-QCVNISQC-QCS----HENAYYPSGSTRKEKCNDCNCT-NGVWSCTKNDCSNV 2887
            C   C+ S   H  TFD     + G+C Y +   +        +K+ + N  C  +N   C KS+ ++     N   I L +   + VN     LP   ND   +T+  E+ H+ V I     +        +  + L P  +  +  GLCG  + N+ +D T S G +TT+ ++    W   +    T        C +    E      C+ +L + F +CH    P P+   CE     C G +     CE +A+Y   C  NG+ + WR+   C  +CP  M Y  C   C+  C  +L  T CS    +GC C      D  VN +CVN   C QC+     E+    +       C+ C C  N + +CT   C  V
Sbjct: 1928 CPCMCMGSSTRHIVTFDGLDFKLMGACSYVLFHDE-----VHDVKVILHNAECNTTNHQTCMKSVEVKH----NKYSILLSSNMQVSVNGDIVPLPYA-NDNFEVTLYGEIVHE-VKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLGRTCETKPDKACTQPISSE------CKIMLSKTFEACHTIFPPKPYFTVCEE--ASCHGQD----ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEG---DVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTV 2284          

HSP 3 Score: 91.6633 bits (226), Expect = 1.209e-17
Identity = 119/500 (23.80%), Postives = 193/500 (38.60%), Query Frame = 2
Query: 2993 FCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNC--LSKCTCNEGKWGCEQEQKC----VGSCKSWGDA--HYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKG-TSCTKSI--------FFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQL-IIYT----DSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQ--AWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTEN---CLICVCNEN---NFKCRPDPKCITSTTSYCIGSKLTKCENGVCAR---IC-------NGIPECSDG 4372
             C D ++L++K     H   CL   K+ L    +     NC  + K  C+      + E+ C       C   G +  H  TFDG  F  +  CSYV+   +    +   K++  N EC      +C KS+             N  V +   + P    N+N+ +  + G I     + QL  ++T    +++ +L  +         P  +  +  GLCG  DQN  NDF    G+   +   F+  W           +   C++  ++         C  M +  F  C  +   + Y+  C   +C    G D   +C  ++A+   C+  G+  +WR+ + CP+ CP    +  C   C K+C K+ LN T+   C+ +  EGC CP   +   G  KCV E  C        +++   E +      C IC+C EN   N    P P     T   C   +L K     C     +C       N +P C +G
Sbjct: 1870 ICTDKWMLTDKC----HSVTCLPDGKTLLESHKV-----NCEKIPKPMCHNNLPAMKIEETCGCRWTCPCMCMGSSTRHIVTFDGLDFKLMGACSYVLFHDE----VHDVKVILHNAECNTTNHQTCMKSVEVKHNKYSILLSSNMQVSVNGDIVPLPYANDNF-EVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLN---------PAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWT------VVDSLGRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKT-LNGTL---CSDSSTEGCFCPEGDVIVNG--KCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTCDVNPVPHCENG 2328          

HSP 4 Score: 82.8037 bits (203), Expect = 6.062e-15
Identity = 88/377 (23.34%), Postives = 148/377 (39.26%), Query Frame = 2
Query:  677 CSIMGGS--YVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTN--------SNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFA--PLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCP-CIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKI 1765
            C  MG S  ++ TFDG+  +     S +L  D +      ++  +++  C T +   C  S+ ++    S+        S N        +N N+  ++  + + +  +I  +G     +    N F+    P        GLCG  D N+   ++F   +G    + ++F+K W   D +        GR   T  +K      ++ C+ +       C TI P  PY ++C    CH    GQ+I       C + +   + C +NG  INWR+    P ECP    Y  C   C++ C   +    C    T GCFCP+        CV +  C  C  + G    +    +     C IC C +  + NC  +
Sbjct: 1930 CMCMGSSTRHIVTFDGLDFKLMGACSYVLFHDEVH---DVKVILHNA-ECNTTNHQTCMKSVEVKHNKYSILLSSNMQVSVNGDIVPLPYANDNFEVTLYGEIVHEV-KIPQLG-FVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTV--NDFTLSDGSVTTDSSKFIKEWTVVDSL--------GRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASCH----GQDI-------CEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAM 2279          
BLAST of Hemocytin vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 456.447 bits (1173), Expect = 1.282e-130
Identity = 353/1265 (27.91%), Postives = 537/1265 (42.45%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDC----LSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIE-TASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWK-----------NPDPIDPNTYYTTGRDLCTGLNK----DLVTTANNM-CQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQ--CTLNGKLI-NWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQ--TNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCS--------------------------NVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVS--QLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCP--AAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPP----------EKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCS--CPTEYIEAEGSNKCVKENEC-FCKLPNSDKKYNPGEIFTEN----CLICVCNENNFKC 4252
            CS+ G +++ TFDG   +     S +L  DC     S    YR     S +    ++   D  L ++ TA++    + +  +S   N  ++ S      G +          +  D   NV +  P       CGLCG +  N     +F    G   EN  +F   W             P     N    T   +  GL K     L T++  M C  +   D          PY +IC  ++C C            + C   +F  Y   C  +G +  NW +       CP   EY+EC S C + C+ L  +E C+  C  GC CP  +  +G  C+P  +C CI         Y  G + +RDC  C C + G + C+    C G C ++G  H+ +FD +H    G C Y ++AT      +    + ++   C    DA CT+S SL+  D  N T I+L     + ++     LPL +   LR  IQ      V +     +++ W    ++ I L   Y   + GLCGNYNGN  DD    SG + T+  +   SW      + L       C  + +  +F++E C  L+   F SCH  V+P P+++ C +D+C C   ++  C C ++++Y  AC + G+ + WR+   C  +C  G  Y +C + C+ +C SL+    +C   C++GC C   + Y     +CV  S C C ++   +          + C C NG+  C+ +D                            N   CP          C +TC+N +  C+  GC SGC CPDG +     C+   +CPC  + K Y   S +     +C + C C   KW C  E  C  +C + G +HY TFDG  + F   C YV+    CG   G F+++  N  CG  G  CTK I   +RN  ++L           + + K  +    SF  L S    I+   + + + WDKG+ + + L   Y+++VCGLCGNFD   NND  S     E + + F +SWK    C    A     +CK N  +Q  A+  C  +    FA+C KVV+ E Y++ C  DTC+C+  GDC C C +L+A+   C + GI+  WRS+ LCP  C            E  + +C   CP  C      +    NC   CVEGC   CP   I  E S  C++  +C  C +      +    I   +    C +C C   N +C
Sbjct:   24 CSLFGENHIQTFDGTFYDFYGDCSYMLAGDCNKHSFSLLADYRNGKKKSVSLYLGEYF--DIHLFLDGTATQGEKHISMPYAS---NGIFLES----EAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNY--NQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSETAEKVYVGLWKVECQMLKTSSAFMQCHHLVDPD----------PYIAICEDDMCECAE---------ELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTCQSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKR----YPPGSAIRRDCNSCTC-QNGAWECSN-EDCPGECFVTGQSHFKSFDNKHFTFSGICQY-LLATD---AMDSTFSVTIETVQCADDIDAVCTRSASLRLLDMHNIT-IKLKHGGGVSLDGQDILLPL-VQGFLR--IQTTVLSAVRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDCTDLMKQDTDPCNLNPKRARFSEEVCFALMDSAFQSCHNEVNPAPYLKNCRYDVCSCSNGKE--CLCSALSTYAAACSRKGILIDWRTPEFCPIQCSEGKIYQQCGSPCNQTCRSLSHPDVDCREFCMEGCYCPPGL-YTNEDGECVPKSDCSCYYDGELFQPDDVFSNHYSMCYCENGLMHCSTSDVPSGYFPESFFNQPPARVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGCISGCTCPDGMVRHKSKCMFPQRCPCFHAGKEYAPGSSV---EIDC-NTCVCENRKWKC-TENICDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGTFRILVGNEGCGFSGEKCTKRITILFRNGEIELTN--------EQIHIKKPLSDETSFDVLKSGNYFILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADFGAVSPLSLCKDNLMKQMAAENACNILMGDLFAECAKVVNPEPYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTC-----QHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC 1223          

HSP 2 Score: 97.4413 bits (241), Expect = 2.417e-19
Identity = 101/383 (26.37%), Postives = 155/383 (40.47%), Query Frame = 2
Query: 1772 CSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQ-EVAHDTVLIESYNGIRILWHQKTQIEITL-PEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAE-CKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCF-SLTQTNCSTECIDGCQCKSNMVYDTAVN-QCVNISQC-QCS----HENAYYPSGSTRKEKCNDCNCT-NGVWSCTKNDCSNV 2887
            C   C+ S   H  TFD     + G+C Y +   +        +K+ + N  C  +N   C KS+ ++     N   I L +   + VN     LP   ND   +T+  E+ H+ V I     +        +  + L P  +  +  GLCG  + N+ +D T S G +TT+ ++    W   +    T        C +    E      C+ +L + F +CH    P P+   CE     C G +     CE +A+Y   C  NG+ + WR+   C  +CP  M Y  C   C+  C  +L  T CS    +GC C      D  VN +CVN   C QC+     E+    +       C+ C C  N + +CT   C  V
Sbjct: 1926 CPCMCMGSSTRHIVTFDGLDFKLMGACSYVLFHDE-----VHDVKVILHNAECNTTNHQTCMKSVEVKH----NKYSILLSSNMQVSVNGDIVPLPYA-NDNFEVTLYGEIVHE-VKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLGRTCETKPDKACTQPISSE------CKIMLSKTFEACHTIFPPKPYFTVCEE--ASCHGQD----ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEG---DVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTV 2282          

HSP 3 Score: 91.2781 bits (225), Expect = 1.583e-17
Identity = 119/500 (23.80%), Postives = 193/500 (38.60%), Query Frame = 2
Query: 2993 FCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNC--LSKCTCNEGKWGCEQEQKC----VGSCKSWGDA--HYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKG-TSCTKSI--------FFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQL-IIYT----DSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQ--AWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTEN---CLICVCNEN---NFKCRPDPKCITSTTSYCIGSKLTKCENGVCAR---IC-------NGIPECSDG 4372
             C D ++L++K     H   CL   K+ L    +     NC  + K  C+      + E+ C       C   G +  H  TFDG  F  +  CSYV+   +    +   K++  N EC      +C KS+             N  V +   + P    N+N+ +  + G I     + QL  ++T    +++ +L  +         P  +  +  GLCG  DQN  NDF    G+   +   F+  W           +   C++  ++         C  M +  F  C  +   + Y+  C   +C    G D   +C  ++A+   C+  G+  +WR+ + CP+ CP    +  C   C K+C K+ LN T+   C+ +  EGC CP   +   G  KCV E  C        +++   E +      C IC+C EN   N    P P     T   C   +L K     C     +C       N +P C +G
Sbjct: 1868 ICTDKWMLTDKC----HSVTCLPDGKTLLESHKV-----NCEKIPKPMCHNNLPAMKIEETCGCRWTCPCMCMGSSTRHIVTFDGLDFKLMGACSYVLFHDE----VHDVKVILHNAECNTTNHQTCMKSVEVKHNKYSILLSSNMQVSVNGDIVPLPYANDNF-EVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLN---------PAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWT------VVDSLGRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKT-LNGTL---CSDSSTEGCFCPEGDVIVNG--KCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTCDVNPVPHCENG 2326          

HSP 4 Score: 82.8037 bits (203), Expect = 6.993e-15
Identity = 88/377 (23.34%), Postives = 148/377 (39.26%), Query Frame = 2
Query:  677 CSIMGGS--YVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTN--------SNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFA--PLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCP-CIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKI 1765
            C  MG S  ++ TFDG+  +     S +L  D +      ++  +++  C T +   C  S+ ++    S+        S N        +N N+  ++  + + +  +I  +G     +    N F+    P        GLCG  D N+   ++F   +G    + ++F+K W   D +        GR   T  +K      ++ C+ +       C TI P  PY ++C    CH    GQ+I       C + +   + C +NG  INWR+    P ECP    Y  C   C++ C   +    C    T GCFCP+        CV +  C  C  + G    +    +     C IC C +  + NC  +
Sbjct: 1928 CMCMGSSTRHIVTFDGLDFKLMGACSYVLFHDEVH---DVKVILHNA-ECNTTNHQTCMKSVEVKHNKYSILLSSNMQVSVNGDIVPLPYANDNFEVTLYGEIVHEV-KIPQLG-FVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTV--NDFTLSDGSVTTDSSKFIKEWTVVDSL--------GRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASCH----GQDI-------CEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAM 2277          
BLAST of Hemocytin vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 451.825 bits (1161), Expect = 5.159e-129
Identity = 367/1353 (27.12%), Postives = 565/1353 (41.76%), Query Frame = 2
Query:  632 KISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTK------DFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNP--DP--IDPNTYYTTGRDLCTGLNKDLVTT-----ANNMCQDVFGGDLSQCTILPVIP--YQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDE--NCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGS--CFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWH-QKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCT-NGVWSCTKNDCSNVTFCPPGKEWKEC--------GHCDQTCEN-QDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVME-NENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENC-AKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKC-RPDPKCITSTTSYCIGSKLTKCENGVCAR---ICNGIPECSDGSDEANCXXXXXXXXXXXXXQPHCIYEGRIM----QIGEVIKLESCL----SVTCTDRRIVETRQNCD 4549
             +  + + + +    C+   G +  TFDG      L     L+   +    ++ +    S +CP          V     ++I+    SV                +  +  +  GD+  + G   + +  D   ++ I           GLCG ++G      +F    G        F   WK P  +P  +D          L  G   DL        A +MC  +  G   QC    V P  Y   C    C    AG          C+  +  +  C      ++WR      R CP  + YS+C SSC  +C  +   E  +C   C +GC CP   FW+G  CVP   CPC  +       Y  G + K+ C  C C + G ++CA+   C   C + GD HY TFD R  +  G+  C Y++V  + S+ G   L + +++  C   +   C  +LS+  G+T     IQL  +  +LV+     LP    +   ++    A  T L+  + G  +LW   +    ITL   +  QVQGLCG +    +DD    +G++ T+    A  +  + + +  L       C+   ++  F +  C  L    F  CH  VD  PF  +C   +C C      +C C  +++Y R C + G+ L+WR+ +LC   CP G  Y EC  +C   C           C+ GC C   +++D    QCV  S C C      Y   +T    C+ C C   G+W+CT + C         ++W  C        G C  TC++ +       G   GC CP G +L +K CV    CPC  + + Y   + I     +C + C C   +W C   Q+C G C++ G  HY TFDG  F F   C Y++V    G+    F +  +N+ CG  G +CTK++     + VV ++RG    V   +   PK      +S       L++ T   + L WD G  + + L P +  +V GLCGNFD + +ND +S+ G  E        SW+    CP   D+P  C  N  R  WA   C  +    FA C   V  + YY+ C+ D C CD GGDCECLC+A++ +   C ++     WRS ELCP+ C   + ++ C + CP  C   + ++ +  +C    CVEGC CP   +   G+  C+K   C C+   S   + PG +  ++C  C C  + + C R    C         G  L + ENG C     +C+   +C DGSDE  C ++       +    HC+    I       G+    + CL    S+ C D R +     C+
Sbjct:  180 AVGQLWSQRQRPSATCATWSGFHYQTFDGHHYHF-LGQCTYLLAGAMDS--TWAVHLRPSVHCPQHRHCWLVQVVMGPEEVLIQDGEVSVK----GQPVPVGEPQLLHGMSLQWQGDWLVLSGGLGVVVRLDRSSSISISVDHEFWGRTQGLCGLYNGRPE--DDFVEPGGGLATLAATFGNSWKLPGSEPGCLDAVEVAWGCESLLGGTLTDLEAVKLQAQAQDMCHQLLEGPFWQCHGQ-VQPDEYHETCLFAYCVGATAGNGPEGQLEAVCATFANYAQACARQHIYVHWRKPGFCERVCPGGQLYSDCVSSCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGALCVPAAHCPCYHRRQR----YAPGDTVKQQCNPCVC-QDGRWHCAQAL-CPAECAVGGDGHYFTFDGRSFFFRGTPGCHYSLV--QDSVKGQ--LLVVLEHGAC---DTGSCLHALSVFLGNT----HIQLRYSGAVLVDGEDVDLPWIGVEGFNISW---ASSTFLLLHWPGAWVLWGVAEPAAYITLDPRHAYQVQGLCGTFTWKQQDDFLTPAGDIETSVTAFASKFQVSGDGRCPLVDKSPLFCSSYSQHLTFTEAACAILHGHAFQECHGLVDREPFRLRCLEAVCGCAPGR--DCLCPVLSAYTRHCAQEGVLLQWRNETLCPVSCPGGQVYQECAPVCGHHCGEPEDCKELGICVAGCNCPPGLLWDLE-GQCVPPSMCHCQFGGHRYTINTTTVRDCSHCICQERGLWNCTAHHCP--------RQWALCPRELIYVPGACLLTCDSPRANHSCWAGSTDGCVCPPGTVLLDKHCVSPDLCPCRHNGQWYPPNATIQE---DC-NICVCQGQRWHCTG-QRCSGWCQASGAPHYVTFDGLVFTFPGACEYLLVREAGGR----FSVSVQNLPCGASGLTCTKALVVRLDSTVVHMLRGQAVTVNGVSIRLPKVYTGPGLSLHHAGLFLLLTTRLGLTLLWDGGTRVLVQLSPHFHGRVAGLCGNFDSDASNDLRSRQGVLEPTAELTAHSWRLNPLCPEPGDLPHPCTVNAHRANWARARCEVILQPIFAPCHTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIATYADECARHRHHVRWRSQELCPLQCEGGQVYEPCGSTCPPTCH--DHHSELRWHCQVITCVEGCFCPEGTLLHGGA--CMKLAACPCEWQGS--FFPPGTVLQKDCGNCTCQGSQWHCDRGGAPCEDMEPGCAEGETLCR-ENGHCVPLEWLCDNQDDCGDGSDEEGCATSVCGEGQMSCQSGHCLPLSLICDGQDDCGDGTDEQGCLCPHGSLACADGRCLPPALLCN 1475          

HSP 2 Score: 83.9593 bits (206), Expect = 2.325e-15
Identity = 98/425 (23.06%), Postives = 165/425 (38.82%), Query Frame = 2
Query:  542 CVEPNVCQCPENFRGRNCETFFREPNTSNLKISDVINTKYKDYQ--------LCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFN------SSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITD--ENCKSF-CTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAK 1762
            CV P++C C  N +       +  PN +  +  ++   + + +          C   G  +  TFDG+    P     +LV +   R   + +         S   C     V  D++++     ++VT  G+S            S+ H   G F  +     L +L+DG   V +         V GLCG FD  S  S++ ++  G  +E   E   +    +P+ P          CT +N      A   C+ +     + C T +P   Y   C  + C C   G    +C+ IA       + +C  +   + WRSQ   P +C   + Y  CGS+C   C D  ++   +C+   C  GCFCP+    +G  C+    CPC  +       +  G   ++DC  C C +G  ++C +
Sbjct:  971 CVSPDLCPCRHNGQ-------WYPPNATIQEDCNICVCQGQRWHCTGQRCSGWCQASGAPHYVTFDGLVFTFPGACEYLLVREAGGR---FSVSVQNLPCGASGLTCTKALVVRLDSTVVHMLRGQAVTVNGVSIRLPKVYTGPGLSLHHA--GLFLLLTTRLGLTLLWDGGTRVLVQLSPHFHGRVAGLCGNFD--SDASNDLRSRQG-VLEPTAELTAHSWRLNPLCPEPGDLP--HPCT-VNAHRANWARARCEVILQPIFAPCHTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIA-----TYADECARHRHHVRWRSQELCPLQCEGGQVYEPCGSTCPPTCHDHHSELRWHCQVITCVEGCFCPEGTLLHGGACMKLAACPCEWQGS----FFPPGTVLQKDCGNCTC-QGSQWHCDR 1367          

HSP 3 Score: 55.4546 bits (132), Expect = 1.028e-6
Identity = 38/124 (30.65%), Postives = 53/124 (42.74%), Query Frame = 2
Query: 2594 CDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTE---CIDGCQCKSNMVYDTAVNQCVNISQCQCS-HENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQ 2953
            C+  CP GME + C N C  SC  L +     E   C  GC+C    +       CV +  C+C+  +   +  GS  ++ CN+C+C  G  SCT   CS    C     W     C  +C  Q
Sbjct: 4039 CEEGCPAGMEMVSCANHCPYSCSDLQEGGMCQEDQACQLGCRCSEGFLEQD--GGCVPVGHCECTDAQGRSWAPGSQHQDACNNCSCQAGQLSCTAQLCSPPAHC-AWSHWSAWSSCSHSCGPQ 4159          
BLAST of Hemocytin vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 451.825 bits (1161), Expect = 5.547e-129
Identity = 367/1353 (27.12%), Postives = 565/1353 (41.76%), Query Frame = 2
Query:  632 KISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTK------DFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNP--DP--IDPNTYYTTGRDLCTGLNKDLVTT-----ANNMCQDVFGGDLSQCTILPVIP--YQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDE--NCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGS--CFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWH-QKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCT-NGVWSCTKNDCSNVTFCPPGKEWKEC--------GHCDQTCEN-QDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVME-NENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENC-AKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKC-RPDPKCITSTTSYCIGSKLTKCENGVCAR---ICNGIPECSDGSDEANCXXXXXXXXXXXXXQPHCIYEGRIM----QIGEVIKLESCL----SVTCTDRRIVETRQNCD 4549
             +  + + + +    C+   G +  TFDG      L     L+   +    ++ +    S +CP          V     ++I+    SV                +  +  +  GD+  + G   + +  D   ++ I           GLCG ++G      +F    G        F   WK P  +P  +D          L  G   DL        A +MC  +  G   QC    V P  Y   C    C    AG          C+  +  +  C      ++WR      R CP  + YS+C SSC  +C  +   E  +C   C +GC CP   FW+G  CVP   CPC  +       Y  G + K+ C  C C + G ++CA+   C   C + GD HY TFD R  +  G+  C Y++V  + S+ G   L + +++  C   +   C  +LS+  G+T     IQL  +  +LV+     LP    +   ++    A  T L+  + G  +LW   +    ITL   +  QVQGLCG +    +DD    +G++ T+    A  +  + + +  L       C+   ++  F +  C  L    F  CH  VD  PF  +C   +C C      +C C  +++Y R C + G+ L+WR+ +LC   CP G  Y EC  +C   C           C+ GC C   +++D    QCV  S C C      Y   +T    C+ C C   G+W+CT + C         ++W  C        G C  TC++ +       G   GC CP G +L +K CV    CPC  + + Y   + I     +C + C C   +W C   Q+C G C++ G  HY TFDG  F F   C Y++V    G+    F +  +N+ CG  G +CTK++     + VV ++RG    V   +   PK      +S       L++ T   + L WD G  + + L P +  +V GLCGNFD + +ND +S+ G  E        SW+    CP   D+P  C  N  R  WA   C  +    FA C   V  + YY+ C+ D C CD GGDCECLC+A++ +   C ++     WRS ELCP+ C   + ++ C + CP  C   + ++ +  +C    CVEGC CP   +   G+  C+K   C C+   S   + PG +  ++C  C C  + + C R    C         G  L + ENG C     +C+   +C DGSDE  C ++       +    HC+    I       G+    + CL    S+ C D R +     C+
Sbjct:  180 AVGQLWSQRQRPSATCATWSGFHYQTFDGHHYHF-LGQCTYLLAGAMDS--TWAVHLRPSVHCPQHRHCWLVQVVMGPEEVLIQDGEVSVK----GQPVPVGEPQLLHGMSLQWQGDWLVLSGGLGVVVRLDRSSSISISVDHEFWGRTQGLCGLYNGRPE--DDFVEPGGGLATLAATFGNSWKLPGSEPGCLDAVEVAWGCESLLGGTLTDLEAVKLQAQAQDMCHQLLEGPFWQCHGQ-VQPDEYHETCLFAYCVGATAGNGPEGQLEAVCATFANYAQACARQHIYVHWRKPGFCERVCPGGQLYSDCVSSCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGALCVPAAHCPCYHRRQR----YAPGDTVKQQCNPCVC-QDGRWHCAQAL-CPAECAVGGDGHYFTFDGRSFFFRGTPGCHYSLV--QDSVKGQ--LLVVLEHGAC---DTGSCLHALSVFLGNT----HIQLRYSGAVLVDGEDVDLPWIGVEGFNISW---ASSTFLLLHWPGAWVLWGVAEPAAYITLDPRHAYQVQGLCGTFTWKQQDDFLTPAGDIETSVTAFASKFQVSGDGRCPLVDKSPLFCSSYSQHLTFTEAACAILHGHAFQECHGLVDREPFRLRCLEAVCGCAPGR--DCLCPVLSAYTRHCAQEGVLLQWRNETLCPVSCPGGQVYQECAPVCGHHCGEPEDCKELGICVAGCNCPPGLLWDLE-GQCVPPSMCHCQFGGHRYTINTTTVRDCSHCICQERGLWNCTAHHCP--------RQWALCPRELIYVPGACLLTCDSPRANHSCWAGSTDGCVCPPGTVLLDKHCVSPDLCPCRHNGQWYPPNATIQE---DC-NICVCQGQRWHCTG-QRCSGWCQASGAPHYVTFDGLVFTFPGACEYLLVREAGGR----FSVSVQNLPCGASGLTCTKALVVRLDSTVVHMLRGQAVTVNGVSIRLPKVYTGPGLSLHHAGLFLLLTTRLGLTLLWDGGTRVLVQLSPHFHGRVAGLCGNFDSDASNDLRSRQGVLEPTAELTAHSWRLNPLCPEPGDLPHPCTVNAHRANWARARCEVILQPIFAPCHTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIATYADECARHRHHVRWRSQELCPLQCEGGQVYEPCGSTCPPTCH--DHHSELRWHCQVITCVEGCFCPEGTLLHGGA--CMKLAACPCEWQGS--FFPPGTVLQKDCGNCTCQGSQWHCDRGGAPCEDMEPGCAEGETLCR-ENGHCVPLEWLCDNQDDCGDGSDEEGCATSVCGEGQMSCQSGHCLPLSLICDGQDDCGDGTDEQGCLCPHGSLACADGRCLPPALLCN 1475          

HSP 2 Score: 83.5741 bits (205), Expect = 2.704e-15
Identity = 98/425 (23.06%), Postives = 165/425 (38.82%), Query Frame = 2
Query:  542 CVEPNVCQCPENFRGRNCETFFREPNTSNLKISDVINTKYKDYQ--------LCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFN------SSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITD--ENCKSF-CTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAK 1762
            CV P++C C  N +       +  PN +  +  ++   + + +          C   G  +  TFDG+    P     +LV +   R   + +         S   C     V  D++++     ++VT  G+S            S+ H   G F  +     L +L+DG   V +         V GLCG FD  S  S++ ++  G  +E   E   +    +P+ P          CT +N      A   C+ +     + C T +P   Y   C  + C C   G    +C+ IA       + +C  +   + WRSQ   P +C   + Y  CGS+C   C D  ++   +C+   C  GCFCP+    +G  C+    CPC  +       +  G   ++DC  C C +G  ++C +
Sbjct:  971 CVSPDLCPCRHNGQ-------WYPPNATIQEDCNICVCQGQRWHCTGQRCSGWCQASGAPHYVTFDGLVFTFPGACEYLLVREAGGR---FSVSVQNLPCGASGLTCTKALVVRLDSTVVHMLRGQAVTVNGVSIRLPKVYTGPGLSLHHA--GLFLLLTTRLGLTLLWDGGTRVLVQLSPHFHGRVAGLCGNFD--SDASNDLRSRQG-VLEPTAELTAHSWRLNPLCPEPGDLP--HPCT-VNAHRANWARARCEVILQPIFAPCHTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIA-----TYADECARHRHHVRWRSQELCPLQCEGGQVYEPCGSTCPPTCHDHHSELRWHCQVITCVEGCFCPEGTLLHGGACMKLAACPCEWQG----SFFPPGTVLQKDCGNCTC-QGSQWHCDR 1367          

HSP 3 Score: 55.4546 bits (132), Expect = 1.028e-6
Identity = 38/124 (30.65%), Postives = 53/124 (42.74%), Query Frame = 2
Query: 2594 CDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTE---CIDGCQCKSNMVYDTAVNQCVNISQCQCS-HENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQ 2953
            C+  CP GME + C N C  SC  L +     E   C  GC+C    +       CV +  C+C+  +   +  GS  ++ CN+C+C  G  SCT   CS    C     W     C  +C  Q
Sbjct: 4048 CEEGCPAGMEMVSCANHCPYSCSDLQEGGMCQEDQACQLGCRCSEGFLEQD--GGCVPVGHCECTDAQGRSWAPGSQHQDACNNCSCQAGQLSCTAQLCSPPAHC-AWSHWSAWSSCSHSCGPQ 4168          
BLAST of Hemocytin vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 449.129 bits (1154), Expect = 2.941e-128
Identity = 346/1157 (29.90%), Postives = 526/1157 (45.46%), Query Frame = 2
Query:  974 IKGIGELEILYDGKRNVFIFAPLTMKKS--VCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDL-SQCTILPVIP-YQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFW---NGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQ----------GLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDPK--CPNGMEYMECKNLCSVSCFSLTQTNCSTEC----IDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKN--------------DCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLL-SNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCG---KGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQL----IRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCP---PEKTFKTCINDCPKKCFKSNLNNT--------VLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLP--NSDKKYNPGEIFT--ENCLICVCNENNFKC 4252
            +K +  L +L+    +  +   L  K +   CGLCG F+G S  S+EF + N        EF    K   P +        +D      K+  +  + +C+ +  G+L S C  L  I  Y   CR ++C C +   +  +C  +A       S QC    G+  +WR      + CP N ++ ECGS C   C +    + C+  C AGCFCP+       N   CVP  QC C+  NG    +Y  G ++  DC  C CS GG ++C  I  C+GTC + G  H +TFD R   V G C Y  V +KP    +    + V+   C  +    C K+++L  G     T I +  T  + VN+I  +LP+             A+ T    S   I    +   Q+EI L    Q  V+          GLCGN+N    DD    SG +         ++ T      +   +   C+ S E EK+A+ +C  L     PF+ CH +V+P+ F   C +D C C   + ++C C +++SY RAC   G+ L  WR      P   CP  M Y    + C  +C +L + + +       +DGC C      D  + +CV  + C C ++ +  P+G + ++    C CT G  +C                 DC N T   PG        C ++C   D  C    C  GC CP+G +   N  CV    CPC+ ++ +Y     I  G  NC    TC    W C  ++ C+ +C  +GD HY TFDG+ + F   C Y ++  +CG        F+++TENI CG  GT+C+KSI  +  N  ++L    +  V+  V +   Y             + + L++ TD  ++L WDK  SI + L P+++ +VCGLCGNFD N  NDF +++ +  +++L F +SWK   +CP      D C +N  R++WA K C  + +  F+ C   V+   YY+ C++D C+CD GGDCEC CT ++A+  AC + G+  SWR+ ++CP+ C    PE   +     C   C ++  N T         LE C   C      PT  I  EG+ +CV  + C    P   + K Y PG      +NC  C+C E+  +C
Sbjct:  176 LKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNG-SPKSNEFLSNNVRLTP--LEFGNLQKMDGPTE------QCQDPLPVPQKN-CSARSGICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDCICHTLA-----EYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLY-NG---TLYAPGTNYSTDCTKCTCS-GGQWSCQDIP-CAGTCSVMGGSHMSTFDGRQYTVHGDCTY--VLSKPC--DSNAFTVLVELRKCGLTESETCLKTVTLNLGG--GQTEIMVKATGEVFVNQIYTQLPV-----------STANATFFRPSTFFIVGETNLGLQLEIQLSPIMQTSVRLKPGLRGLTCGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKTQAACPNVKNIFQDPCSLSVENEKYAQHWCSLLTNASGPFSQCHATVNPSTFFSNCMYDTCNC--EKSEDCMCAALSSYVRACAAKGVLLSDWRDGICTKPTITCPKSMTYQYHISTCQPTCRALNEKDVTCHVSFIPVDGCTCPKGTFLDD-LGKCVQATSCPCYYKGSTVPNGESVQDSGAICTCTQGALTCIGGPAPTPVCDAPMIYFDCHNAT---PGDTG---AGCQKSCHTLDMTCYSSECVPGCVCPNGLVADGNGGCVVTEDCPCVHNEATYRPGETIQVGCNNC----TCENRMWQCT-DKPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPCGTTGTTCSKSIKIFLGNYELKLSDSKMEVVQKDVGQEPPY---------FVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDPCTANPYRKSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRGLEGCYPKCP-----PTAPIFDEGTMQCV--SNCTVTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRC 1264          

HSP 2 Score: 137.502 bits (345), Expect = 1.394e-31
Identity = 125/480 (26.04%), Postives = 212/480 (44.17%), Query Frame = 2
Query: 1496 NKEYSECGSSCSQNCEDLITDENC-KSFCTAGCFCPKDRFWNGTY-CVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQ--VLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKC----PNGM---EYMECKNLCSVSCFSLT-QTNCSTECIDGCQCK---SNMVYDTAVNQCVNISQCQCS-----HENAYYPSGSTRKEK-CNDCNCTNGVWSCTKN 2872
            N    + G+ C ++C  L  D  C  S C  GC CP     +G   CV    CPC+         Y  G + +  C  C C +  ++ C   + C  TC + GD HY TFD +     G C YT++       G+     ++  +N  C  +    C+KS+ +  G+ +    ++L  +K  +V K   + P          + ++  + +++E+  G+ +LW +KT I + L   ++ +V GLCGN++ N+ +D T  S  + ++  E   SW  +     + +      A  Y  + +A++ C  +  E F++CH  V+P  + + C +D C C       C C ++A+Y +AC + G+ + WR+  +C   C    P G     Y  C   C  +C + T Q       ++GC  K   +  ++D    QCV  S C  +     +   Y P  S   +K C+ C CT     CT N
Sbjct:  812 NATPGDTGAGCQKSCHTL--DMTCYSSECVPGCVCPNGLVADGNGGCVVTEDCPCVHNE----ATYRPGETIQVGCNNCTC-ENRMWQCTD-KPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPC-GTTGTTCSKSIKIFLGNYE----LKLSDSKMEVVQKDVGQEPPYF-------VHQMG-NYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDPCTANPYR-KSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRGLEGCYPKCPPTAPIFDEGTMQCV--SNCTVTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRCTHN 1267          

HSP 3 Score: 135.961 bits (341), Expect = 3.826e-31
Identity = 112/423 (26.48%), Postives = 175/423 (41.37%), Query Frame = 2
Query: 1784 CVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTK-----------NILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTN---DNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLY-EPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMK-NGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTN-CSTECIDGCQCKSNMVYDTAVNQ--CVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCF 2995
            C   G+ HY TFD +  Y  G C Y   A                  HC    DAY   ++ L+     N+T +  VT K           ++LVN  P +LP   +      + E+++  + + +  G+  +W++   + + L   Y ++  GLCG++NG+ + +   S+    T     N   +   T +C+  L +      A+S          C+ +L  E F+ C   VD + +++ C  D+CLC   +  +C C ++A Y R C    G    WR  +LC   CP  M++ EC + C  +C +   +  C   CI GC C   MV D  +NQ  CV +SQC C +    Y  G+     C  C C+ G WSC    C+       G           T      + L K C S  F
Sbjct:   80 CSTWGNFHYKTFDGQVFYFPGLCNYVFSA------------------HC---GDAYEDFNIQLRRVQESNTTTLSRVTMKLDGLVVELTKSSVLVNNHPVQLPFSQSG----VLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSNNVRLTPLEFGNLQKMDGPTEQCQDPLPVPQKNCSARS--------GICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDD-INQMGCVPVSQCACLYNGTLYAPGTNYSTDCTKCTCSGGQWSCQDIPCAGTCSVMGGSHMSTFDGRQYTVHGDCTYVLSKPCDSNAF 468          

HSP 4 Score: 108.997 bits (271), Expect = 5.843e-23
Identity = 97/395 (24.56%), Postives = 162/395 (41.01%), Query Frame = 2
Query: 3149 GCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECG-NKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRV-------KGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQ-YQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKD----VPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRS--NELCPVMCPPEKTFKTCINDCPKKCFKSN-LNNTVLENCAKNCVEGCSCP-TEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCR----PDPKC 4270
            GC Q  +C   C  WGD HY TFDG Y+ F+  C+YV+V        G+F+++ +N  C      SC +SI   Y    V L R     VM N+    ++V        G ++ R  +   +   +  + + +  GL   + +P   + N   G CG    +  ++ +   G+  ++       WK   N P+ +        +             +C  + +  F  C  V+    +YQ CL D C      D E +C+ L  + S C   G+   WRS  N  C   CP  + ++ C    P  C++ + ++ ++    A    EGC CP +  + +   + CV   + +C  P  +    PG   + +C  C+C E    C+    P P C
Sbjct: 2734 GCCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVFGYFRVLIDNYYCDVGDSVSCPQSIIVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNGIVTSRVGIKMYVTIQEIGVRVMF-SGLIFSVEVPFNLFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKVP-NQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYC---HMLDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDSISPSLTLQEAGPKTEGCFCPDSTTLFSTNDSICVPSCQ-WCLGPRGE-PVEPGHTISIDCQDCICKEATLTCQKKACPQPTC 3120          

HSP 5 Score: 108.612 bits (270), Expect = 6.914e-23
Identity = 94/366 (25.68%), Postives = 158/366 (43.17%), Query Frame = 2
Query: 3182 CKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQ--LIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNL-NNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKY-GIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAE-GSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDP 4264
            C +WG+ HYKTFDG+ F F   C+YV   + CG     F +    ++  N  T+    +       VV+L +     V+ N N+P      +      +S   L +     ++  W++  S+ + L  +Y N+ CGLCG+F+ +  +N+F S   N     L F +  K        +D   + + N   ++   +M   +K   F+ C  +VD   Y + C  D C C+     +C+C  L+ +   C    G    WR   LC   CP     + C + C   C  SN  ++ +  C  +C+ GC CP   +  +     CV  ++C C    +   Y PG  ++ +C  C C+   + C+  P
Sbjct:   80 CSTWGNFHYKTFDGQVFYFPGLCNYVF-SAHCGDAYEDFNIQLRRVQESN--TTTLSRVTMKLDGLVVELTKS---SVLVN-NHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSN--NVRLTPLEFGNLQKMDGPTEQCQDPLPVPQKNCSARSGICEM--ILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTC--SNPQHSQV--CEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLY--NGTLYAPGTNYSTDCTKCTCSGGQWSCQDIP 428          

HSP 6 Score: 73.1738 bits (178), Expect = 4.425e-12
Identity = 88/409 (21.52%), Postives = 151/409 (36.92%), Query Frame = 2
Query: 1754 CAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQ-----LVTTKNILVNKIPNR-------LPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKT-QIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKS--TLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSS--LCDPKCPNGMEYMECKNLCSVSCF-------SLTQTNCSTECIDGCQCK-SNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPG 2905
            C +   C   C   GDPHY TFD  +     +C Y +V     + G    ++ + N +C   +   C +S+ +++   D     +     ++T + I  NK+ +        +  ++   + +TIQE+           G+R+++      +E+     + +  +G CG    + +D+     G + ++ +E+++ W      S      +   V  +           C+ +L   F  CH  + P  F Q C  D C     E     C  +  Y   C   G+ + WRS +   C   CP+   Y  C       C+       SLT      +  +GC C  S  ++ T  + CV   Q            G T    C DC C     +C K  C   T   PG
Sbjct: 2735 CCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIVPVFG--YFRVLIDNYYCDVGDSVSCPQSIIVEY-HQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNGIVTSRVGIKMYVTIQEI-----------GVRVMFSGLIFSVEVPF-NLFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKVPNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYCHMLDLE---VVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDSISPSLTLQEAGPK-TEGCFCPDSTTLFSTNDSICVPSCQWCLGPRGEPVEPGHTISIDCQDCICKEATLTCQKKACPQPTCPEPG 3124          
BLAST of Hemocytin vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 441.81 bits (1135), Expect = 5.329e-126
Identity = 343/1157 (29.65%), Postives = 523/1157 (45.20%), Query Frame = 2
Query:  974 IKGIGELEILYDGKRNVFIFAPLTMKKS--VCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDL-SQCTILPVIP-YQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFW---NGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQ----------GLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDPK--CPNGMEYMECKNLCSVSCFSLTQTNCSTEC----IDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKN--------------DCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLL-SNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCG---KGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQL----IRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCP---PEKTFKTCINDCPKKCFKSNLNNT--------VLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLP--NSDKKYNPGEIFT--ENCLICVCNENNFKC 4252
            +K +  L +L+    +  +   L  K +   CGLCG F+G S  S+EF + N        EF    K   P +        +D      K+  +  + +C+ +  G+L S C  L  I  Y   CR ++C C +   +  +C  +A       S QC    G+  +WR      + CP N ++ ECGS C   C +    + C+  C AGCFCP+       N   CVP  QC C+  NG    +Y  G ++  DC       GG ++C  I  C+GTC + G  H +TFD R   V G C Y  V +KP    +    + V+   C  +    C K+++L  G     T I +  T  + VN+I  +LP+             A+ T    S   I    +   Q+EI L    Q  V+          GLCGN+N    DD    SG +         ++ T      +   +   C+ S E EK+A+ +C  L     PF+ CH +V+P+ F   C +D C C   + ++C C +++SY RAC   G+ L  WR      P   CP  M Y    + C  +C +L + + +       +DGC C      D  + +CV  + C C ++ +  P+G + ++    C CT G  +C                 DC N T   PG        C ++C   D  C    C  GC CP+G +   N  CV    CPC+ ++ +Y     I  G  NC    TC    W C  ++ C+ +C  +GD HY TFDG+ + F   C Y ++  +CG        F+++TENI CG  GT+C+KSI  +  N  ++L    +  V+  V +   Y             + + L++ TD  ++L WDK  SI + L P+++ +VCGLCGNFD N  NDF +++ +  +++L F +SWK   +CP      D C +N  R++WA K C  + +  F+ C   V+   YY+ C++D C+CD GGDCEC CT ++A+  AC + G+  SWR+ ++CP+ C    PE   +     C   C ++  N T         LE C   C      PT  I  EG+ +CV  + C    P   + K Y PG      +NC  C+C E+  +C
Sbjct:  176 LKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNG-SPKSNEFLSNNVRLTP--LEFGNLQKMDGPTE------QCQDPLPVPQKN-CSARSGICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDCICHTLA-----EYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLY-NG---TLYAPGTNYSTDCT--NTCSGGQWSCQDIP-CAGTCSVMGGSHMSTFDGRQYTVHGDCTY--VLSKPC--DSNAFTVLVELRKCGLTESETCLKTVTLNLGG--GQTEIMVKATGEVFVNQIYTQLPV-----------STANATFFRPSTFFIVGETNLGLQLEIQLSPIMQTSVRLKPGLRGLTCGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKTQAACPNVKNIFQDPCSLSVENEKYAQHWCSLLTNASGPFSQCHATVNPSTFFSNCMYDTCNC--EKSEDCMCAALSSYVRACAAKGVLLSDWRDGICTKPTITCPKSMTYQYHISTCQPTCRALNEKDVTCHVSFIPVDGCTCPKGTFLDD-LGKCVQATSCPCYYKGSTVPNGESVQDSGAICTCTQGALTCIGGPAPTPVCDAPMIYFDCHNAT---PGDTG---AGCQKSCHTLDMTCYSSECVPGCVCPNGLVADGNGGCVVTEDCPCVHNEATYRPGETIQVGCNNC----TCENRMWQCT-DKPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPCGTTGTTCSKSIKIFLGNYELKLSDSKMEVVQKDVGQEPPY---------FVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDPCTANPYRKSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRGLEGCYPKCP-----PTAPIFDEGTMQCV--SNCTVTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRC 1263          

HSP 2 Score: 138.272 bits (347), Expect = 7.486e-32
Identity = 125/480 (26.04%), Postives = 211/480 (43.96%), Query Frame = 2
Query: 1496 NKEYSECGSSCSQNCEDLITDENC-KSFCTAGCFCPKDRFWNGTY-CVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQ--VLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKC----PNGM---EYMECKNLCSVSCFSLT-QTNCSTECIDGCQCK---SNMVYDTAVNQCVNISQCQCSHE-----NAYYPSGSTRKEK-CNDCNCTNGVWSCTKN 2872
            N    + G+ C ++C  L  D  C  S C  GC CP     +G   CV    CPC+         Y  G + +  C  C C +  ++ C   + C  TC + GD HY TFD +     G C YT++       G+     ++  +N  C  +    C+KS+ +  G+ +    ++L  +K  +V K   + P          + ++  + +++E+  G+ +LW +KT I + L   ++ +V GLCGN++ N+ +D T  S  + ++  E   SW  +     + +      A  Y  + +A++ C  +  E F++CH  V+P  + + C +D C C       C C ++A+Y +AC + G+ + WR+  +C   C    P G     Y  C   C  +C + T Q       ++GC  K   +  ++D    QCV  S C  +         Y P  S   +K C+ C CT     CT N
Sbjct:  811 NATPGDTGAGCQKSCHTL--DMTCYSSECVPGCVCPNGLVADGNGGCVVTEDCPCVHNEA----TYRPGETIQVGCNNCTC-ENRMWQCTD-KPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPC-GTTGTTCSKSIKIFLGNYE----LKLSDSKMEVVQKDVGQEPPYF-------VHQMG-NYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDPCTANPYR-KSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRGLEGCYPKCPPTAPIFDEGTMQCV--SNCTVTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRCTHN 1266          

HSP 3 Score: 130.183 bits (326), Expect = 2.149e-29
Identity = 111/423 (26.24%), Postives = 175/423 (41.37%), Query Frame = 2
Query: 1784 CVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTK-----------NILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTN---DNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLY-EPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMK-NGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTN-CSTECIDGCQCKSNMVYDTAVNQ--CVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCF 2995
            C   G+ HY TFD +  Y  G C Y   A                  HC    DAY   ++ L+     N+T +  VT K           ++LVN  P +LP   +      + E+++  + + +  G+  +W++   + + L   Y ++  GLCG++NG+ + +   S+    T     N   +   T +C+  L +      A+S          C+ +L  E F+ C   VD + +++ C  D+CLC   +  +C C ++A Y R C    G    WR  +LC   CP  M++ EC + C  +C +   +  C   CI GC C   MV D  +NQ  CV +SQC C +    Y  G+     C +  C+ G WSC    C+       G           T      + L K C S  F
Sbjct:   80 CSTWGNFHYKTFDGQVFYFPGLCNYVFSA------------------HC---GDAYEDFNIQLRRVQESNTTTLSRVTMKLDGLVVELTKSSVLVNNHPVQLPFSQSG----VLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSNNVRLTPLEFGNLQKMDGPTEQCQDPLPVPQKNCSARS--------GICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDD-INQMGCVPVSQCACLYNGTLYAPGTNYSTDCTN-TCSGGQWSCQDIPCAGTCSVMGGSHMSTFDGRQYTVHGDCTYVLSKPCDSNAF 467          

HSP 4 Score: 109.383 bits (272), Expect = 3.557e-23
Identity = 97/395 (24.56%), Postives = 162/395 (41.01%), Query Frame = 2
Query: 3149 GCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECG-NKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRV-------KGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQ-YQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKD----VPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRS--NELCPVMCPPEKTFKTCINDCPKKCFKSN-LNNTVLENCAKNCVEGCSCP-TEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCR----PDPKC 4270
            GC Q  +C   C  WGD HY TFDG Y+ F+  C+YV+V        G+F+++ +N  C      SC +SI   Y    V L R     VM N+    ++V        G ++ R  +   +   +  + + +  GL   + +P   + N   G CG    +  ++ +   G+  ++       WK   N P+ +        +             +C  + +  F  C  V+    +YQ CL D C      D E +C+ L  + S C   G+   WRS  N  C   CP  + ++ C    P  C++ + ++ ++    A    EGC CP +  + +   + CV   + +C  P  +    PG   + +C  C+C E    C+    P P C
Sbjct: 2030 GCCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVFGYFRVLIDNYYCDVGDSVSCPQSIIVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNGIVTSRVGIKMYVTIQEIGVRVMF-SGLIFSVEVPFNLFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKVP-NQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYC---HMLDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDSISPSLTLQEAGPKTEGCFCPDSTTLFSTNDSICVPSCQ-WCLGPRGE-PVEPGHTISIDCQDCICKEATLTCQKKACPQPTC 2416          

HSP 5 Score: 101.293 bits (251), Expect = 1.153e-20
Identity = 90/350 (25.71%), Postives = 151/350 (43.14%), Query Frame = 2
Query: 3182 CKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQ--LIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNL-NNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKY-GIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAE-GSNKCVKENECFCKLPNSDKKYNPGEIFTENC 4216
            C +WG+ HYKTFDG+ F F   C+YV   + CG     F +    ++  N  T+    +       VV+L +     V+ N N+P      +      +S   L +     ++  W++  S+ + L  +Y N+ CGLCG+F+ +  +N+F S   N     L F +  K        +D   + + N   ++   +M   +K   F+ C  +VD   Y + C  D C C+     +C+C  L+ +   C    G    WR   LC   CP     + C + C   C  SN  ++ +  C  +C+ GC CP   +  +     CV  ++C C    +   Y PG  ++ +C
Sbjct:   80 CSTWGNFHYKTFDGQVFYFPGLCNYVF-SAHCGDAYEDFNIQLRRVQESN--TTTLSRVTMKLDGLVVELTKS---SVLVN-NHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSN--NVRLTPLEFGNLQKMDGPTEQCQDPLPVPQKNCSARSGICEM--ILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTC--SNPQHSQV--CEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLY--NGTLYAPGTNYSTDC 412          

HSP 6 Score: 74.7146 bits (182), Expect = 1.172e-12
Identity = 88/409 (21.52%), Postives = 151/409 (36.92%), Query Frame = 2
Query: 1754 CAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQ-----LVTTKNILVNKIPNR-------LPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKT-QIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKS--TLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSS--LCDPKCPNGMEYMECKNLCSVSCF-------SLTQTNCSTECIDGCQCK-SNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPG 2905
            C +   C   C   GDPHY TFD  +     +C Y +V     + G    ++ + N +C   +   C +S+ +++   D     +     ++T + I  NK+ +        +  ++   + +TIQE+           G+R+++      +E+     + +  +G CG    + +D+     G + ++ +E+++ W      S      +   V  +           C+ +L   F  CH  + P  F Q C  D C     E     C  +  Y   C   G+ + WRS +   C   CP+   Y  C       C+       SLT      +  +GC C  S  ++ T  + CV   Q            G T    C DC C     +C K  C   T   PG
Sbjct: 2031 CCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIVPVFG--YFRVLIDNYYCDVGDSVSCPQSIIVEY-HQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNGIVTSRVGIKMYVTIQEI-----------GVRVMFSGLIFSVEVPF-NLFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKVPNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYCHMLDLE---VVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDSISPSLTLQEAGPK-TEGCFCPDSTTLFSTNDSICVPSCQWCLGPRGEPVEPGHTISIDCQDCICKEATLTCQKKACPQPTCPEPG 2420          
BLAST of Hemocytin vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 441.81 bits (1135), Expect = 5.329e-126
Identity = 343/1157 (29.65%), Postives = 523/1157 (45.20%), Query Frame = 2
Query:  974 IKGIGELEILYDGKRNVFIFAPLTMKKS--VCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDL-SQCTILPVIP-YQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFW---NGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQ----------GLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDPK--CPNGMEYMECKNLCSVSCFSLTQTNCSTEC----IDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKN--------------DCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLL-SNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCG---KGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQL----IRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCP---PEKTFKTCINDCPKKCFKSNLNNT--------VLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLP--NSDKKYNPGEIFT--ENCLICVCNENNFKC 4252
            +K +  L +L+    +  +   L  K +   CGLCG F+G S  S+EF + N        EF    K   P +        +D      K+  +  + +C+ +  G+L S C  L  I  Y   CR ++C C +   +  +C  +A       S QC    G+  +WR      + CP N ++ ECGS C   C +    + C+  C AGCFCP+       N   CVP  QC C+  NG    +Y  G ++  DC       GG ++C  I  C+GTC + G  H +TFD R   V G C Y  V +KP    +    + V+   C  +    C K+++L  G     T I +  T  + VN+I  +LP+             A+ T    S   I    +   Q+EI L    Q  V+          GLCGN+N    DD    SG +         ++ T      +   +   C+ S E EK+A+ +C  L     PF+ CH +V+P+ F   C +D C C   + ++C C +++SY RAC   G+ L  WR      P   CP  M Y    + C  +C +L + + +       +DGC C      D  + +CV  + C C ++ +  P+G + ++    C CT G  +C                 DC N T   PG        C ++C   D  C    C  GC CP+G +   N  CV    CPC+ ++ +Y     I  G  NC    TC    W C  ++ C+ +C  +GD HY TFDG+ + F   C Y ++  +CG        F+++TENI CG  GT+C+KSI  +  N  ++L    +  V+  V +   Y             + + L++ TD  ++L WDK  SI + L P+++ +VCGLCGNFD N  NDF +++ +  +++L F +SWK   +CP      D C +N  R++WA K C  + +  F+ C   V+   YY+ C++D C+CD GGDCEC CT ++A+  AC + G+  SWR+ ++CP+ C    PE   +     C   C ++  N T         LE C   C      PT  I  EG+ +CV  + C    P   + K Y PG      +NC  C+C E+  +C
Sbjct:  176 LKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNG-SPKSNEFLSNNVRLTP--LEFGNLQKMDGPTE------QCQDPLPVPQKN-CSARSGICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDCICHTLA-----EYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLY-NG---TLYAPGTNYSTDCT--NTCSGGQWSCQDIP-CAGTCSVMGGSHMSTFDGRQYTVHGDCTY--VLSKPC--DSNAFTVLVELRKCGLTESETCLKTVTLNLGG--GQTEIMVKATGEVFVNQIYTQLPV-----------STANATFFRPSTFFIVGETNLGLQLEIQLSPIMQTSVRLKPGLRGLTCGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKTQAACPNVKNIFQDPCSLSVENEKYAQHWCSLLTNASGPFSQCHATVNPSTFFSNCMYDTCNC--EKSEDCMCAALSSYVRACAAKGVLLSDWRDGICTKPTITCPKSMTYQYHISTCQPTCRALNEKDVTCHVSFIPVDGCTCPKGTFLDD-LGKCVQATSCPCYYKGSTVPNGESVQDSGAICTCTQGALTCIGGPAPTPVCDAPMIYFDCHNAT---PGDTG---AGCQKSCHTLDMTCYSSECVPGCVCPNGLVADGNGGCVVTEDCPCVHNEATYRPGETIQVGCNNC----TCENRMWQCT-DKPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPCGTTGTTCSKSIKIFLGNYELKLSDSKMEVVQKDVGQEPPY---------FVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDPCTANPYRKSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRGLEGCYPKCP-----PTAPIFDEGTMQCV--SNCTVTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRC 1263          

HSP 2 Score: 138.272 bits (347), Expect = 7.486e-32
Identity = 125/480 (26.04%), Postives = 211/480 (43.96%), Query Frame = 2
Query: 1496 NKEYSECGSSCSQNCEDLITDENC-KSFCTAGCFCPKDRFWNGTY-CVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQ--VLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKC----PNGM---EYMECKNLCSVSCFSLT-QTNCSTECIDGCQCK---SNMVYDTAVNQCVNISQCQCSHE-----NAYYPSGSTRKEK-CNDCNCTNGVWSCTKN 2872
            N    + G+ C ++C  L  D  C  S C  GC CP     +G   CV    CPC+         Y  G + +  C  C C +  ++ C   + C  TC + GD HY TFD +     G C YT++       G+     ++  +N  C  +    C+KS+ +  G+ +    ++L  +K  +V K   + P          + ++  + +++E+  G+ +LW +KT I + L   ++ +V GLCGN++ N+ +D T  S  + ++  E   SW  +     + +      A  Y  + +A++ C  +  E F++CH  V+P  + + C +D C C       C C ++A+Y +AC + G+ + WR+  +C   C    P G     Y  C   C  +C + T Q       ++GC  K   +  ++D    QCV  S C  +         Y P  S   +K C+ C CT     CT N
Sbjct:  811 NATPGDTGAGCQKSCHTL--DMTCYSSECVPGCVCPNGLVADGNGGCVVTEDCPCVHNEA----TYRPGETIQVGCNNCTC-ENRMWQCTD-KPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPC-GTTGTTCSKSIKIFLGNYE----LKLSDSKMEVVQKDVGQEPPYF-------VHQMG-NYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDPCTANPYR-KSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRGLEGCYPKCPPTAPIFDEGTMQCV--SNCTVTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRCTHN 1266          

HSP 3 Score: 130.183 bits (326), Expect = 2.149e-29
Identity = 111/423 (26.24%), Postives = 175/423 (41.37%), Query Frame = 2
Query: 1784 CVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTK-----------NILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTN---DNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLY-EPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMK-NGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTN-CSTECIDGCQCKSNMVYDTAVNQ--CVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCF 2995
            C   G+ HY TFD +  Y  G C Y   A                  HC    DAY   ++ L+     N+T +  VT K           ++LVN  P +LP   +      + E+++  + + +  G+  +W++   + + L   Y ++  GLCG++NG+ + +   S+    T     N   +   T +C+  L +      A+S          C+ +L  E F+ C   VD + +++ C  D+CLC   +  +C C ++A Y R C    G    WR  +LC   CP  M++ EC + C  +C +   +  C   CI GC C   MV D  +NQ  CV +SQC C +    Y  G+     C +  C+ G WSC    C+       G           T      + L K C S  F
Sbjct:   80 CSTWGNFHYKTFDGQVFYFPGLCNYVFSA------------------HC---GDAYEDFNIQLRRVQESNTTTLSRVTMKLDGLVVELTKSSVLVNNHPVQLPFSQSG----VLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSNNVRLTPLEFGNLQKMDGPTEQCQDPLPVPQKNCSARS--------GICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDD-INQMGCVPVSQCACLYNGTLYAPGTNYSTDCTN-TCSGGQWSCQDIPCAGTCSVMGGSHMSTFDGRQYTVHGDCTYVLSKPCDSNAF 467          

HSP 4 Score: 109.383 bits (272), Expect = 3.557e-23
Identity = 97/395 (24.56%), Postives = 162/395 (41.01%), Query Frame = 2
Query: 3149 GCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECG-NKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRV-------KGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQ-YQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKD----VPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRS--NELCPVMCPPEKTFKTCINDCPKKCFKSN-LNNTVLENCAKNCVEGCSCP-TEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCR----PDPKC 4270
            GC Q  +C   C  WGD HY TFDG Y+ F+  C+YV+V        G+F+++ +N  C      SC +SI   Y    V L R     VM N+    ++V        G ++ R  +   +   +  + + +  GL   + +P   + N   G CG    +  ++ +   G+  ++       WK   N P+ +        +             +C  + +  F  C  V+    +YQ CL D C      D E +C+ L  + S C   G+   WRS  N  C   CP  + ++ C    P  C++ + ++ ++    A    EGC CP +  + +   + CV   + +C  P  +    PG   + +C  C+C E    C+    P P C
Sbjct: 2030 GCCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVFGYFRVLIDNYYCDVGDSVSCPQSIIVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNGIVTSRVGIKMYVTIQEIGVRVMF-SGLIFSVEVPFNLFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKVP-NQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYC---HMLDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDSISPSLTLQEAGPKTEGCFCPDSTTLFSTNDSICVPSCQ-WCLGPRGE-PVEPGHTISIDCQDCICKEATLTCQKKACPQPTC 2416          

HSP 5 Score: 101.293 bits (251), Expect = 1.153e-20
Identity = 90/350 (25.71%), Postives = 151/350 (43.14%), Query Frame = 2
Query: 3182 CKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQ--LIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNL-NNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKY-GIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAE-GSNKCVKENECFCKLPNSDKKYNPGEIFTENC 4216
            C +WG+ HYKTFDG+ F F   C+YV   + CG     F +    ++  N  T+    +       VV+L +     V+ N N+P      +      +S   L +     ++  W++  S+ + L  +Y N+ CGLCG+F+ +  +N+F S   N     L F +  K        +D   + + N   ++   +M   +K   F+ C  +VD   Y + C  D C C+     +C+C  L+ +   C    G    WR   LC   CP     + C + C   C  SN  ++ +  C  +C+ GC CP   +  +     CV  ++C C    +   Y PG  ++ +C
Sbjct:   80 CSTWGNFHYKTFDGQVFYFPGLCNYVF-SAHCGDAYEDFNIQLRRVQESN--TTTLSRVTMKLDGLVVELTKS---SVLVN-NHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSN--NVRLTPLEFGNLQKMDGPTEQCQDPLPVPQKNCSARSGICEM--ILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTC--SNPQHSQV--CEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLY--NGTLYAPGTNYSTDC 412          

HSP 6 Score: 74.7146 bits (182), Expect = 1.172e-12
Identity = 88/409 (21.52%), Postives = 151/409 (36.92%), Query Frame = 2
Query: 1754 CAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQ-----LVTTKNILVNKIPNR-------LPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKT-QIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKS--TLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSS--LCDPKCPNGMEYMECKNLCSVSCF-------SLTQTNCSTECIDGCQCK-SNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPG 2905
            C +   C   C   GDPHY TFD  +     +C Y +V     + G    ++ + N +C   +   C +S+ +++   D     +     ++T + I  NK+ +        +  ++   + +TIQE+           G+R+++      +E+     + +  +G CG    + +D+     G + ++ +E+++ W      S      +   V  +           C+ +L   F  CH  + P  F Q C  D C     E     C  +  Y   C   G+ + WRS +   C   CP+   Y  C       C+       SLT      +  +GC C  S  ++ T  + CV   Q            G T    C DC C     +C K  C   T   PG
Sbjct: 2031 CCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIVPVFG--YFRVLIDNYYCDVGDSVSCPQSIIVEY-HQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNGIVTSRVGIKMYVTIQEI-----------GVRVMFSGLIFSVEVPF-NLFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKVPNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYCHMLDLE---VVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDSISPSLTLQEAGPK-TEGCFCPDSTTLFSTNDSICVPSCQWCLGPRGEPVEPGHTISIDCQDCICKEATLTCQKKACPQPTCPEPG 2420          
BLAST of Hemocytin vs. UniProt/SwissProt
Match: sp|Q02817|MUC2_HUMAN (Mucin-2 OS=Homo sapiens OX=9606 GN=MUC2 PE=1 SV=2)

HSP 1 Score: 472.241 bits (1214), Expect = 8.480e-135
Identity = 363/1264 (28.72%), Postives = 564/1264 (44.62%), Query Frame = 2
Query:  653 TKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFL----GLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEF--MKYWKNPDPI--DPNTYYTTG-----RDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNG---TYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRL--LYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDP---KCPNGMEYMECKNLCSVSCFSLTQTNCSTEC------IDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTK--------------NDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKT-CVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGK--GIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC----PP---EKTFKTCINDCPKKC-----FKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFT--ENCLICVC-NENNFKCRPD 4261
            T+Y    +CS  G  +  TFDG     P         DC   + SY+ F       P +         ++ T  +   +L     + N +  S  +Y   +  +    + ++     L ++++ +  + +      +   CGLCG ++G  S S EF  ++   + +  EF  M+    PD +  DP            R  C  L   L   A   CQD          ++P+ PY   C+ + C C   G +  VC+ +A     F S QC+   G+  NWR+    P+ CP N  Y E GS C   C  L     C+     GCFCP+   ++    + CVP  QC C R +G+   +Y  G     DCE C C+ G      K   C GTC + G  H TTFD +     G C+Y +         N    +  +   C  ++   C K++ L      N+   +  +  ++L+N++   LP  +     +      H  V +     +++      Q+ +TL +  Q QVQGLCGN+NG   DD   +SG +       A +W A + C   L       C+ + E   +A+ +C  L     PF  CH +VDP  + ++C++D C C  NE  +C C +++SY RAC   G+ L      +C+     CPN   ++     C  +C SL++ +  + C      +DGC C  +   D    +CV +++C C H   Y  +G     +   C C +G   C +               DCSN+T     K          +C+          C SGC CPDG +   +  CV + +CPC+ ++  Y + + I        + CTC  G+W C Q   C G+C  +G  HY TFDGKY+DF   CSYV V   CG+   +G F ++TEN+ CG  G +C+K+I  +     ++L    R  +  +E +         + R++   L++ + + II+ WDK  ++ I L P Y+  VCGLCGNFD   NNDF ++     ++ L F +SWK    CP     P+ C  N  R++WA+K C  +K+  F+ C   VD + +Y+ C+ D+CSCD GGDCEC C+A++++   C K G    WR+ +LCP+ C    PP   E  ++ C N   + C       SN++ + LE C   C +        I  E   KCV  ++C C +   D  Y PG      E C  CVC N +   CRP+
Sbjct:   29 TRYHGRNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDC---RGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYS-EF--LSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERL---LTAEAFADCQD----------LVPLEPYLRACQQDRCRC--PGGDTCVCSTVA----EF-SRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHC-RLHGH---LYTPGQEITNDCEQCVCNAGRWV--CKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKGD----HNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNAVVFK--SDGSVLLNQLQVNLP-HVTASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSTCHDKLDW-LDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNE--DCLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEAD--SHCLEGFAPVDGCGCPDHTFLDEK-GRCVPLAKCSCYHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRA------LSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVD----CNTCTCKRGRWVCTQ-AVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGH-----HVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPK-----DRPIYEEDLKKCVTADKCGCYV--EDTHYPPGASVPTEETCKSCVCTNSSQVVCRPE 1224          

HSP 2 Score: 116.316 bits (290), Expect = 2.144e-24
Identity = 138/537 (25.70%), Postives = 225/537 (41.90%), Query Frame = 2
Query: 3149 GCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECG-NKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRV-------KGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALP-PQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSW----KSRVNCP--------AAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWR--SNELCPVMCPPEKTFKTC--INDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIE-AEGSNKCVKENECFCKLP-NSDKKYNPGEIFTENCLICVCNE--NNFKCRPDPKCITSTTSYCI--GSKL--------TKCENGVC---ARICNGIPE-CSDGSD-EANCXXXXXXXXXXXXXQPHCIYEGRIMQIGEVIKLESCLSVTCTDR--------RIVETRQNCDKTCQPNYVLKLYPDKCCE 4603
            GC    +C   C  WGD HY TFDG Y+ +   C+YV+V+ +    +  F +  +N  C  N   SC +++   +  Q V LI+ V    M+ +     +         G   ++  ++ ++   +  +++ ++ GLS  + LP  ++ N   G CG      ++D    +G   +N  A  D W     S+ +CP         A  VP   K+   +      +C  +K+  FA C  +V  + YY  C+ D+C    G   E  C +L A+ + C +  I   WR  ++  C V CP  + ++ C    +   K   S  NNTVL       VEGC CP   +  A G + CVK   C C  P N  +++  GE F  +C  CVC E  +   C+P  +C     ++C+  G+ L        T C   VC     +C   P  C  G + ++     +        ++  C++     Q G  +    C    CTD+         I  T   C+ +C P + L   P +CC+
Sbjct: 4470 GCCWHWECDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVE-EISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEV-LIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYN-GLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMP-GSSLE--CASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVL-------VEGCFCPEGTMNYAPGFDVCVK--TCGCVGPDNVPREF--GEHFEFDCKNCVCLEGGSGIICQPK-RCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWCESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCSPGFELMEAPGECCK 4988          

HSP 3 Score: 90.1225 bits (222), Expect = 1.914e-16
Identity = 111/463 (23.97%), Postives = 177/463 (38.23%), Query Frame = 2
Query: 1772 CSGTCVISGDPHYTTFDKRHIYVEGSCFYTMV-ATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDN--STFIQLVTTKNILVNKIPNRLP-----LQINDPLRLTIQEVAHDTVLIESYNG----IRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-----ATAECKSTLS------LSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSS--LCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQC-KSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWS--CTKNDCSN--VTFCPPGKEW--KECGHCDQTCENQDGFCLEKGCKS-GCFCPDGYLLSNKTCVPKHKCPCLW 3061
            C   C   GDPHY TFD  +   +G+C Y +V    PS+       +++ N HC  ++   C ++L ++    +    T   +     + VN+    LP     L++       + ++    VL+ SYNG    +R+ +H+           + +  +G CG     + DD    SGE+ +N    A  W     +   C  + S      ++  G    +   +      CQ +    F  CH  V P  +   C  D C   G+  +   C S+ +Y   C +  + L WR+ +   C  +CP+  EY  C      +C S +    +T  ++GC C +  M Y    + CV    C    +N     G   +  C +C C  G     C    CS   VT C     +   E    D  C      C    CK     CP G+ + +K  VP   CP  W
Sbjct: 4477 CDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDN---FGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLV-SYNGLSFSVRLPYHR-----------FGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSLE---CASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEGTMNYAPGFDVCVKTCGC-VGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKM-VPGRCCPFYW 4919          

HSP 4 Score: 64.6994 bits (156), Expect = 1.031e-8
Identity = 80/345 (23.19%), Postives = 133/345 (38.55%), Query Frame = 2
Query:  617 NTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCP-TKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRS-QLC--------APRECPANKEYSECGSSCSQNCEDL-ITDENCKSFCTAGCF--CPKDR 1609
            NT   K    + T+   +  CSI G  +  TFDG   +     S + V D   +  S   F   + N P     V C  ++ I      +            +  +  +   + +G +  ++    + +++D +  VFI    + K +VCGLCG FD  S  +++F   +   + +  +F   WK   P  P+   +T  + C+ LN    + A   C  +     S C + +   P+   C  + C C   G     C+ +A       + +CT  G  + WR+  LC         P EC     Y  CG+   + C  +     N       GC+  CPKDR
Sbjct:  840 NTCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRS--NNDFTTRDHMVVSSELDFGNSWKEA-PTCPDV--STNPEPCS-LNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVA-----SYAQECTKEGACVFWRTPDLCPIFCDYYNPPHEC--EWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPKDR 1171          

HSP 5 Score: 57.3806 bits (137), Expect = 1.756e-6
Identity = 83/380 (21.84%), Postives = 148/380 (38.95%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESV----TFLGLSNSSTNSNRNYISSIQHKNIG------DFNQIKGIGELEIL--YDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYY---TTGRDLCTGLNKDLVT-----TANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAP--RECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRF-WNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGG 1744
            C+  G  +  TFDG+        + +LV +      ++ ++ ++ Y+C   D V+C  +L++   ++ V      +         NR  ++ + +K  G        N +  I EL +L  Y+G              +  G CG     ++ S +    +GE + N       W   DP  P+  +   TT R   T       T     T + +CQ +     +QC  ++P   Y   C  +   C   G      +++ C+     +  C      ++WR+        ECP+++EY  CG +    C+   + +N  +    GCFCP+    +   + V    C C+   G   V    G  F+ DC+ C C +GG
Sbjct: 4481 CTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDN-YHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVA-LPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKGQCGTC--TNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFD--SCFMPG------SSLECASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQN-NTVLVEGCFCPEGTMNYAPGFDVCVKTCGCV---GPDNVPREFGEHFEFDCKNCVCLEGG 4844          
BLAST of Hemocytin vs. UniProt/SwissProt
Match: sp|Q62635|MUC2_RAT (Mucin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc2 PE=1 SV=1)

HSP 1 Score: 460.685 bits (1184), Expect = 2.538e-134
Identity = 364/1267 (28.73%), Postives = 566/1267 (44.67%), Query Frame = 2
Query:  671 QLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTF---LGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDG----NSSLSS--EFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWN---GTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNS-TFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIR--ILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDP---KCPNGMEYMECKNLCSVSCFSLTQTNCSTEC------IDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKN--------------DCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKT-CVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGK-GIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGR-ISF--RDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC----PP---EKTFKTCINDCPKKC-----FKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFT--ENCLICVC-NENNFKCRPDPKCITSTT 4285
             +CS  G  +  TFDG     P         DC      + +      +       +   S++I    +++     L + N +  S  +Y S +  +    + ++     L ++++ +  + +      +   CGLCG F+G    N  LS    F  I   +++ + +     ++P+ +      +  R  C  L   L +TA   CQ            +PV  Y   C  + C C   G          CS  +  S QC+   G+  NWR+    P++CP N  Y E GS     C  L     C+     GCFCP+   ++   G+ C+P  QC C + +G+   +Y  G     DCE C C+  G + C  +  C  TC + G  H TTFD +     G C+Y +  TK     N    +  +   C  ++   C K++ L    TDN    +   +  ++L+N++   LP   +     +I + +   +++ +  G+R  I      Q+ +TL +  Q QVQGLCGN+NG   DD   S G +       A +W A + C   L       C  + E   +A+ +C  L     PF  CH++VDP  + ++C++D C C  NE  +C C +++SY RAC   G+ L     S+C+     CP+   +M     C  +C S+++ +  T C      ++GC C  +   D    +CV +S+C C H   Y  +G     +   C C NG   CT+               DC+N+T     +          +C+          C SGC CPDG L + +  CV + +CPC+ + + Y +   I     +C + CTC +G+W C +   C  +C  +G  HY TFDGK++DF   CSYV V   CG+   G F ++TEN+ CG  G +C+K+I  +        I G   K+++     K   +G  + F  R++   L++   S II+ WDK  +I I L P Y+  VCGLCGNFD    NDF ++      + L F +SWK    CP     PD C  N  R++WA+K C  +K+  F  C   VD  ++Y  C+ D+CSCD GGDCEC C+A++++   C K      WR+ +LCPV C    PP   E  ++ C N   + C       SN++ + LE C   C E        I  E   KCV  ++C C +   D +Y PG      E C+ C C N +   CRPD   I + T
Sbjct:   32 HVCSTWGDFHYKTFDGDVFRFPGLCDYNFASDCRDSYKEFAVHLKRGLD--KAGGHSSIESVLITIKDDTIYLTHKLAVVNGAMVSTPHYSSGLLIEKNDAYTKVYSRAGLSLMWNREDALMVELDGRFQNHTCGLCGDFNGMQANNEFLSDGIRFSAIEFGNMQKINKPEVVCEDPEEVQEPESCSEHRAECERL---LTSTAFEDCQ----------ARVPVELYVLACMHDRCQCPQGGA-------CECSTLAEFSRQCSHAGGRPENWRTASLCPKKCPGNMVYLESGSPWLDTCSHLEVSSLCEEHYMDGCFCPEGTVYDDITGSGCIPVSQCHC-KLHGH---LYMPGQEITNDCEQCVCN-AGRWMCKDLP-CPETCALEGGSHITTFDGKKFTFHGDCYYVLTKTKY----NDSYALLGELASCGSTDKQTCLKTVVLL---TDNKKNVVAFKSGGSVLLNEMEVSLP---HVAASFSIFKPSSYHIVVNTMFGLRLQIQLVPVMQLFVTLDQSAQGQVQGLCGNFNGLESDDFMTSGGMVEATGAGFANTWKAQSSCHDKLDW-LDDPCPLNIESANYAEHWCSLLKRSETPFARCHLAVDPTEYYKRCKYDTCNCQNNE--DCMCAALSSYARACAAKGVMLWGWRESVCNKDVHACPSSQIFMYNLTTCQQTCRSISEGD--THCLKGFAPVEGCGCPDHTFMDEK-GRCVPLSKCSCYHHGLYLEAGDVILRQEERCICRNGRLQCTQVKLIGHTCLSPQILVDCNNLTALAIREPRP------TSCQTLVARYYHTECISGCVCPDGLLDNGRGGCVVEDECPCIHNKQFYDSGKSI---KLDCNNTCTCQKGRWECTR-YACHSTCSIYGSGHYITFDGKHYDFDGHCSYVAVQDYCGQNSTGSFSIITENVPCGTTGVTCSKAIKIF--------IGGTELKLVDKHRVVKQLEEGHHVPFITREVGLYLVVEVSSGIIVIWDKKTTIFIKLDPSYKGNVCGLCGNFDDQTKNDFTTRDHMVVASELDFGNSWKEASTCPDVSHNPDPCSLNPHRRSWAEKQCSIIKSDVFLACHGKVDPTVFYDACVHDSCSCDTGGDCECFCSAVASYAQECTKAEACVFWRTPDLCPVFCDYYNPPDECEWHYEPCGNRSFETCRTLNGIHSNISVSYLEGCYPRCPE-----DRPIYDEDLKKCVSGDKCGCYI--EDTRYPPGGSVPTDEICMSCTCTNTSEIICRPDEGKIINQT 1229          

HSP 2 Score: 146.747 bits (369), Expect = 8.351e-34
Identity = 176/669 (26.31%), Postives = 265/669 (39.61%), Query Frame = 2
Query: 2723 MVYDTAVNQC-----VNISQCQCSHENAYYPSG-----STRKEKCNDCNCTNGV---WS----CTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCL-EKGCKSGCFCPDGYLLSNKT---CVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKG-TSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSD--IILYWDKGLSIEIALPP----------QYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKD-VPDMCKSNHERQAWADKMCGTMKN--VKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGID-YSWRSNELC---PVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNC--VEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPKCITSTTSYCIGSK-LTKCENGVCARICNGIP-------------ECSDGSDEANCXXXXXXXXXXXXXQPHCIYEGRIMQIGEVIKLESCLSVTCTDRRIVETRQNCDKTC 4558
            ++  TA   C     V +    C H+    P G     ST  E    C+   G    W     C K    N+ +   G  W +      TC + +   L E+    GCFCP+G +  + T   C+P  +C C      Y+    I    TN   +C CN G+W C ++  C  +C   G +H  TFDGK F F   C YV+  +   K    + L+ E   CG+    +C K++     N+   +       V+ NE          +S   + +   I+  S   I++    GL ++I L P            Q QV GLCGNF+   ++DF +  G  E     F ++WK++ +C    D + D C  N E   +A+  C  +K     FA C   VD   YY++C  DTC+C    DC  +C ALS++  AC   G+  + WR + +C      CP  + F   +  C + C   +  +T   +C K    VEGC CP      E   +CV  ++C C   +       G++       C+C     +C    K I  T   C+  + L  C N     I    P             EC  G    +      +       +  CI+  +    G+ IKL+   + TC   R   TR  C  TC
Sbjct:  225 LLTSTAFEDCQARVPVELYVLACMHDRCQCPQGGACECSTLAEFSRQCSHAGGRPENWRTASLCPKKCPGNMVYLESGSPWLD------TCSHLEVSSLCEEHYMDGCFCPEGTVYDDITGSGCIPVSQCHCKLHGHLYMPGQEI----TNDCEQCVCNAGRWMC-KDLPCPETCALEGGSHITTFDGKKFTFHGDCYYVLTKT---KYNDSYALLGELASCGSTDKQTCLKTVVLLTDNKKNVVAFKSGGSVLLNEM--------EVSLPHVAASFSIFKPSSYHIVVNTMFGLRLQIQLVPVMQLFVTLDQSAQGQVQGLCGNFNGLESDDFMTSGGMVEATGAGFANTWKAQSSCHDKLDWLDDPCPLNIESANYAEHWCSLLKRSETPFARCHLAVDPTEYYKRCKYDTCNCQNNEDC--MCAALSSYARACAAKGVMLWGWRES-VCNKDVHACPSSQIFMYNLTTCQQTCRSISEGDT---HCLKGFAPVEGCGCPDHTFMDE-KGRCVPLSKCSCY--HHGLYLEAGDVILRQEERCICRNGRLQCT-QVKLIGHT---CLSPQILVDCNNLTALAIREPRPTSCQTLVARYYHTECISGCVCPDGLLDNGRGGCVVEDECPCIHNKQFYDSGKSIKLDCNNTCTCQKGRWECTRYACHSTC 858          
BLAST of Hemocytin vs. UniProt/SwissProt
Match: sp|P98088|MUC5A_HUMAN (Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4)

HSP 1 Score: 457.988 bits (1177), Expect = 4.812e-130
Identity = 365/1270 (28.74%), Postives = 562/1270 (44.25%), Query Frame = 2
Query:  614 PNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYN--CPTKDFVNCDT-SLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDP--NTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDL-SQCTIL-PVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLI-NWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNG---TYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWH--QKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDP--KCPNGMEYMECKNLCSVSCFSLTQTN--CSTECI--DGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKN--------------DCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKT-CVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCG---KGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCP---PEKTFKTCINDCPKKCFKSNLNNTVLENCAKNC--VEGC--SCPTEY-IEAEGSNKCVKENECFCKLPN-------SDKKYNPGEIFT--ENCLICVCNENNFKC 4252
            P+   + +    N  +   ++CS  G  +  TFDG     P   + +    C +    + I    S     PT   V      ++I+    SV   G       S    +  IQ  +   + +++    L ++++   ++ +          CGLCG F+G   +S    +    +     EF    K  DP D   +      R+  TG           +C+++  G L S C  L  V  Y   CR +LC C +      VC  +A       S QCT  G L  +WR     P++CP N +Y EC S C+  C +      C+  C AGCFCP+    +    T CVP  +C C+  NG     Y  G ++  DC  C CS GG ++C ++  C GTC + G  H++TFD +   V G C Y  V TKP    +    +  +   C  ++   C KS++L        T + +  +  + +N+I  +LP+   +   +TI   +   ++ ++  G+++        Q+ + L    + Q  GLCGN+N    DD    SG +         ++ T      +  S+   C+ S E EK+A+ +C +L     PF  CH +V P  +   C  D C C     ++C C +++SY  AC   G+ L  WR      P   CP  M Y    + C  +C SL++ +  CS   I  DGC C      D    +CV  S C C H  +  P+G +  +    C CT+G  SC                 DC N T   PG        C ++C   D  C    C  GC CPDG +   +  C+    CPC+ ++ SY     I  G     + CTC+   W C  +  C+ +C  +GD HY TFDG+ + F   C Y +V + CG        F++VTEN+ CG  GT+C+K+I  +     ++L  G    +  +E+      +   + R +   L++ TD  ++L WDK  SI I L P+++ +VCGLCGNFD    NDF +++ +   ++L F +SWK   +CP A    D C +N  R++WA K C  +    FA C   V+   YY+ C++D C+CD GGDCEC CTA++A+  AC + G+  SWR+  +CP+ C    PE   +     C   C ++  N     +C ++   +EGC   CP E  I  E   +CV      C  P          K Y PG +    +NC  C+C E   +C
Sbjct:   61 PSLRTIPVVRASNPAHNG-RVCSTWGSFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNIQLRRSQESAAPTLSRVLMKVDGVVIQLTKGSVLVNGHPVLLPFSQSGVL--IQQSS--SYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSH---NTKLTPMEFGNLQKMDDPTDQCQDPVPEPPRNCSTGFG---------ICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCEDTDLLSCVCHTLA-----EYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSPCADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACV-YNG---AAYAPGATYSTDCTNCTCS-GGRWSCQEVP-CPGTCSVLGGAHFSTFDGKQYTVHGDCSY--VLTKPC--DSSAFTVLAELRRCGLTDSETCLKSVTLSLDGAQ--TVVVIKASGEVFLNQIYTQLPISAAN---VTIFRPSTFFIIAQTSLGLQLNLQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTFKTQAACPNIRNSFEDPCSLSVENEKYAQHWCSQLTDADGPFGRCHAAVKPGTYYSNCMFDTCNC--ERSEDCLCAALSSYVHACAAKGVQLGGWRDGVCTKPMTTCPKSMTYHYHVSTCQPTCRSLSEGDITCSVGFIPVDGCICPKGTFLDD-TGKCVQASNCPCYHRGSMIPNGESVHDSGAICTCTHGKLSCIGGQAPAPVCAAPMVFFDCRNAT---PGDTG---AGCQKSCHTLDMTCYSPQCVPGCVCPDGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVG----CNTCTCDSRMWRC-TDDPCLATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKVEVIGTDESQ-----EVPYTIRQMGIYLVVDTDIGLVLLWDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACACDSGGDCECFCTAVAAYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNP--RGDCLRDVRGLEGCYPKCPPEAPIFDEDKMQCVAT----CPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVEC 1268          

HSP 2 Score: 108.612 bits (270), Expect = 5.053e-22
Identity = 96/377 (25.46%), Postives = 156/377 (41.38%), Query Frame = 2
Query: 3182 CKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRD---LVSQLIIYTDSD----IILYWDKGLSIEIALPPQYQNQVCGLCGNFD------QNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVK-FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYG-IDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPT-EYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDP 4264
            C +WG  HYKTFDG  F F   C+YV  +  CG     F +     +           +       V+QL +G    V+ N  +P       + F     L+ Q   YT  +    ++L W+   S+ + L  +Y N+ CGLCG+F+      + L+++ K     + N  L  +D    +   P  +  P  C +          +C  + + + F+ C  +VD   Y + C  D C C+      C+C  L+ +   C   G +   WR  + CP  CP    +  C + C   C  SN  ++    C  +CV GC CP    ++  G   CV  ++C C    +   Y PG  ++ +C  C C+   + C+  P
Sbjct:   81 CSTWGSFHYKTFDGDVFRFPGLCNYVFSE-HCGAAYEDFNIQLRRSQ--ESAAPTLSRVLMKVDGVVIQLTKG---SVLVN-GHPV-----LLPFSQSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGN--LQKMDDPTDQCQDPVPEP-PRNCSTGF-------GICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCEDTDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSPCADTC--SNQEHS--RACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVY--NGAAYAPGATYSTDCTNCTCSGGRWSCQEVP 429          

HSP 3 Score: 103.605 bits (257), Expect = 1.707e-20
Identity = 94/409 (22.98%), Postives = 153/409 (37.41%), Query Frame = 2
Query: 3149 GCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNK-GTSCTKSIFFYYRNQVVQLIRGVRPKVMENENY-------PKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALP-PQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWK-------------------------SRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYG--IDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEY-IEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNF--KCRP 4258
            GC    +C   C  WGD HY TFDG Y+ F+  C+YV+V        G F+++ +N  CG + G SC +SI   Y    V L R     VM NE         P  R  G +  R  V       +  + + +  GL   + +P  ++ N   G CG    +  ++ ++  G    +       W                          S    P       +  +          +C  + +  F  C  V+   L+Y+ C+ D C      D + +C++L  + + C  +   ID+  R+  +CP  CP +K ++ C    P  C+ ++  +      A    EGC CP    + +  +  CV      C  P+ +     G     +C  C C    +   CRP
Sbjct: 4910 GCCHHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVMF-SGLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPICQLILSKVFEPCHTVIPPLLFYEGCVFDRCHMT---DLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGE-PVKVGHTVGMDCQECTCEAATWTLTCRP 5312          

HSP 4 Score: 62.3882 bits (150), Expect = 5.322e-8
Identity = 79/396 (19.95%), Postives = 141/396 (35.61%), Query Frame = 2
Query: 1796 GDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTD---NSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKT-QIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW---------------------ATAECKSTLSLSYLG---VCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKD-NCACESMASYGRACMKNGLTLKW--RSSSLCDPKCPNGMEYMECKNLCSVSCF-----SLTQTNCSTECIDGCQCKSNM-VYDTAVNQCVNI--SQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCT 2866
            GDPHY TFD  +     +C Y +V     + G+   ++ V N  C   +   C +S+ L++           +  V T  I+ N        + N    + +  +           G+++++      +E+   +F  +  +G CG    + +D+     G +  + +E++  W                      T    +T+  + +G   V   +          CQ +L + F  CH  + P  F + C  D C    +  D +  C S+  Y   C  + + + W  R+  +C   CP    Y  C       C+     SL     +    +GC C   M ++ T+   CV     +C   H       G T    C +C C    W+ T
Sbjct: 4925 GDPHYITFDGTYYTFLDNCTYVLVQQIVPVYGH--FRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNG---IVVSRIGVKMYATIPELGVQVMFSGLIFSVEVPFSKF-ANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPICQLILSKVFEPCHTVIPPLLFYEGCVFDRC----HMTDLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVK-VGHTVGMDCQECTCEAATWTLT 5309          
BLAST of Hemocytin vs. UniProt/SwissProt
Match: sp|Q80Z19|MUC2_MOUSE (Mucin-2 (Fragments) OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=2)

HSP 1 Score: 455.292 bits (1170), Expect = 1.544e-129
Identity = 356/1264 (28.16%), Postives = 559/1264 (44.22%), Query Frame = 2
Query:  671 QLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTF---LGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSS----LSSE---FKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWN---GTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIR--ILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDP---KCPNGMEYMECKNLCSVSCFSLTQTNCSTEC------IDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKN--------------DCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKT-CVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGK-GIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC----PP---EKTFKTCINDCPKKC-----FKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFT--ENCLICVC-NENNFKCRPDPKCITSTT 4285
             +CS  G  +  TFDG     P         DC      + +              +   S++I    +++     L + N +  S  +Y S +  +    + ++     L ++++ +  + +      +   CGLCG F+G  +    LS E   F  I   +++ + +     ++P+ +      +  R  C  L   L + A   CQ          T +PV  Y   C  + C C   G          CS  +  S QC+   G+  NWR+    P++CP N  Y E  S C   C  L     C+     GCFCP+   ++   G+ C+P  QC C + +G+   +Y  G  F  DCE C C+ G      K   C  TC + G  H TTFD +     G C+Y +  ++     N    +  +   C  ++   C K++ L   D  N   +   +  ++L+N++   LP   +     +I + +   +++ +  G+R  I      Q+ +TL +  Q QVQGLCGN+NG   DD   S G +       A +W A + C   L       C+ + E   +A+ +C  L     PF  CH++VDP  + ++C++D C C  NE  +C C +++SY RAC   G+ L      +C+     CP+   +M     C  +C SL++ +  + C      ++GC C  +   D    +CV +++C C H   Y  +G     +   C C NG   CT+               DC+N+T     K          +C+          C SGC CPDG L   +  CV + KCPC+ +   Y +   I     +C + CTC +G+W C +   C  +C  +G  HY TFDGK++DF   CSYV V   CG+   G F ++TEN+ CG  G +C+K+I  +     ++L+   R      E +    +      R++   L++   S II+ WDK  +I I L P Y+  VCGLCGNFD    NDF ++      + L F +SWK    CP     PD C  N  R++WA+K C  +K+  F  C   VD  ++Y+ C+ D+CSCD GGDC+C C+A++++   C K      WR+ +LCP+ C    PP   E  ++ C N   + C       SN++ + LE C   C E        I  E   KCV  ++C C +   D +Y PG      E C  C C N +  +C PD   I + T
Sbjct:   32 HVCSTWGDFHYKTFDGDVYRFPGLCDYNFASDCRDSYKEFAVHLKRGLG--EAGGHSQIESILITIKDDTIYLTHKLAVVNGAMVSTPHYSSGLLIEKNDAYTKVYSRAGLSLMWNREDALMVELDSRFQNHTCGLCGDFNGMQTNYEFLSEEGIQFSAIEFGNMQKINKPEVQCEDPEAVQEPESCSEHRAECERL---LTSAAFEDCQ----------TRVPVESYVRACMHDRCQCPKGGA-------CECSTLAEFSRQCSHAGGRPENWRTASLCPKKCPNNMVYLESSSPCVDTCSHLEVSSLCEEHYMDGCFCPEGTVYDDITGSGCIPVSQCHC-KLHGH---LYMPGQEFTNDCEQCVCNAGRWV--CKDLPCPETCALEGGSHITTFDGKKFTFHGDCYYVLTKSE----HNDSYALLGELASCGSTDKQTCLKTVVLLTDDKKN--VVAFKSGGSVLLNEMEVTLP---HVAASFSIFQPSSYHIVVNTKFGLRLQIQLLPVMQLFVTLDQAAQGQVQGLCGNFNGLESDDFMTSGGMVEATGAGFANTWKAQSSCHDKLDW-LDDPCSLNIE-TNYAEHWCSLLKRSETPFARCHLAVDPTEYYKRCKYDTCNCQNNE--DCMCAALSSYARACAAKGVMLWGWRERVCNKDVHACPSSQIFMYNLTTCQQTCRSLSEGD--SHCLKGFAPVEGCGCPDHTFMDEK-GRCVPLAKCSCYHHGLYLEAGDVILRQEERCICRNGRLQCTQVKLIGHTCQYPKILVDCNNLTALAVRKPRP------TSCQTLVAGYYHTECISGCVCPDGLLDDGRGGCVEEDKCPCIHNKDLYSSGESI---KLDCNNTCTCQKGRWECTR-YACHSTCSIYGSGHYITFDGKHYDFDGHCSYVAVQDYCGQNSTGSFSIITENVPCGTTGVTCSKAIKIFIGGTELKLVDKHRVVKQLEEGHHVPYIT-----REVGQYLVVEASSGIIVIWDKKTTIFIKLDPSYKGTVCGLCGNFDDQTKNDFTTRDHMVVTSELDFGNSWKEASTCPDVSHNPDPCSLNPHRRSWAEKQCSIIKSRVFKVCHSKVDPTVFYEACVHDSCSCDTGGDCDCFCSAVASYAQECTKAEACVFWRTPDLCPIFCDYYNPPDECEWHYEPCGNRSFETCRTLNGIHSNISVSYLEGCYPRCPED-----RPIYDEDLKKCVTGDKCGCYI--EDTRYPPGGSVPTDEICKSCTCTNTSKIECHPDEGKILNMT 1229          

HSP 2 Score: 139.428 bits (350), Expect = 2.127e-31
Identity = 150/561 (26.74%), Postives = 226/561 (40.29%), Query Frame = 2
Query: 2987 GCFCPDGYLLSNKT---CVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKG-TSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSD--IILYWDKGLSIEIALPP----------QYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKD-VPDMCKSNHERQAWADKMCGTMKN--VKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGID-YSWRSNELC---PVMCPPEKTFKTCINDCPKKCFK-SNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPKCITSTTSYCIGSKLTKCENGVCARICNGIP-------------ECSDGSDEANCXXXXXXXXXXXXXQPHCIYEGRIMQIGEVIKLESCLSVTCTDRRIVETRQNCDKTC 4558
            GCFCP+G +  + T   C+P  +C C      Y+         TN   +C CN G+W C ++  C  +C   G +H  TFDGK F F   C YV+  S+       + L+ E   CG+    +C K++     ++   +       V+ NE          ++   + +   I+  S   I++    GL ++I L P            Q QV GLCGNF+   ++DF +  G  E     F ++WK++ +C    D + D C  N E   +A+  C  +K     FA C   VD   YY++C  DTC+C    DC  +C ALS++  AC   G+  + WR   +C      CP  + F   +  C + C   S  ++  L+  A   VEGC CP      E   +CV   +C C   +       G++       C+C     +C    K I  T  Y     L  C N     +    P             EC  G    +      +       +  CI+   +   GE IKL+   + TC   R   TR  C  TC
Sbjct:  326 GCFCPEGTVYDDITGSGCIPVSQCHCKLHGHLYMPGQEF----TNDCEQCVCNAGRWVC-KDLPCPETCALEGGSHITTFDGKKFTFHGDCYYVLTKSEHNDS---YALLGELASCGSTDKQTCLKTVVLLTDDKKNVVAFKSGGSVLLNEM--------EVTLPHVAASFSIFQPSSYHIVVNTKFGLRLQIQLLPVMQLFVTLDQAAQGQVQGLCGNFNGLESDDFMTSGGMVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIETN-YAEHWCSLLKRSETPFARCHLAVDPTEYYKRCKYDTCNCQNNEDC--MCAALSSYARACAAKGVMLWGWR-ERVCNKDVHACPSSQIFMYNLTTCQQTCRSLSEGDSHCLKGFAP--VEGCGCPDHTFMDE-KGRCVPLAKCSCY--HHGLYLEAGDVILRQEERCICRNGRLQCT-QVKLIGHTCQY--PKILVDCNNLTALAVRKPRPTSCQTLVAGYYHTECISGCVCPDGLLDDGRGGCVEEDKCPCIHNKDLYSSGESIKLDCNNTCTCQKGRWECTRYACHSTC 858          

HSP 3 Score: 110.153 bits (274), Expect = 1.680e-22
Identity = 109/404 (26.98%), Postives = 174/404 (43.07%), Query Frame = 2
Query: 3182 CKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIEC-GNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRV-------KGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQ-YQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSW----KSRVNCP--------AAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNE--LCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIE-AEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPKCITSTTSYCIGSKLTKCE 4321
            C  WGD H+ TFDG Y+ +   C+YV+V+ +    +  F +  +N  C  N   SC +++   +  Q VQ I+ VR   +E E     ++        G   +   ++ ++  +  +  + ++ GLS  I LP + + N   G CG    N  +D    +G   ++     D W     S+ +CP         A   P +  +N         +C  + +  F+ C   V  + YY+ CL D+C    G + EC   ++ A+ + C K G+   WR++   +C V CPP K ++ C  +    C  S+  N+ L       VEGC CP    + A G + CVK   C C  P++  +   GE F  +C  CVC E        PK        C G   T CE
Sbjct: 1986 CTGWGDPHFVTFDGLYYSYQGNCTYVLVE-EITPTVDNFGVYIDNYHCDANDKVSCPRTLIVRHETQEVQ-IKTVRMMPIEVEVQVNKQLVALPYKKYGLEVYESGINIVVNISRLEAKISYN-GLSFSIRLPYKLFVNNTKGQCGTCTNNTADDCILPSGKIISDCEIAADEWLVNDPSKPHCPHKGLTTKRPATTTPGLSLNN----CTVSPVCHLIMDSLFSQCHAFVPPKHYYEACLFDSCYVP-GSNMEC--ASVQAYATLCAKEGVCIDWRNHTQGVCSVKCPPHKQYQACGPEEEPTCQPSSSQNSTL------LVEGCFCPEGTTKFAPGYDVCVK--TCGCVGPDNVPR-EFGEHFEFDCKDCVCREGGSGIVCQPK-------KCSGGNQTTCE 2363          

HSP 4 Score: 88.1965 bits (217), Expect = 6.969e-16
Identity = 91/387 (23.51%), Postives = 152/387 (39.28%), Query Frame = 2
Query: 1751 NCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPL--------RLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLP-EFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEK--------FAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSS--LCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMV-YDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNG 2851
            NC     C   C   GDPH+ TFD  +   +G+C Y +V        N    +++ N HC  ++   C ++L ++    +    +Q+ T     V  +P  + +Q+N  L         L + E   + V+  S    +I ++      I LP + + +  +G CG    N+ DD    SG++ ++    A  W   +  S     + G+  K                   C  ++   F+ CH  V P  + + C  D C   G+   N  C S+ +Y   C K G+ + WR+ +  +C  KCP   +Y  C      +C   +  N ST  ++GC C      +    + CV    C    +N     G   +  C DC C  G
Sbjct: 1975 NCCWHWECDCYCTGWGDPHFVTFDGLYYSYQGNCTYVLVEEITPTVDN--FGVYIDNYHCDANDKVSCPRTLIVRHETQE----VQIKT-----VRMMPIEVEVQVNKQLVALPYKKYGLEVYESGINIVVNISRLEAKISYN-GLSFSIRLPYKLFVNNTKGQCGTCTNNTADDCILPSGKIISDCEIAADEWLVND-PSKPHCPHKGLTTKRPATTTPGLSLNNCTVSPVCHLIMDSLFSQCHAFVPPKHYYEACLFDSCYVPGS---NMECASVQAYATLCAKEGVCIDWRNHTQGVCSVKCPPHKQYQACGPEEEPTCQPSSSQN-STLLVEGCFCPEGTTKFAPGYDVCVKTCGC-VGPDNVPREFGEHFEFDCKDCVCREG 2343          

HSP 5 Score: 61.2326 bits (147), Expect = 1.084e-7
Identity = 88/389 (22.62%), Postives = 150/389 (38.56%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLS----NSSTNSNRNYISSIQHKNIG------DFNQIKGIGELE--ILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYY---TTGRDLCTGLNKDLVT-TANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWR--SQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKD--RFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSG 1780
            C+  G  +  TFDG+        + +LV +      ++ ++ ++ Y+C   D V+C  +L++   ++ V    +           N+  ++ + +K  G        N +  I  LE  I Y+G              +  G CG    N++      +  G+ I +       W   DP  P+  +   TT R   T     L   T + +C  +     SQC   +P   Y   C  + C+   +        N+ C+     +  C   G  I+WR  +Q     +CP +K+Y  CG      C+   +  +  +    GCFCP+   +F  G Y V    C C+   G   V    G  F+ DC+ C C +GG     + + CSG
Sbjct: 1986 CTGWGDPHFVTFDGLYYSYQGNCTYVLVEEITPTVDNFGVYIDN-YHCDANDKVSCPRTLIVRHETQEVQIKTVRMMPIEVEVQVNKQLVA-LPYKKYGLEVYESGINIVVNISRLEAKISYNGLSFSIRLPYKLFVNNTKGQCGTCTNNTADDCILPS--GKIISDCEIAADEWLVNDPSKPHCPHKGLTTKRPATTTPGLSLNNCTVSPVCHLIMDSLFSQCHAFVPPKHYYEACLFDSCYVPGS--------NMECASVQAYATLCAKEGVCIDWRNHTQGVCSVKCPPHKQYQACGPEEEPTCQPSSSQNS--TLLVEGCFCPEGTTKFAPG-YDVCVKTCGCV---GPDNVPREFGEHFEFDCKDCVCREGGSGIVCQPKKCSG 2356          

HSP 6 Score: 55.8398 bits (133), Expect = 5.448e-6
Identity = 86/401 (21.45%), Postives = 141/401 (35.16%), Query Frame = 2
Query:  653 TKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVID-CLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWK----------NPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC--TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPREC----PANK---EYSECGSSCSQNCEDL-ITDENCKSFCTAGCF--CPKDRFW---NGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRD--CEICECSKGGVFNCAKIRG 1771
            T+Y  +  CSI G  +  TFDG   +     S + V D C             +  C T   V C  ++ I      +  +            +      + +G +  ++    + +++D K  +FI    + K +VCGLCG FD  +   ++F   +   + +  +F   WK          NPDP                LN    + A   C  +       C   + P + Y++ C  + C C   G     C+ +A       + +CT     + WR+    P  C    P ++    Y  CG+   + C  L     N       GC+  CP+DR     +   CV   +C C  ++      Y  G S   D  C+ C C+      C    G
Sbjct:  850 TRYACHSTCSIYGSGHYITFDGKHYDFDGHCSYVAVQDYCGQNSTGSFSIITENVPCGTTG-VTCSKAIKIFIGGTELKLVDKHRVVKQLEEGHHVPYITREVGQYLVVEASSGIIVIWDKKTTIFIKLDPSYKGTVCGLCGNFDDQT--KNDFTTRDHMVVTSELDFGNSWKEASTCPDVSHNPDPC--------------SLNPHRRSWAEKQCSIIKSRVFKVCHSKVDPTVFYEA-CVHDSCSCDTGGDCDCFCSAVA-----SYAQECTKAEACVFWRTPDLCPIFCDYYNPPDECEWHYEPCGNRSFETCRTLNGIHSNISVSYLEGCYPRCPEDRPIYDEDLKKCVTGDKCGCYIEDTR----YPPGGSVPTDEICKSCTCTNTSKIECHPDEG 1223          
BLAST of Hemocytin vs. UniProt/SwissProt
Match: sp|Q2PC93|SSPO_CHICK (SCO-spondin OS=Gallus gallus OX=9031 GN=SSPO PE=2 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 1.398e-128
Identity = 345/1160 (29.74%), Postives = 522/1160 (45.00%), Query Frame = 2
Query:  956 IGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTG--LNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDE--NCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIE-ITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCST------ECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGR-ISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDM--CKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENC-AKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPKCITSTTSYCIGSKLTKCENGVC---ARICNGIPECSDGSDE 4381
            +GDF  ++    + +  DG+  V++     ++ S  GLCG +  N     +F  + G+       F   W+ PD  +P    +   +   G  +       A  MC  +      QC    V P+         HC   G   S    +  ++ ++    C      I WR      ++C   + YS+C SSC  +C    T E  +C+  C +GC C      +   C+P+  CPC+ +      +Y  G S ++ C  C C +GG + C + R C+  C + GD HY TFD+R     G+C YT+V      T    L+I  +   C       C ++LS+    T      +L +T  ++V+     LP        LT++  +   +L++++ G  +LW  +T    ITL   + ++V+GLCG YN +  DD    +G++       A  +  +     LS      C+      + A   C  L    F  CH  VD  PF Q C +D+C C   +  +C C ++A+Y R C + G  L WR+ S C  +C  G  Y EC + C  +C  L     S+       C+ GC C    V D    QCV    C C H +  YP+GS  ++ CN C CT G WSCT   C +  FCP G      G C +TC++ +      G   GC CP G +  ++ CVP  +CPC  + + Y     I     +C + C C + +W C  E  C+G+C + GD HY TFDG+ F F+  C YV+V     +  G F +  EN+ CG  G +CTKS+     N VV ++RG    V      P     G  ++ +     L++ +   + + WD G  + I L PQ++ +V GLCGNFD++  ND  S+ G  E     F +SW+  + CP          C  N  R  WA K C  +    FA C   V  + +Y  C+ D C CD GGDCECLCTA++ +   C + GI   WRS +LCP+ C   + +  C   CP+ C   NL   + E+C   +C+EGC CP   +  EGS  C+   EC C        +    +  + C  C C    ++C P  +   +   +C  S+      G C   A +C+   +C DGSDE
Sbjct:  279 LGDFVAVESGLGVHLKLDGRGTVYVTVSAELRGSTKGLCGPY--NDDPIDDFLRVEGDVAPLAASFGNSWRIPDA-NPELSCSDAVEPSPGCAMGSTAQRAAEAMCGMLLTDPFRQCH-EAVDPHGFYEACLELHCREGGTGPSPPPAVCDTLATYVR-DCAQRRAYIEWRRPGLCEQQCGHGQRYSDCVSSCPASCMAAGTAEEGHCRDDCASGCECTPGLLLDRGACIPQSACPCLHRGH----IYAPGQSIRQRCNQCTC-RGGRWLCTQDR-CAAECAVLGDLHYITFDRRRFSFPGACEYTLVQDFVEGT----LRITAEQEACGGHQPLSCLRALSI----TVPGASARLHSTGEVVVDGRVVPLPFA---SAALTVRRASSSFLLLQTF-GAHLLWGLETPAAYITLQPAFANKVRGLCGTYNWDQRDDFATPAGDVEVGVTAFANKYRVSTDCPVLSPVPFEPCSTYAPRRELAAAACAILHGASFQPCHHLVDREPFHQLCLYDVCACPAGK--HCLCPALAAYARECAQEGAALSWRNESFCGTQCRGGQVYQECSSPCGRTCADLRLDGASSCPSLDNICVSGCNCPEGPVLDDG-GQCVPPGVCPCQHSSQLYPAGSKIRQGCNACMCTAGTWSCTDAPCPDAAFCP-GDLVYVFGSCLRTCDSAEPNGTCTGIADGCVCPPGTVFLDERCVPPEECPCQHNGRLYHPNDTIVR---DC-NTCVCRQQRWQCSSED-CMGTCVATGDPHYITFDGRAFSFLGDCEYVLVR----EANGLFTVTAENVPCGTSGVTCTKSVVVEMGNTVVHMLRGRDVTVNGVSVRPPKVYSGNGLTLQRAGIFLLLLSRLGLAVLWDGGTRVYIRLQPQHRGRVVGLCGNFDRDAENDLASQQGVLEPTAELFGNSWRVSLLCPEVDGTTAQHPCTDNPHRATWARKRCSILTQRLFAPCHDEVPCQHFYDWCIFDACGCDSGGDCECLCTAIATYAEECSQRGIHIRWRSQDLCPMQCDGGQEYSACGPPCPQTC--RNLGLELPEHCDTMSCLEGCFCPEGKVLHEGS--CIDPAECPCFWQGI--AFPDSAVVQQGCRNCSCTAGLWQCVPTAEPCPA-QPHCPDSEFPCRSGGRCVPGAWLCDNEDDCGDGSDE 1395          

HSP 2 Score: 82.0333 bits (201), Expect = 6.296e-14
Identity = 81/370 (21.89%), Postives = 140/370 (37.84%), Query Frame = 2
Query: 3176 GSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDS-DCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWK-----SRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDC--ECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPD 4261
             SC  W  + Y++FDG++F F  +C+Y +  S D    +               G+     + F     V Q        V   E   +  + G IS   L   + + +   + L  D   ++ + +  + +    GLCG ++ +  +DF    G+      +F +SW+       ++C  A +    C      Q  A+ MCG +    F  C + VD   +Y+ CL   C     G      +C  L+ +   C +      WR   LC   C   + +  C++ CP  C  +        +C  +C  GC C    +   G+  C+ ++ C C   +    Y PG+   + C  C C    + C  D
Sbjct:  192 ASCTVWAGSRYRSFDGRHFGFQGECAYSLAASTDSTWAVSI-----------TPGSPPVLHMTFGLDTVVAQGHNISVNGVAVPEG--RQHLHGGISVTWLGDFVAVESGLGVHLKLDGRGTVYVTVSAELRGSTKGLCGPYNDDPIDDFLRVEGDVAPLAASFGNSWRIPDANPELSCSDAVEPSPGCAMGSTAQRAAEAMCGMLLTDPFRQCHEAVDPHGFYEACLELHCREGGTGPSPPPAVCDTLATYVRDCAQRRAYIEWRRPGLCEQQCGHGQRYSDCVSSCPASCMAAGTAEE--GHCRDDCASGCECTPGLLLDRGA--CIPQSACPCL--HRGHIYAPGQSIRQRCNQCTCRGGRWLCTQD 542          

HSP 3 Score: 77.7962 bits (190), Expect = 1.200e-12
Identity = 120/508 (23.62%), Postives = 186/508 (36.61%), Query Frame = 2
Query:  332 NGGRCIEPDRCQCDPKFSGADCSFRI---ADEKPCIQG---CIRGKCKN------------GDCL--CDSGYEGERCDRAFCQYGCGTGI------CVEPNVCQCPENFRGRN-CETFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPT-KDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKN------IGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITD--ENCKSF-CTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKG 1741
            +GG+C+ P  C C           +I    +   C  G   C    C +            G CL  CDS      C        C  G       CV P  C C  N R  +  +T  R+ NT   +      +       C   G  +  TFDG +         +LV      + +  +F  ++ N P     V C  S+++E  +  V  L   + + N        +   N       G F  +     L +L+DG   V+I      +  V GLCG FD ++   ++  +  G        F   W+    + P    TT +  CT  N    T A   C  +     + C   +P   +   C  + C C + G    +C  IA       + +C+  G  I WRSQ   P +C   +EYS CG  C Q C +L  +  E+C +  C  GCFCP+ +  +   C+   +CPC  +     + +      ++ C  C C+ G
Sbjct:  858 DGGQCVPPGVCPCQHSSQLYPAGSKIRQGCNACMCTAGTWSCTDAPCPDAAFCPGDLVYVFGSCLRTCDSAEPNGTCTGIADGCVCPPGTVFLDERCVPPEECPCQHNGRLYHPNDTIVRDCNTCVCRQQRWQCSSEDCMGTCVATGDPHYITFDGRAFSFLGDCEYVLV------REANGLFTVTAENVPCGTSGVTCTKSVVVEMGNTVVHMLRGRDVTVNGVSVRPPKVYSGNGLTLQRAGIFLLLLSRLGLAVLWDGGTRVYIRLQPQHRGRVVGLCGNFDRDA--ENDLASQQGVLEPTAELFGNSWR-VSLLCPEVDGTTAQHPCTD-NPHRATWARKRCSILTQRLFAPCHDEVPCQHFYDWCIFDACGCDSGGDCECLCTAIATY-----AEECSQRGIHIRWRSQDLCPMQCDGGQEYSACGPPCPQTCRNLGLELPEHCDTMSCLEGCFCPEGKVLHEGSCIDPAECPCFWQG----IAFPDSAVVQQGCRNCSCTAG 1346          

HSP 4 Score: 55.0694 bits (131), Expect = 8.730e-6
Identity = 39/139 (28.06%), Postives = 56/139 (40.29%), Query Frame = 2
Query: 2540 GRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTE---CIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAY-YPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTC 2944
            G+ C      L   ++  CD  CP GM  + C N C   C  L +     E   C  GC+C +  +       CV ++ C+C+    + +  GST  + CN+C C  G   CT   C  +    P   W     C  TC
Sbjct: 4112 GQRCPGERHQLHLCNAQPCDDSCPPGMALVTCANHCPRHCGDLQEGIVCREEEHCEPGCRCPNGTLEQDG--GCVPLAHCECTDAQGHGWVPGSTHHDGCNNCTCLEGRLRCTDRLCPPLRC--PWSRWSRWSPCSVTC 4246          
BLAST of Hemocytin vs. TrEMBL
Match: A0A267DLR6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026350g2 PE=4 SV=1)

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 513/1515 (33.86%), Postives = 776/1515 (51.22%), Query Frame = 2
Query:   59 FHSHMKLVQIFIWL-VLSLSIQILAEDNNRFCGESFVREPFQACDDAKESLKDNDQLVTVGEQCQIKRYKRKCCNGWTGTDCQ-------------------------------FPICQQLCKNGGRCIEPDRCQCDPKFSGADC-SFRIADEKPCIQGC-IRGKCKNGDCLCDSGYEGERCDRAFCQYGCGT-GICVEPNVCQCPENFRGRNCE--TFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQH----KNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDL---CTGL---NKDLVTTANNMCQDVFGGD--LSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWR-SQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGN--QVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWAT-AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP-FNSCHMSVDPNPFIQQCEHDICLCGGNEK---DNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKS-GCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPT-EYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRP-----------DPKCITSTTSYCIGSKLTKCENGVCARICNGIPECSDGSDEANC 4390
            + + + L  + ++   ++ +   ++   N FC  +   E +  C DAKE      +  + G  CQ++   R CC+GW G+ C                                 P+C + C NGG C+ P+ C+C   F G  C S        C+ GC   GKC  G C+C+ GY+G++C+   C+  C + G C+ PN C+CP+ + G  C+    +   +T+ + +  V NT+Y++  +CS  GG +  TFDG   + P  GS +L+ DC++ +  Y+++FN S NC       C  SL I      V  +   +   N     + +I       N  +   ++G+ +L I YDG RN+ ++AP TM ++VCGLCG FDG ++  ++F ++  + + +V +F K W++  P D N Y +   D    C  L   +  L+ +A ++C  +  G    S C + +    Y+S+C  ++C CL  G N +VC    C+  +  S  CT  G +INWR S LC   +C   K +SEC   C+Q C     D++C + C  GCFCP  RFW+G  CV +  CPC R  G+S   Y  G  +   CE C C +GG + C+    C G C +SGDP Y TFD RH   EG C Y M+  + S   +    + ++V+N +C    D  C K ++LQ G  +    I+L +   + V+     LP++++D   +TI+ V+   + +E+  G  +LW+ +T+I+I L + ++++V GLCGN+N + +DD    +G    +  + A SW T   C +     Y G CA S E++ +A   C +L  E  F +CH  VDP   ++QC+HD+C CG   K     C C + ASY R+C  +G  L WRSSSLC  KCP  MEY EC + C  +C  +  + C  EC++GCQC S    D     CV  +QC+C +    Y +G  RK+KCN+C CT+G W CT   C++   CP G  W EC  C ++CEN +  C +  CKS GC CP G +L    CV K  CPC  + K Y   SV+  G T C + C C +G W C    KC  +C+ WGD HY+TFDG+Y+DF+  CSYV+ +  CG   G F++  ENI+CG +G SCTKS+   YR+ VV L+RG  P +  N  +P    K +         L   T+  I + WD  + + + L P +  +VCGLCGNF+   ++D +++ G    + +AF DSWK R  CP     P    S+ ER+ WA+K C  +++ +F  C   V+   +Y KC+ DTC+C +  DC C CTA+S +   C + G+   WR+ + CPVMCP    +K C + CP++C   +   T+  +C   CVEGC CP  E++E      C K  +C C +    KK   G+     C  C C   + +C+P                T+      G  + + E   CA+ C+G  EC  G DE  C
Sbjct:    6 YPAAVLLSAVLLYCSAVATASGSMSSSKNHFCNSTRT-EDYVKCSDAKEKGYVVLKTHSDGVNCQVQIKYRTCCSGWIGSSCSEAVCSPKCDNGMCVAPNSCNCSSGWSGATCNKPVCAKECANGGICVAPNTCRCAAGFDGEQCQSVATTVSSVCVGGCGSNGKCVRGRCVCNLGYKGDKCELPLCKNNCNSVGTCLAPNKCRCPDGYHGDLCQVSALYASDSTAFVAVRAVNNTRYRNSAVCSAFGGKHFLTFDGKYFDFPAHGSYVLLQDCVNSEAKYQVYFNGSRNCADAAQTRCQVSLKIVAGPAKVEIMPGGSVFVNEKPVTLPTIAGIVSVSNTANHITVRGLDDLAITYDGDRNINVYAPKTMSRTVCGLCGRFDGKAA--NDFTDLMNKPLTHVVDFAKAWRDESPDDKNVYPSVPADAQHPCARLRSKSTSLLESAQSLCSILRSGSSTFSACHSRVNSSVYESMCMKDMCTCLLNG-NATVCNEQRCNSATLYSRACTQQGIVINWRQSNLCPAPKCSNGKVFSECSHDCNQKCGTNTVDDDCGTHCVDGCFCPSGRFWDGHKCVIRDNCPCNRA-GDSRS-YPVGSKYSHKCEQCVCDRGGSWKCSPTDECYGYCTVSGDPTYRTFDGRHFSFEGHCEYIMMMPQRSAAESLEYPVAVYVENKYCDSVTDVLCAKLVTLQMGSGEKQHTIRLESLSRVKVDSAYVSLPVKVHD---ITIRLVSTSMLRVETNKGFDLLWNGRTRIQIRLSKAFRNKVTGLCGNFNNDMKDDTISPTGIDVKDIRQFAKSWKTNPTCDAKTRFVYNGACATSKEFDSYATSVCNKLYTESVFKACHSRVDPKWALEQCKHDVCSCGSRRKGVMSQCECTAFASYARSCALDGKVLNWRSSSLCPVKCPPTMEYQECGSNCGKTCKRVEASPCIEECVEGCQCPSGQALDEEKGTCVPRNQCKCVYNGVSYTNGQVRKDKCNNCTCTDGNWECTNLTCTDSNTCPAGMVWSECSDCQRSCENINIECPKSSCKSGGCVCPKGQVLHQGKCVDKGNCPCAMAGKVYAENSVVPRGSTRCYNYCMCRKGSWQCTN-NKCPSTCRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMSCTKSVKITYRDVVVHLVRGTDPIISRNLYWPVTLPKAKYEIYPAGFYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIAPCSS-ERKRWAEKKCAILRSSEFTSCHSKVEVNEFYDKCVMDTCAC-KLDDCLCYCTAVSQYVLRCNEMGVKIKWRNPDDCPVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLE---DGVCKKREQCSCVV--GGKKIAYGKKIIYKCQECTCTAGSLECKPYYLGDCATFPTTVPPTTTPFCTGPGLIICRGERKYCAKRCDGNRECMYGDDEQCC 1503          
BLAST of Hemocytin vs. TrEMBL
Match: A0A267GUZ7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026350g1 PE=4 SV=1)

HSP 1 Score: 897.501 bits (2318), Expect = 0.000e+0
Identity = 512/1492 (34.32%), Postives = 765/1492 (51.27%), Query Frame = 2
Query:  125 LAEDNNRFCGESFVREPFQACDDAKESLKDNDQLVTVGEQCQIKRYKRKCCNGWTGTDCQ-------------------------------FPICQQLCKNGGRCIEPDRCQCDPKFSGADC-SFRIADEKPCIQGC-IRGKCKNGDCLCDSGYEGERCDRAFCQYGCGT-GICVEPNVCQCPENFRGRNCET--FFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQH----KNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDL---CTGL---NKDLVTTANNMCQDVFGGD--LSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWR-SQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGN--QVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWAT-AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP-FNSCHMSVDPNPFIQQCEHDICLCGGNEK---DNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKS-GCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPT-EYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRP-----------DPKCITSTTSYCIGSKLTKCENGVCARICNGIPECSDGSDEANC 4390
            ++   N FC  +   E +  C DAKE      +  + G  CQ++   R CC+GW G+ C                                 P+C + C NGG C+ P+ C+C   F G  C S        C+ GC   GKC  G C+C+ GY+G++C+   C+  C + G C+ PN C+CP+ + G  C+    +   +T+ + +  V NT+Y++  +CS  GG +  TFDG   + P  GS +L+ DC++ +  Y+++FN S NC       C  SL I      V  +   +   N     + +I       N  +   ++G+ +L I YDG RN+ ++AP TM ++VCGLCG FDG ++  ++F ++  + +  V +F K W++  P D N Y +   D    C  L   +  L+ +A ++C  +  G    S C + +    Y+S+C  ++C CL  G N +VC    C+  +  S  CT  G +INWR S LC   +C   K +SEC   C+Q C     D++C + C  GCFCP  RFW+G  CV +  CPC R  G+S   Y  G  +   CE C C +GG + C+    C G C +SGDP Y TFD RH   EG C Y M+  + S   +    + ++V+N +C    D  C K ++LQ G  +    I+L +   + V+     LP++++D   +TI+ V+   + +E+  G  +LW+ +T+I+I L + ++++V GLCGN+N + +DD    +G    +  + A SW T   C +     Y G CA S E++ +A   C +L  E  F +CH  VDP   ++QC+HD+C CG   K     C C + ASY R+C  +G  L WRSSSLC  KCP  MEY EC + C  +C  +  + C  EC++GCQC S    D     CV  +QC+C +    Y +G  RK+KCN+C CT+G W CT   C++   CP G  W EC  C ++CEN +  C +  CKS GC CP G +L    CV K  CPC  + K Y   SV+  G T C + C C +G W C    KC  +C+ WGD HY+TFDG+Y+DF+  CSYV+ +  CG   G F++  ENI+CG +G SCTKS+   YR+ VV L+RG  P +  N  +P    K +         L   T+  I + WD  + + + L P +  +VCGLCGNF+   ++D +++ G    + +AF DSWK R  CP     P    S+ ER+ WA+K C  +++ +F  C   V+   +Y KC+ DTC+C +  DC C CTA+S +   C + G+   WR+ + CPVMCP    +K C + CP++C   +   T+  +C   CVEGC CP  E++E      C K  +C C +    KK   G+     C  C C   + +C+P                T+      G  + + E   CA+ C+G  EC  G DE  C
Sbjct:   29 MSSSKNHFCNSTRT-EDYVKCSDAKEKGYVVLKTHSDGVNCQVQIKYRTCCSGWIGSSCSEAVCSPKCDNGMCVAPNSCNCSSGWSGATCNKPVCAKECANGGICVAPNTCRCAAGFDGEQCQSVATTVSSVCVGGCGSNGKCVRGRCVCNLGYKGDKCELPLCKNNCNSVGTCLAPNKCRCPDGYHGDLCQVSALYASDSTAFVAVRAVNNTRYRNSAVCSAFGGKHFLTFDGKYFDFPAHGSYVLLQDCVNSEAKYQVYFNGSRNCADAAQTRCQVSLKIVAGPAKVEIMPGGSVFVNEKPVTLPTIAGIVSVSNTANHITVRGLDDLAITYDGDRNINVYAPKTMSRTVCGLCGRFDGKAA--NDFTDLMNKPLTRVVDFAKAWRDESPDDKNVYPSVPADAQHPCARLRSKSTSLLESAQSLCSILRSGSSTFSACHSRVNSSVYESMCMKDMCTCLLNG-NATVCNEQRCNSATLYSRACTQQGIVINWRQSNLCPAPKCSNGKVFSECSHDCNQKCGTNTVDDDCGTHCVDGCFCPSGRFWDGHKCVIRDNCPCNRA-GDSRS-YPVGSKYSHKCEQCVCDRGGSWKCSPTDECYGYCTVSGDPTYRTFDGRHFSFEGHCEYIMMMPQRSAAESLEYPVAVYVENKYCDSVTDVLCAKLVTLQMGSGEKQHTIRLESLSRVKVDSAYVSLPVKVHD---ITIRLVSTSMLRVETNKGFDLLWNGRTRIQIRLSKAFRNKVTGLCGNFNNDMKDDTISPTGIDVKDIRQFAKSWKTNPTCDAKTRFVYNGACATSKEFDSYATSVCNKLYTESVFKACHSRVDPKWALEQCKHDVCSCGSRRKGVMSQCECTAFASYARSCALDGKVLNWRSSSLCPVKCPPTMEYQECGSNCGKTCKRVEASPCIEECVEGCQCPSGQALDEEKGTCVPRNQCKCVYNGVSYTNGQVRKDKCNNCTCTDGNWECTNLTCTDSNTCPAGMVWSECSDCQRSCENINIECPKSSCKSGGCVCPKGQVLHQGKCVDKGNCPCAMAGKVYAENSVVPRGSTRCYNYCMCRKGSWQCTN-NKCPSTCRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMSCTKSVKITYRDVVVHLVRGTDPIISRNLYWPVTLPKAKYEIYPAGFYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIAPCSS-ERKRWAEKKCAILRSSEFTSCHSKVEVNEFYDKCVMDTCAC-KLDDCLCYCTAVSQYVLRCNEMGVKIKWRNPDDCPVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLE---DGVCKKREQCSCVV--GGKKIAYGKKIIYKCQECTCTAGSLECKPYYLGDCATFPTTVPPTTTPFCTGPGLIICRGERKYCAKRCDGNRECMYGDDEQCC 1503          
BLAST of Hemocytin vs. TrEMBL
Match: A0A1I8G0U9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 882.863 bits (2280), Expect = 0.000e+0
Identity = 510/1495 (34.11%), Postives = 762/1495 (50.97%), Query Frame = 2
Query:  125 LAEDNNRFCGESFVREPFQACDDAKESLKDNDQLVTVGEQCQIKRYKRKCCNGWTGTDCQ-------------------------------FPICQQLCKNGGRCIEPDRCQCDPKFSGADC-SFRIADEKPCIQGC-IRGKCKNGDCLCDSGYEGERCDRAFCQYGCGT-GICVEPNVCQCPENFRGRNCE--TFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQH----KNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDL---CTGL---NKDLVTTANNMCQDVFGGD--LSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWR-SQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGN--QVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWAT-AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP-FNSCHMSVDPNPFIQQCEHDICLCGGNEK---DNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKS-GCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGV---RPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPT-EYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRP-----------DPKCITSTTSYCIGSKLTKCENGVCARICNGIPECSDGSDEANC 4390
            ++   N FC  +   E +  C DAKE      +  + G  CQ++   R CC+GW G+ C                                 P+C + C NGG C+ P+ C+C   F G  C S        C+ GC   GKC  G C+C+ GY+G++C+   C+  C + G C+ PN C+CP+ + G  C+    +   +T+ + +  V NT+Y++  +CS  GG +  TFDG   + P  GS +L+ DC++ +  Y+++FN S NC       C  SL I      V  +   +   N     + +I       N  +   ++G+ +L I YDG RN+ ++AP TM ++VCGLCG FDG ++  ++F ++  + +  V +F K W++  P D N Y +   D    C  L   +  L+ +A ++C  +  G    S C + +    Y+S+C  ++C CL  G N +VC    C+  +  S  CT  G +INWR S LC   +C   K +SEC   C+Q C     D++C + C  GCFCP  RFW+G  CV +  CPC R  G+S   Y  G  +   CE C C +GG + C+    C G C +SGDP Y TFD RH   EG C Y M+  + S   +    + ++V+N +C    D  C K ++LQ G  +    I+L +   + V+     LP++++D   +TI+ V+   + +E+  G  +LW+ +T+I+I L + ++++V GLCGN+N + +DD    +G    +  + A SW T   C +     Y G CA S E++ +A   C +L  E  F +CH  VDP   ++QC+HD+C CG   K     C C + ASY R+C  +G  L WRSSSLC  KCP  MEY EC + C  +C  +  + C  EC++GCQC S    D     CV  +QC+C +    Y +G  RK+KCN+C CT+G W CT   C++   CP G  W EC  C ++CEN +  C +  CKS GC CP G +L    CV K  CPC  + K Y   SV+  G T C + C C +G W C    KC  +C+ WGD HY+TFDG+Y+DF+  CSYV+ +  CG   G F++  ENI+CG +G SCTKS+   YR+ VV L + +    P   + E YP                L   T+  I + WD  + + + L P +  +VCGLCGNF+   ++D +++ G    + +AF DSWK R  CP     P    S+ ER+ WA+K C  +++ +F  C   V+   +Y KC+ DTC+C +  DC C CTA+S +   C + G+   WR+ + CPVMCP    +K C + CP++C   +   T+  +C   CVEGC CP  E++E      C K  +C C +    KK   G+     C  C C   + +C+P                T+      G  + + E   CA+ C+G  EC  G DE  C
Sbjct:   29 MSSSKNHFCNSTRT-EDYVKCSDAKEKGYVVLKTHSDGVNCQVQIKYRTCCSGWIGSSCSEAVCSPKCDNGMCVAPNSCNCSSGWSGATCNKPVCAKECANGGICVAPNTCRCAAGFDGEQCQSVATTVSSVCVGGCGSNGKCVRGRCVCNLGYKGDKCELPLCKNNCNSVGTCLAPNKCRCPDGYHGDLCQVSALYASDSTAFVAVRAVNNTRYRNSAVCSAFGGKHFLTFDGKYFDFPAHGSYVLLQDCVNSEAKYQVYFNGSRNCADAAQTRCQVSLKIVAGPAKVEIMPGGSVFVNEKPVTLPTIAGIVSVSNTANHITVRGLDDLAITYDGDRNINVYAPKTMSRTVCGLCGRFDGKAA--NDFTDLMNKPLTRVVDFAKAWRDESPDDKNVYPSVPADAQHPCARLRSKSTSLLESAQSLCSILRSGSSTFSACHSRVNSSVYESMCMKDMCTCLLNG-NATVCNEQRCNSATLYSRACTQQGIVINWRQSNLCPAPKCSNGKVFSECSHDCNQKCGTNTVDDDCGTHCVDGCFCPSGRFWDGHKCVIRDNCPCNRA-GDSRS-YPVGSKYSHKCEQCVCDRGGSWKCSPTDECYGYCTVSGDPTYRTFDGRHFSFEGHCEYIMMMPQRSAAESLEYPVAVYVENKYCDSVTDVLCAKLVTLQMGSGEKQHTIRLESLSRVKVDSAYVSLPVKVHD---ITIRLVSTSMLRVETNKGFDLLWNGRTRIQIRLSKAFRNKVTGLCGNFNNDMKDDTISPTGIDVKDIRQFAKSWKTNPTCDAKTRFVYNGACATSKEFDSYATSVCNKLYTESVFKACHSRVDPKWALEQCKHDVCSCGSRRKGVMSQCECTAFASYARSCALDGKVLNWRSSSLCPVKCPPTMEYQECGSNCGKTCKRVEASPCIEECVEGCQCPSGQALDEEKGTCVPRNQCKCVYNGVSYTNGQVRKDKCNNCTCTDGNWECTNLTCTDSNTCPAGMVWSECSDCQRSCENINIECPKSSCKSGGCVCPKGQVLHQGKCVDKGNCPCAMAGKVYAENSVVPRGSTRCYNYCMCRKGSWQCTN-NKCPSTCRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMSCTKSVKITYRDVVVHLPKPLLAGHPAKAKYEIYPAG------------FYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIAPCSS-ERKRWAEKKCAILRSSEFTSCHSKVEVNEFYDKCVMDTCAC-KLDDCLCYCTAVSQYVLRCNEMGVKIKWRNPDDCPVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLE---DGVCKKREQCSCVV--GGKKIAYGKKIIYKCQECTCTAGSLECKPYYLGDCATFPTTVPPTTTPFCTGPGLIICRGERKYCAKRCDGNRECMYGDDEQCC 1494          
BLAST of Hemocytin vs. TrEMBL
Match: A0A1I8GY38 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 508/1492 (34.05%), Postives = 758/1492 (50.80%), Query Frame = 2
Query:  125 LAEDNNRFCGESFVREPFQACDDAKESLKDNDQLVTVGEQCQIKRYKRKCCNGWTGTDCQ-------------------------------FPICQQLCKNGGRCIEPDRCQCDPKFSGADC-SFRIADEKPCIQGC-IRGKCKNGDCLCDSGYEGERCDRAFCQYGCGT-GICVEPNVCQCPENFRGRNCE--TFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQH----KNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDL---CTGL---NKDLVTTANNMCQDVFGGD--LSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWR-SQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGN--QVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWAT-AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP-FNSCHMSVDPNPFIQQCEHDICLCGGNEK---DNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKS-GCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPT-EYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRP-----------DPKCITSTTSYCIGSKLTKCENGVCARICNGIPECSDGSDEANC 4390
            ++   N FC  +   E +  C DAKE      +  + G  CQ++   R CC+GW G+ C                                 P+C + C NGG C+ P+ C+C   F G  C S        C+ GC   GKC  G C+C+ GY+G++C+   C+  C + G C+ PN C+CP+ + G  C+    +   +T+ + +  V NT+Y++  +CS  GG +  TFDG   + P  GS +L+ DC++ +  Y+++FN S NC       C  SL I      V  +   +   N     + +I       N  +   ++G+ +L I YDG RN+ ++AP TM ++VCGLCG FDG ++  ++F ++  + + +V +F K W++  P D N Y +   D    C  L   +  L+ +A ++C  +  G    S C + +    Y+S+C  ++C CL  G N +VC    C+  +  S  CT  G +INWR S LC   +C   K +SEC   C+Q C     D++C + C  GCFCP  RFW+G  CV +  CPC R  G+S   Y  G  +   CE C C +GG + C+    C G C +SGDP Y TFD RH   EG C Y M+  + S   +    + ++V+N +C    D  C K ++LQ G  +    I+L +   + V+     LP++++D   +TI+ V+   + +E+  G  +L          L + ++++V GLCGN+N + +DD    +G    +  + A SW T   C +     Y G CA S E++ +A   C +L  E  F +CH  VDP   ++QC+HD+C CG   K     C C + ASY R+C  +G  L WRSSSLC  KCP  MEY EC + C  +C  +  + C  EC++GCQC S    D     CV  +QC+C +    Y +G  RK+KCN+C CT+G W CT   C++   CP G  W EC  C ++CEN +  C +  CKS GC CP G +L    CV K  CPC  + K Y   SV+  G T C + C C +G W C    KC  +C+ WGD HY+TFDG+Y+DF+  CSYV+ +  CG   G F++  ENI+CG +G SCTKS+   YR+ VV L+RG  P +  N  +P    K +         L   T+  I + WD  + + + L P +  +VCGLCGNF+   ++D +++ G    + +AF DSWK R  CP     P    S+ ER+ WA+K C  +++ +F  C   V+   +Y KC+ DTC+C +  DC C CTA+S +   C + G+   WR+ + CPVMCP    +K C + CP++C   +   T+  +C   CVEGC CP  E++E      C K  +C C +    KK   G+     C  C C   + +C+P                T+      G  + + E   CA+ C+G  EC  G DE  C
Sbjct:   29 MSSSKNHFCNSTRT-EDYVKCSDAKEKGYVVLKTHSDGVNCQVQIKYRTCCSGWIGSSCSEAVCSPKCDNGMCVAPNSCNCSSGWSGATCNKPVCAKECANGGICVAPNTCRCAAGFDGEQCQSVATTVSSVCVGGCGSNGKCVRGRCVCNLGYKGDKCELPLCKNNCNSVGTCLAPNKCRCPDGYHGDLCQVSALYASDSTAFVAVRAVNNTRYRNSAVCSAFGGKHFLTFDGKYFDFPAHGSYVLLQDCVNSEAKYQVYFNGSRNCADAAQTRCQVSLKIVAGPAKVEIMPGGSVFVNEKPVTLPTIAGIVSVSNTANHITVRGLDDLAITYDGDRNINVYAPKTMSRTVCGLCGRFDGKAA--NDFTDLMNKPLTHVVDFAKAWRDESPDDKNVYPSVPADAQHPCARLRSKSTSLLESAQSLCSILRSGSSTFSACHSRVNSSVYESMCMKDMCTCLLNG-NATVCNEQRCNSATLYSRACTQQGIVINWRQSNLCPAPKCSNGKVFSECSHDCNQKCGTNTVDDDCGTHCVDGCFCPSGRFWDGHKCVIRDNCPCNRA-GDSRS-YPVGSKYSHKCEQCVCDRGGSWKCSPTDECYGYCTVSGDPTYRTFDGRHFSFEGHCEYIMMMPQRSAAESLEYPVAVYVENKYCDSVTDVLCAKLVTLQMGSGEKQHTIRLESLSRVKVDSAYVSLPVKVHD---ITIRLVSTSMLRVETNKGFDLLSD--------LSKAFRNKVTGLCGNFNNDMKDDTISPTGIDVKDIRQFAKSWKTNPTCDAKTRFVYNGACATSKEFDSYATSVCNKLYTESVFKACHSRVDPKWALEQCKHDVCSCGSRRKGVMSQCECTAFASYARSCALDGKVLNWRSSSLCPVKCPPTMEYQECGSNCGKTCKRVEASPCIEECVEGCQCPSGQALDEEKGTCVPRNQCKCVYNGVSYTNGQVRKDKCNNCTCTDGNWECTNLTCTDSNTCPAGMVWSECSDCQRSCENINIECPKSSCKSGGCVCPKGQVLHQGKCVDKGNCPCAMAGKVYAENSVVPRGSTRCYNYCMCRKGSWQCTN-NKCPSTCRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMSCTKSVKITYRDVVVHLVRGTDPIISRNLYWPVTLPKAKYEIYPAGFYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIAPCSS-ERKRWAEKKCAILRSSEFTSCHSKVEVNEFYDKCVMDTCAC-KLDDCLCYCTAVSQYVLRCNEMGVKIKWRNPDDCPVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLE---DGVCKKREQCSCVV--GGKKIAYGKKIIYKCQECTCTAGSLECKPYYLGDCATFPTTVPPTTTPFCTGPGLIICRGERKYCAKRCDGNRECMYGDDEQCC 1495          
BLAST of Hemocytin vs. TrEMBL
Match: A0A0L8GSF5 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22028776mg PE=4 SV=1)

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 343/975 (35.18%), Postives = 520/975 (53.33%), Query Frame = 2
Query:  899 SNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDL---CTGLNKDLVTTANNMCQ--DVFGGD---LSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQ-LCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTY--CVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWAT-AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE-PFNSCHMSVDPNPFIQQCEHDICLCGGNEKD--NCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNK---TCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAG--NYENNILAFVDSWKSRVNCPAA-KDVPDMCKSNHERQAWAD 3757
            SN S  S  + +  ++   I ++  +KGI +L ILYDG  +V+ FAP  M   +CGLCG FDGN +  +EF N   + +    +F   W   DP++  +  +   D    C  L       A+N+     VF  D     +C + +P   Y ++C  E+C CL  G ++  C++  C + +  +  C+ +GK++ WRS   C P  CP N  + EC  +C Q+C     +  C+ FC  GCFC +   W+ +   CV +  CPC R  GN    Y  G   K  CE C C++GG +NC   + C G C +SGDPH+ TFD R  + EG C Y +   +    G +   +W++N +C K  DA CTK ++++FG  +N+  I+L + K + VN +   LP + +D   + I++V++  + + +  G+ +LW  +T+I + L   YQ +V G+CGN+N +  DD    +GE   N  + A+ W T   C S  S  YLG CA S +YEK A E C ++  E  F SCH +V+P+ F+ QC+HD+C+CG    D  +C C + A+Y RAC+  G+TL WR S+LC   C  GM Y EC   C  +C  +   NC  ECI+GC C     YD   N CV + +C+C + N YY   S+R+E CN+C C +G W CT   C+    C     W  C  C +TC++ +  C+    + GC CP+G +  NK    CV   +CPC      Y N   I     +C ++C C  G W C  E+ C  +C+++GD HY TFDGK ++F   C+Y++    C +  G F++ TEN+ CG  G SCTKS+ F   + ++ L RG       N   P+       + +++ + ++I     I L WDK + + I L  +Y  +VCGLCGN+DQ  NNDF+ K+    +  + LAF +SW+ R +C    K++P+ C  N  RQ+WA+
Sbjct:   12 SNGSVISLPHQVGDLELSEIANYTVVKGIDDLIILYDGLSSVYAFAPPQMLGKLCGLCGQFDGNKT--NEFVNYVRKPVATKADFSNVWL--DPMEQRSIPSVKEDSVHPCVRLRNKFSKAADNVEAFCSVFSLDYVVFQKCHSTVPPDEYIAMCSREMCTCL-LGNSLQECSHKRCEVATQYARACSHHGKIMKWRSNTFCPPHTCPKNMVFKECSKNCRQSCGSEGFEAECEEFCVDGCFCKEGTLWDTSTSSCVHRGDCPCYR--GNDQRAYPIGTLEKSGCESCTCAEGGRWNCIMSKDCPGICTLSGDPHFQTFDGRQFFFEGECEYVLSQYQAK-DGGESFAVWIENKYCNKITDAVCTKVVTIKFGSKNNTQIIRLRSFK-VEVNSMSIGLPYKDDD---VVIRKVSNILIRLTASIGLDVLWDGRTRIYLKLSNKYQGKVTGMCGNFNNDVNDDNLTPNGENEFNVTKFAMEWKTNTACNSRPSTIYLGACALSKQYEKLATEVCNKMWKEESFKSCHFAVNPSKFVDQCKHDVCMCGQRHGDPRDCECAAFATYARACVLKGITLNWRKSNLCFINCTKGMIYQECGYNCDQTCRGIQPQNCEEECIEGCNCPPGEKYDEEDNVCVPVEECKCYYRNEYYEPKSSRQELCNECICIDGHWQCTTESCNVHDLCSGDMVWSNCSDCIRTCDSLNVDCVATCSQQGCICPEGKVQLNKDSQNCVEPSECPCNHLGYQYKNGDKI---KKDC-NQCYCKHGTWKC-TERHCAATCEAFGDPHYVTFDGKPYNFQGACAYIVAQDFCNETGGTFQVTTENVPCGTLGYSCTKSVKFLIYDTIINLARGTNITYTINNKAPEGTPMANFTIKEVGTYIMIEAHG-ITLVWDKSMRLYITLENKYMGRVCGLCGNYDQIANNDFRDKSSFPEHTQSPLAFANSWRVRESCAIVDKELPNPCVLNSHRQSWAE 968          

HSP 2 Score: 161.77 bits (408), Expect = 3.276e-36
Identity = 151/479 (31.52%), Postives = 220/479 (45.93%), Query Frame = 2
Query: 2888 TFCPP-----GKEWKECG-HCDQTCENQDGFCLE--KGCKSGCFCPDGYLL--SNKTCVPKHKCPCLWSD--KSYLNQSVIYTGPTNCLSKCTCNEG-KWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTS--CTK--SIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIIL--YWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDM--CKSNHERQAWADKMCGTM-KNVKFADCQKVVDTELYYQKCLSDTCSC-DRGGDC-ECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKC 4252
            TFCPP        +KEC  +C Q+C   +GF  E  + C  GCFC +G L   S  +CV +  CPC   +  ++Y   ++  +G       CTC EG +W C   + C G C   GD H++TFDG+ F F  +C YV+       G   F +  EN  C NK T   CTK  +I F  +N   Q+IR    KV  N        K        VS ++I   + I L   WD    I + L  +YQ +V G+CGNF+ ++N+D  +  G  E N+  F   WK+   C +      +  C  + + +  A ++C  M K   F  C   V+   +  +C  D C C  R GD  +C C A + +  AC   GI  +WR + LC + C     ++ C  +C + C          +NC + C+EGC+CP      E  N CV   EC C   N  + Y P     E C  C+C + +++C
Sbjct:  206 TFCPPHTCPKNMVFKECSKNCRQSC-GSEGFEAECEEFCVDGCFCKEGTLWDTSTSSCVHRGDCPCYRGNDQRAYPIGTLEKSG----CESCTCAEGGRWNCIMSKDCPGICTLSGDPHFQTFDGRQFFFEGECEYVLSQYQAKDGGESFAVWIENKYC-NKITDAVCTKVVTIKFGSKNNT-QIIRLRSFKVEVNSMSIGLPYKDDDVVIRKVSNILIRLTASIGLDVLWDGRTRIYLKLSNKYQGKVTGMCGNFNNDVNDDNLTPNGENEFNVTKFAMEWKTNTACNSRPSTIYLGACALSKQYEKLATEVCNKMWKEESFKSCHFAVNPSKFVDQCKHDVCMCGQRHGDPRDCECAAFATYARACVLKGITLNWRKSNLCFINCTKGMIYQECGYNCDQTC-----RGIQPQNCEEECIEGCNCPPGEKYDEEDNVCVPVEECKCYYRN--EYYEPKSSRQELCNECICIDGHWQC 670          

HSP 3 Score: 91.2781 bits (225), Expect = 1.653e-14
Identity = 70/277 (25.27%), Postives = 111/277 (40.07%), Query Frame = 2
Query: 3452 GRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSW---KSRVNCPAAKD--VPDMCKSNHERQAWADKMCG-----TMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDC-EC---LCTALSAFYSACKKYGIDYSWRSNELCPV-MCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNE 4237
            G +   ++ +  ++    D+I+ +D   S+    PPQ   ++CGLCG FD N  N+F +           F + W     + + P+ K+  V    +  ++    AD +       ++  V F  C   V  + Y   C  + C+C  G    EC    C   + +  AC  +G    WRSN  CP   CP    FK C  +C + C            C + CV+GC C    +    ++ CV   +C C   N  + Y  G +    C  C C E
Sbjct:   24 GDLELSEIANYTVVKGIDDLIILYDGLSSVYAFAPPQMLGKLCGLCGQFDGNKTNEFVNYVRKPVATKADFSNVWLDPMEQRSIPSVKEDSVHPCVRLRNKFSKAADNVEAFCSVFSLDYVVFQKCHSTVPPDEYIAMCSREMCTCLLGNSLQECSHKRCEVATQYARACSHHGKIMKWRSNTFCPPHTCPKNMVFKECSKNCRQSCGSEGFE----AECEEFCVDGCFCKEGTLWDTSTSSCVHRGDCPCYRGNDQRAYPIGTLEKSGCESCTCAE 296          
BLAST of Hemocytin vs. Ensembl Cavefish
Match: vwf (von Willebrand factor [Source:NCBI gene;Acc:103041546])

HSP 1 Score: 485.337 bits (1248), Expect = 3.751e-140
Identity = 362/1260 (28.73%), Postives = 565/1260 (44.84%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLG-LSNSSTNSNRNYISSIQHKNIGDFNQIKGIGE---LEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLC--TGLN-KDLVTTANNM-CQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLI-NWRSQ-LCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFS--LTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDC-----SNVTF-------------CPPGKEWKECG-------HCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQ---LIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKT---------FKTCINDCPKKCFKSNLNNTVLENCAKNCVEGC--SCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTEN-----CLICVCNENNFKCRPDPKCITSTT 4285
            CS+ G  +V TFDG+  E P   S  L  DC  R  ++ I  + S+    +  V   T  + ET    ++  G LS  +      Y SS       +   ++   E     I  D   N+ +          CGLCG +  NS  + E+    G   E+  +F   W      +     T     C  TG + +DL++    +    VF   L    ++    + ++C S++CHC++  + +       C      +  C  +G ++ NW +Q  C P+ CP   +YSEC  +CS +C+ L   E C+  C  GC C   +  +G  CV   QC C          Y  G +  +DC  C C + G + C     C G CV+SG  HY TFD +     G C Y +           +    +    C    DA CT+S++L+F +  N T ++L     + V+ +  ++PL IN  LR  +Q     +V +   + +++ W  + ++ + L   Y  ++ GLCGNYNGN  DD   + G + T       +W   AEC + +       C+ + +  +FA+E C  LL   F  CH  V+P P+++ C +D+C C   ++  C C ++++Y  AC   G+ + WR    C+  CP    Y  C ++C+ +C S  L  + C + C +GC C   + Y T   +CV   QC C ++   Y       +  + C C NG   C+ ++      S++ F             CP   +   C         C +TC+N D  C+ +GC SGC CP G +   + CVP  +CPC  ++ +Y     I     +C + C C   +W C Q + C G C + GD+HY +FDG  F F   C Y++    C    G F+++ EN  CG  G  C KSI  +Y   ++         VME E     +   + +  ++V      I+    +I + WD G  I + +  QY+ +VCGLCGNFD + NND  S     E + L F +SWK + +C  A  VP  C ++  +Q   ++ C  + +  F +C  VVD E Y++ C  DTCSC   GDC C C A++A+   C + G+   WRSN+LCP+ C              F  C   CPK C      +    +C   C+EGC  SCP   I  E   +CV+ +EC   + N ++  +  +I   +     C IC C EN   C P P    ++T
Sbjct:   28 CSLFGRHHVHTFDGVIYEFPGDCSYKLAGDCHHR--TFSILGDLSHG--RRKGV---TVFLGETFELHLSVGGVLSQGAERLPLPYASSSVFAGF-ELGSVRLWSEEFGFSIRIDPAHNIQLTLSKHHANHTCGLCGNY--NSVPTDEYTAQEGFLTEDPYDFANSWAMNGASEACKRVTPPAQTCNNTGASARDLMSRCETLRTSPVF---LHCAHLVDTDAFAAVCESDVCHCVDGQECV-------CQALLEYARTCASHGLVLPNWHTQSQCTPK-CPIGMQYSECSQACSTSCQSLNIHEVCREECVDGCSCAVGKVLDGDRCVEVSQCSCQHTGKR----YPPGSTISQDCNTCVC-RHGSWECTN-EECPGQCVVSGQSHYKTFDDKFFTFSGFCQYLLAKD----CQTNLFSAIIDTVQCADDQDAVCTRSVTLKFHELANQT-VRLKHGGVVSVDGLDVQMPL-INGLLR--VQSTVLSSVRLNYGDDLQLDWDGRGRVVLRLSPVYAGKMCGLCGNYNGNQGDDFLTAGGLVETRVEGFGNAWKMNAECDN-IQKQPSDPCSLNPKRVRFAEEACALLLSPKFEPCHHEVNPYPYLKNCRYDVCSCADGQE--CLCAAVSNYAAACSARGVLINWRGQGYCELTCPGNQVYEVCGSVCNQTCRSRSLPDSACRSMCEEGCFCPRGL-YLTDTGECVPPDQCSCHYDGEIYQPNDMFADHHSICYCENGSMRCSSSELPASVLSDLFFDEPPLSRERRSVSCPAPLQQLRCESVRDVGIECARTCQNLDLECVSQGCISGCVCPPGTVRHRRECVPPDQCPCFHNNHAYSPGQSIKI---DC-NTCVCGGRQWKCTQ-RVCDGVCHTVGDSHYISFDGLKFTFPGPCQYILAQDYCNGLDGTFRILVENSACGTIGHRCRKSISVFYMGGLI---------VMEQEEVKMKKPVMKETDVEIVRSGFYYIVLLGKNISITWDTGTRIILQISGQYRGKVCGLCGNFDGSQNNDLLSSNNQIEVDPLDFGNSWKVQPSCANAVQVPSQCSTDMSKQVTVEQSCRVLNSDLFRECNSVVDPEPYWEICTHDTCSCASVGDCACFCDAIAAYAHECAQKGVVVDWRSNDLCPLSCEELNKDAGVECMWRFNACDTACPKTC-----QHPEQLSCPIACLEGCHASCPQGQILDEVLRRCVEPSECQVCMHNGERISHGKQIILNHGDPHLCQICHCEENTLTCAPCPPSGPAST 1229          

HSP 2 Score: 161.77 bits (408), Expect = 4.301e-39
Identity = 115/374 (30.75%), Postives = 164/374 (43.85%), Query Frame = 2
Query: 1778 GTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW----ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP-FNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDPKCPNGMEYMECKNLCSVSCFSL-TQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDC 2878
            G C + G  H  TFD       G C Y +         ++   I    +H  +       K +++  G+T      +L  +   ++++   RLPL           E+    +  E + G  I       I++TL + + +   GLCGNYN    D+ T   G LT +  + A SW    A+  CK     +    C  +    +     C+ L   P F  C   VD + F   CE D+C C   ++  C C+++  Y R C  +GL L  W + S C PKCP GM+Y EC   CS SC SL     C  EC+DGC C    V D   ++CV +SQC C H    YP GST  + CN C C +G W CT  +C
Sbjct:   26 GRCSLFGRHHVHTFDGVIYEFPGDCSYKLAGD----CHHRTFSILGDLSHGRR-------KGVTVFLGET-----FELHLSVGGVLSQGAERLPLPYASSSVFAGFELGSVRLWSEEF-GFSIRIDPAHNIQLTLSKHHANHTCGLCGNYNSVPTDEYTAQEGFLTEDPYDFANSWAMNGASEACKRVTPPAQ--TCNNTGASARDLMSRCETLRTSPVFLHCAHLVDTDAFAAVCESDVCHCVDGQE--CVCQALLEYARTCASHGLVLPNWHTQSQCTPKCPIGMQYSECSQACSTSCQSLNIHEVCREECVDGCSCAVGKVLDG--DRCVEVSQCSCQHTGKRYPPGSTISQDCNTCVCRHGSWECTNEEC 376          

HSP 3 Score: 123.25 bits (308), Expect = 1.849e-27
Identity = 98/380 (25.79%), Postives = 166/380 (43.68%), Query Frame = 2
Query: 3176 GSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDV-PDMCKSNHERQAWADKM--CGTMKNVK-FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDY-SWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDP---KCITSTTSY 4291
            G C  +G  H  TFDG  ++F   CSY +   DC      F ++ +      KG +    +F     ++   + GV  +  E    P         F +L S  +   +    +  D   +I++ L   + N  CGLCGN++    +++ ++ G    +   F +SW       A K V P     N+   +  D M  C T++    F  C  +VDT+ +   C SD C C  G   EC+C AL  +   C  +G+   +W +   C   CP    +  C   C   C   N++    E C + CV+GCSC    +     ++CV+ ++C C+  ++ K+Y PG   +++C  CVC   +++C  +    +C+ S  S+
Sbjct:   26 GRCSLFGRHHVHTFDGVIYEFPGDCSYKLA-GDCHHRT--FSILGDLSHGRRKGVT----VFLGETFELHLSVGGVLSQGAERLPLPYASSSVFAGF-ELGSVRLWSEEFGFSIRIDPAHNIQLTLSKHHANHTCGLCGNYNSVPTDEYTAQEGFLTEDPYDFANSWAMNGASEACKRVTPPAQTCNNTGASARDLMSRCETLRTSPVFLHCAHLVDTDAFAAVCESDVCHCVDGQ--ECVCQALLEYARTCASHGLVLPNWHTQSQCTPKCPIGMQYSECSQACSTSCQSLNIH----EVCREECVDGCSCAVGKV--LDGDRCVEVSQCSCQ--HTGKRYPPGSTISQDCNTCVCRHGSWECTNEECPGQCVVSGQSH 387          

HSP 4 Score: 65.855 bits (159), Expect = 5.454e-10
Identity = 61/299 (20.40%), Postives = 113/299 (37.79%), Query Frame = 2
Query: 1772 CSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQ---IEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSC 2659
            C   C+ S   H  +F    + ++G+C Y ++ +  +       ++ +    C  S +  C KSL L+ G T     + L     + V+     +P +        I  + H   L     G  + +   +    I + L         G+CG+ + + +       G  +T+ +    +WA  EC    ++S   VC      E    + C+ L    F  CH  + P  +++ C+   C           C+ + +Y   C + G+ + WR++ LC       MEY  C+  C   C
Sbjct: 1955 CPCMCMGSSTSHVVSFGGTALKLKGACSYLLLHSGGT-------ELVLHTATCDSSPNQICMKSLELKEGGTS----VMLKDDMKVTVDGAVTAVPFRRGGVSVTQIGALLHQ--LRSETQGFTLTFTPHSNEFTISLDLTMITNTSTTGICGSCS-DDQAHLLLPDGSPSTDPDAYLQAWAVGECVWNKNVS---VC------EAGVAQGCELLASSVFGQCHAVLPPQDYVEMCKQLAC------HPTAMCDLITAYSSVCRQQGVCVNWRNADLCRKSLLFSMEYDACRTGCVEQC 2224          

HSP 5 Score: 55.8398 bits (133), Expect = 5.892e-7
Identity = 84/381 (22.05%), Postives = 148/381 (38.85%), Query Frame = 2
Query:  674 LCSIMGGSYVTTFDGISIENPLRGSNILVID-CLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLG----LSNSSTNSNRNYISSIQHKNI-GDFNQIKGIGE-LEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPN--TYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPREC-PANKE--------YSECGSSCSQNCEDLITDENCKSFCTAGCF--CPKDRFWNGTY--CVPKPQCPCIRKNGNSMVVYHQGMSFKRD---CEICECSK 1738
            +C  +G S+  +FDG+    P     IL  D C     ++RI   +S          C T       S SV ++G    +        +  +     + +   F  I  +G+ + I +D    + +      +  VCGLCG FDG  S +++  + N +   +  +F   WK    + P+            T ++K +  T    C+ +      +C +++   PY  IC  + C C + G     C  IA       +++C   G +++WRS    P  C   NK+        ++ C ++C + C+      +C   C  GC   CP+ +  +     CV   +C     NG  +    Q +    D   C+IC C +
Sbjct:  856 VCHTVGDSHYISFDGLKFTFPGPCQYILAQDYCNGLDGTFRILVENSA---------CGTIGHRCRKSISVFYMGGLIVMEQEEVKMKKPVMKETDVEIVRSGFYYIVLLGKNISITWDTGTRIILQISGQYRGKVCGLCGNFDG--SQNNDLLSSNNQIEVDPLDFGNSWK----VQPSCANAVQVPSQCSTDMSKQV--TVEQSCRVLNSDLFRECNSVVDPEPYWEICTHDTCSCASVGDCACFCDAIAA-----YAHECAQKGVVVDWRSNDLCPLSCEELNKDAGVECMWRFNACDTACPKTCQH-PEQLSCPIACLEGCHASCPQGQILDEVLRRCVEPSECQVCMHNGERISHGKQIILNHGDPHLCQICHCEE 1213          
BLAST of Hemocytin vs. Ensembl Cavefish
Match: scospondin (subcommissural organ spondin [Source:ZFIN;Acc:ZDB-GENE-051114-1])

HSP 1 Score: 465.307 bits (1196), Expect = 1.828e-133
Identity = 333/1176 (28.32%), Postives = 535/1176 (45.49%), Query Frame = 2
Query:  956 IGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMG----------SFKSY--QCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDEN--CKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVE-GSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWH-QKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQT------NCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQD---GFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENE-NYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCP--AAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAK-NCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNF-----KCRPDPKCITSTTSYCIGSKLTKCENGVCARICNGIPECSDGSDE 4381
            +GDF  ++    + I +D    V++        +  GLCG ++ N+    +F   +G   +    F   W+ PD        T G      L      T +     +  G  S C  L   P+     S   H ++ G  +  C  + CS+G          +  SY  +C     +++WR      R CP  + +S+C SSC  +C   +   +  C+  C  GC CP   + +   C+ K  CPC  +       Y +G + K+ C  C C +GG + C+  R C+  C I G  H +TFDK+   ++ G C + +V        ++ L + ++   C+      C + +S+    T   T + + +  ++++N  P  LP+   D   L ++      +L++ + G R+LWH   + + ITL   +  +V+GLCG    N  DD T   G++  +    A  +    C  + +++    C+   +  ++A+  C  L    F +CH  V+  P+++ C+ ++C C  +    C C  + +Y + C + G+ + WR+ + C  +C  G  Y EC   C  SC  L Q+        S  C+ GCQC   ++ D    QCV +  C C H  A +  GS+ +  CN C C  GVW+C+ + C  V  CP G      G C +TC + D     C E     GC CP+G +L    CV   +CPC  + + +     I        + C C + +W C Q Q C G+C + GD HY TFDG+ + F+  C Y++      +  G F +  EN+ CG+ G +CTKS+     N  + L+RG    V       PK      +    +   + + +   + L WD G+ + + L P  Q +V GLCGNFD +  NDF ++ G  E+    F +SWK   +CP  A +D+ D C  N  R  WA K C  +    F+ C   V  + YY  C+ D C CD GGDCECLCTA++A+   C + G+   WRS ELCP+ C     ++ C + C   C  S    +V  +C+  +CVEGC CP   +     + C+  +EC C+   S   +  G + T++C  C C+   +      C P   C+ S      GS+  +C   +   +C+   +C DGSDE
Sbjct:  289 LGDFVFVESGLGVRIKFDLSNTVYLTVNTEHFAATRGLCGVYNNNAE--DDFTGRSGSISQYAASFGNSWRVPD------QQTEGCSDAAELGHSCDVTGD---VSLRRGAESACHQLKESPF-----SHCHHQVDPGPYVDTCLYVYCSLGEKERVGAVCDTLASYARECAQQHIILSWRRPDLCERVCPGGQLFSDCVSSCPPSCSSALPPASGQCREECVGGCECPPGLYLHRGQCLRKDDCPCFHRR----HTYQEGDTIKQKCNTCVC-QGGQWQCSSER-CAAQCSIIGAMHISTFDKKSYNLQAGGCQFIVVED----FVDKKLAVTIRAGECVTGGRTGCPQEMSV----TALHTTVTVNSKGSVILNGQPEALPVLTAD---LAVRRATSSFLLVQVF-GARLLWHTDGSLVVITLEPGFAHKVRGLCGTLTWNQHDDFTTPEGDVENSVPSFAAKFNIGSCPLSSAVTS-DPCSTYTQRRQYAESVCAVLHSAVFQACHDVVEREPYVRMCQTEVCSCATHRL--CHCTVVTAYAQHCAQEGVLVSWRNHTFCPVQCSGGQVYQECGRACGGSCADLQQSWVCEENAGSRTCVPGCQCPEGLMQDDQ-GQCVPVDMCPCVHGGAVHQPGSSVQINCNTCVCGKGVWNCSDDPCPEVRECP-GSLIFSPGSCLRTCSSLDSPQALCTEP--IYGCVCPEGTVLLGDQCVTPDECPCHHNGRLFFTNDTISKD----CNTCVCKQRRWHCTQ-QLCAGTCVATGDPHYVTFDGRCYSFLGDCEYMLAQ----EMSGLFSVSAENVPCGSTGVTCTKSVTLTVGNTAIHLLRGKSVTVNGMPVTLPKSYSGSGLVLEKVGMFVSLSSRLGVTLLWDGGMRVYVRLEPHLQGRVGGLCGNFDGDTENDFTTRQGIVESTPELFGNSWKVSPSCPDVAEQDLRDPCVINPHRVTWAKKKCAVITQELFSLCHAEVPYQQYYDWCVFDACGCDSGGDCECLCTAIAAYAEECNRRGVYIHWRSQELCPLQCEDGLVYEPCGSTCSAVCPSS--TPSVHSHCSPLSCVEGCFCPHGTVRH--GDGCITPSECPCEWEGS--LFPAGAVLTQHCQNCTCSNGTWDCTGPACPPLVPCLESEFQCTRGSQ--RCIPSI--WLCDNEDDCGDGSDE 1404          

HSP 2 Score: 164.466 bits (415), Expect = 7.025e-40
Identity = 104/380 (27.37%), Postives = 162/380 (42.63%), Query Frame = 2
Query: 1775 SGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPL---RLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-----ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMEC---KNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCS 2881
            S TC+  G  HY +FD++H + +G C Y + ++            W      +     +C+K+L +  G       +  V   N+ +N     L +   +P+    ++I  +  D V +ES  G+RI +     + +T+   +    +GLCG YN N+EDD T  SG ++        SW      T  C     L +           + A+  C +L   PF+ CH  VDP P++  C +  C  G  E+    C+++ASY R C +  + L WR   LC+  CP G  + +C         S        C  EC+ GC+C   +       QC+    C C H    Y  G T K+KCN C C  G W C+   C+
Sbjct:  195 SATCMSWGGVHYRSFDRKHFHFQGGCTYVLASSTDG--------TWAVYISTVCDGGGHCSKALQMMLGRD-----LVSVNKSNMSLNG----LIIAQGEPVFQNGVSIHWLG-DFVFVESGLGVRIKFDLSNTVYLTVNTEHFAATRGLCGVYNNNAEDDFTGRSGSISQYAASFGNSWRVPDQQTEGCSDAAELGHSCDVTGDVSLRRGAESACHQLKESPFSHCHHQVDPGPYVDTCLYVYCSLGEKERVGAVCDTLASYARECAQQHIILSWRRPDLCERVCPGGQLFSDCVSSCPPSCSSALPPASGQCREECVGGCECPPGLYLHRG--QCLRKDDCPCFHRRHTYQEGDTIKQKCNTCVCQGGQWQCSSERCA 554          

HSP 3 Score: 113.235 bits (282), Expect = 2.652e-24
Identity = 85/379 (22.43%), Postives = 154/379 (40.63%), Query Frame = 2
Query: 3134 NEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWK----SRVNCPAAKDVPDMCKSNHE--RQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKC 4252
             +G  G     K   +C SWG  HY++FD K+F F   C+YV+  S  G    +   V +       G  C+K++       +V + +             +   +  +S   L   + + +   + + +D   ++ + +  ++     GLCG ++ N  +DF  ++G+      +F +SW+        C  A ++   C    +   +  A+  C  +K   F+ C   VD   Y   CL   CS         +C  L+++   C +  I  SWR  +LC  +CP  + F  C++        S+        C + CV GC CP       G  +C+++++C C   +    Y  G+   + C  CVC    ++C
Sbjct:  182 RKGHLGGLHNPKASATCMSWGGVHYRSFDRKHFHFQGGCTYVLASSTDGTWAVYISTVCDG------GGHCSKALQMMLGRDLVSVNKSNMSLNGLIIAQGEPVFQNGVSIHWLGDFVFVESGLGVRIKFDLSNTVYLTVNTEHFAATRGLCGVYNNNAEDDFTGRSGSISQYAASFGNSWRVPDQQTEGCSDAAELGHSCDVTGDVSLRRGAESACHQLKESPFSHCHHQVDPGPYVDTCLYVYCSLGEKERVGAVCDTLASYARECAQQHIILSWRRPDLCERVCPGGQLFSDCVSS--CPPSCSSALPPASGQCREECVGGCECPPGLYLHRG--QCLRKDDCPCF--HRRHTYQEGDTIKQKCNTCVCQGGQWQC 548          

HSP 4 Score: 95.1301 bits (235), Expect = 7.132e-19
Identity = 109/424 (25.71%), Postives = 164/424 (38.68%), Query Frame = 2
Query:  542 CVEPNVCQCPENFRGRNCETFFREPNTSNLKISDVINT---KYKDY----QLCS----IMGGSYVTTFDGISIENPLRGSNILVIDC--LSRKPSYRIFFNSSYNCP-TKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYI------SSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTI-LPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLI--TDENCKSF-CTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKG 1741
            CV P+ C C  N R      FF     +N  IS   NT   K + +    QLC+      G  +  TFDG             + DC  +  +    +F  S+ N P     V C  S+ +   + ++  L   + + N     +      S +  + +G F  +     + +L+DG   V++     ++  V GLCG FDG++   ++F    G        F   WK   P  P+      RD C  +N   VT A   C  +     S C   +P   Y   C  + C C + G    +C  IA       + +C   G  I+WRSQ   P +C     Y  CGS+CS  C         +C    C  GCFCP     +G  C+   +CPC  +      ++  G    + C+ C CS G
Sbjct:  964 CVTPDECPCHHNGR-----LFF-----TNDTISKDCNTCVCKQRRWHCTQQLCAGTCVATGDPHYVTFDGRCYS--------FLGDCEYMLAQEMSGLFSVSAENVPCGSTGVTCTKSVTLTVGNTAIHLLRGKSVTVNGMPVTLPKSYSGSGLVLEKVGMFVSLSSRLGVTLLWDGGMRVYVRLEPHLQGRVGGLCGNFDGDT--ENDFTTRQGIVESTPELFGNSWKV-SPSCPDVAEQDLRDPCV-INPHRVTWAKKKCAVITQELFSLCHAEVPYQQYYDWCVFDACGCDSGGDCECLCTAIA-----AYAEECNRRGVYIHWRSQELCPLQCEDGLVYEPCGSTCSAVCPSSTPSVHSHCSPLSCVEGCFCPHGTVRHGDGCITPSECPCEWEGS----LFPAGAVLTQHCQNCTCSNG 1356          

HSP 5 Score: 92.0485 bits (227), Expect = 6.663e-18
Identity = 99/398 (24.87%), Postives = 159/398 (39.95%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVI-DCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQ-----HKNIGDFNQIKGIGELEILY-DGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEF-MKYWKNPDPI------DPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDL----ITDENCKS-FCTAGCFCPKDRFWNGT-YCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCA-----KIRGCSGTCVIS 1795
            CSI+G  +++TFD  S      G   +V+ D + +K +  I    +  C T     C   + +     +VT     +   N     +  +       +    F  ++  G   + + DG   V    P    K V GLCG    N     +F    G+   +V  F  K+     P+      DP + YT  R     +   L +     C DV   +          PY  +C++E+C C        +C    C++ +  +  C   G L++WR+    P +C   + Y ECG +C  +C DL    + +EN  S  C  GC CP+    +    CVP   CPC+        V+  G S + +C  C C K GV+NC+     ++R C G+ + S
Sbjct:  557 CSIIGAMHISTFDKKSYNLQAGGCQFIVVEDFVDKKLAVTI---RAGECVTGGRTGCPQEMSVTALHTTVTVNSKGSVILNGQPEALPVLTADLAVRRATSSFLLVQVFGARLLWHTDGSLVVITLEPGFAHK-VRGLCGTLTWNQ--HDDFTTPEGDVENSVPSFAAKFNIGSCPLSSAVTSDPCSTYTQRRQYAESVCAVLHSAVFQACHDVVERE----------PYVRMCQTEVCSCATH----RLC---HCTVVTAYAQHCAQEGVLVSWRNHTFCPVQCSGGQVYQECGRACGGSCADLQQSWVCEENAGSRTCVPGCQCPEGLMQDDQGQCVPVDMCPCVHGG----AVHQPGSSVQINCNTCVCGK-GVWNCSDDPCPEVRECPGSLIFS 926          

HSP 6 Score: 56.9954 bits (136), Expect = 2.288e-7
Identity = 46/141 (32.62%), Postives = 66/141 (46.81%), Query Frame = 2
Query: 2489 CGGNEK---DNCACESMASYGRACMKNGLTLKWRSSSLCDPK-CPNGMEYMECKNLCSVSCFSLTQT---NCSTECIDGCQC-KSNMVYDTAVNQCVNISQCQCSHE-NAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSN 2884
            CGG       +C+     + GR C+     +K  ++  CD   CP G E++ C N C   C  L Q      STEC  GC+C +  M  D     CV + QC C       + +GS  +  CN+C+C +GV SC+ + CS 
Sbjct: 3859 CGGGRSIRTRSCSSPPPKNGGRKCVGEKNQVKPCNTKPCDTHGCPPGQEFVPCANQCPQRCSDLQQGIQCKASTECQPGCRCPRGEMQQD---GTCVKLWQCDCMDALGQSWAAGSQHQVDCNNCSCADGVLSCSNHTCSG 3996          

HSP 7 Score: 53.1434 bits (126), Expect = 3.502e-6
Identity = 46/144 (31.94%), Postives = 61/144 (42.36%), Query Frame = 2
Query: 2540 GRACMKNGLTLKWRSSSLCDPKCPNGMEYM---ECK---NLCSVSCFSLTQ-TNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSG-STRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCE 2947
            G +C+   +  +  +S  C   CP GM Y+   EC+     C   C   T    C+TEC DGC C   +      N CV +S C C H+ A YP G S   + CN  NC +   S    DC          EW     C +TC+
Sbjct: 2745 GNSCLGPHIQTRDCNSHPCSGSCPTGMSYLTKEECQAQGGACPRVCLDATTIVECATECYDGCYCSPGLYLFN--NTCVPLSNCPCYHKGALYPQGASVPHDACN--NCASLYQSVNSVDCG-------WSEWTSWSMCSRTCD 2877          
BLAST of Hemocytin vs. Ensembl Cavefish
Match: ENSAMXT00000041370.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:1809499:1822580:1 gene:ENSAMXG00000037407.1 transcript:ENSAMXT00000041370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 439.113 bits (1128), Expect = 3.706e-126
Identity = 359/1223 (29.35%), Postives = 553/1223 (45.22%), Query Frame = 2
Query:  671 QLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVT--FLGLSNSSTNSNRNYISS-IQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVF-GGDLSQCT-ILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWN---GTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTM----VATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNI-LVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIR--ILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRL--LYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WR-----SSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTN--CSTE--CIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKN----DCS------NVTFCPPGKEWKECGHCDQTCENQDGFCLE------KGCKSGCFCPDGYLLS-NKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGI--GFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC----PP---EKTFKTCINDCPKKCFKS----NLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKL 4165
            Q+CS  G  +  T+DG   + P   ++IL   C   + SY  F             N      +E    +++   + L  +  +    ++ S +  + I  +  +K    L  +++    + I          CGLCG F+G  + +   K+  G  + + T++   WK   P +      T  +    +N++      N CQ++F     S CT ++ V P+  +C  +LC C ++  +  +C  +A       S QC    G+  NWR++   P +CP +K Y ECGS C   C +    + C   C  GCFCP D  ++    T C+P   C CI         Y  G  +   C  C CS GG +NC   + C GTC + G  H  TFD +     G C Y +      T  +I G+ V         C  ++   C K+++L      N T + L    NI L+ K   RL    +D   ++I + +   ++I++  G+R  I      Q+ IT    +Q Q+ GLCGN+N    DD T   G       + A +W T      +  ++   C+ S E EK+A+ +C  L      F+SCH  ++P  + + C +D C C   + ++C C +++SY  AC   G+ +K WR     S +L    CPN M Y      C  SC SL+QT+  CS++   +DGC C     Y     +CV+ S C C   N     G T   +   C C  G  +C  +    +C+      N +   PG    EC    ++C+  D  C+       +GC SGC CP G +   N  C+ +  CPC+ +  SY     +     +C + CTC + +W C   Q C  +C  +GD HY TFD K + F   C Y +    C      G F+++TENI CG  GT+C+K+I  +  +  + L  G    V  +       +  +I  R + + L+I T++ ++L WD+  S+ I L P +  +VCGLCGNFD N NNDF +++     N L F +SWK    CP A  V + C  N  R+AWA + C  + +  F+ C   VD   +Y  C+ D C+CD GGDCEC CTA++A+  AC   G+  +WR+ ++CP+ C    PP   E  +K C   C K C       +L    +E C   C  G          E + KCV   EC C +
Sbjct:   27 QVCSTWGNYHFKTYDGDVFQLPSTCNHILTSQC---RGSYEAF-------------NIQLRRQVENGEPTISKITMKLDGTVVDVKAPHLGSGVFIETISSYIMVKATVGLTAMWNEDDALMIELNAKFINQTCGLCGDFNGVPTYNEFIKD--GAQL-SATDYGNLWKMDGPTE------TCEEQPERVNENC--GDENFCQNLFLSKAFSSCTDLVSVEPFTKVCIEDLCQCNSSAGSSCLCDTLA-----EYSRQCVHAGGQPANWRTEHFCPMKCPESKVYMECGSPCMDTCSNPERGQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCIHGGK----AYASGEGYSSSCRECTCS-GGQWNCVD-KQCPGTCSVEGGAHIITFDGKPYTFHGDCSYVLSKECTGTDFTILGDLV--------KCGITDSETCLKAVTLAL---SNGTNVSLSCELNINLLFKKIFRLTQTESD---ISIFKPSSFYIVIQTTIGLRLEIQLTPIMQVYITADPKFQGQMCGLCGNFNNIQADDFTTMGGLTEGTAVDFANTWKTRASCLDVQRTFENPCSLSTENEKYAQYWCSLLSDASGVFSSCHSEINPATY-KNCIYDTCNC--EKTEDCMCAALSSYVHACAAKGIYIKGWRDVACKSYTL---SCPNTMVYSYNMTSCGRSCRSLSQTDFSCSSQFVAVDGCGCAEG-TYLNEKEECVDPSGCPCYDSNTVIQPGETVSREGTTCTCKQGQLNCIGSGKVQECTSPMTYLNCSAAVPGSTGSECA---KSCKTLDMACVSYHIKYTRGCVSGCVCPSGLVSDDNGGCITEDLCPCVHNGASYKPGETVKE---DC-NTCTCKDRRWQCTTNQ-CSATCSIYGDGHYITFDDKRYVFNGNCEYTLAQDFCSSSNTNGTFRVITENIPCGTTGTTCSKAIKLFIGSNELVLSDGSYQVVQRDAG---QEIPYQI--RTMGNYLVIETNNGVVLIWDRKTSMYIKLTPDFNGRVCGLCGNFDGNANNDFTTRSQELVVNALDFGNSWKFSPTCPEAMVVQEPCAHNPYREAWAQRQCSIINSDVFSACHSKVDPASFYSACVRDACACDTGGDCECFCTAVAAYAEACNAVGVCVAWRTPKVCPLFCDYYNPPGECEWHYKPCGAPCMKTCRNPAGTCSLQLPAMEGCYPECPAGLP-----FFDEDTMKCVALEECGCYV 1172          

HSP 2 Score: 157.532 bits (397), Expect = 5.575e-38
Identity = 156/602 (25.91%), Postives = 253/602 (42.03%), Query Frame = 2
Query: 2894 CPPGKEWKECGH-CDQTCENQD-GFCLEKGCKSGCFCPDGYL---LSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECG-NKGTSCTKSIFFYYRNQV-VQLIRGVRPKVMENENYPKDRVKGRIS-FRDLVSQLIIYTDSDIIL--YWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNC-PAAKDVPDMCKSNHERQAWADKMCGTMKNVK--FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELC---PVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKN--CVEGCSCPTEYIEAEGS-----NKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPK---CITSTTSYCIGSKLTKCENGVCARICNGI---------------------PECSDGSDEANCXXXXXXXXXXXXXQPHCIYEGRIMQIGEVIKLESCLSVTCTDRRIVETRQNCDKTC 4558
            CP  K + ECG  C  TC N + G    + C  GCFCP   +   ++N  C+P   C C+   K+Y +      G ++   +CTC+ G+W C  +Q C G+C   G AH  TFDGK + F   CSYV+     G     F ++ + ++CG     +C K++     N   V L   +   ++  + +   + +  IS F+     ++I T   + L       + + I   P++Q Q+CGLCGNF+    +DF +  G  E   + F ++WK+R +C    +   + C  + E + +A   C  + +    F+ C   ++    Y+ C+ DTC+C++  DC  +C ALS++  AC   GI      +  C    + CP    +   +  C + C   +L+ T   +C+     V+GC C      AEG+      +CV  + C C   +S+    PGE  +     C C +    C    K   C +  T     + +       CA+ C  +                     P      D   C +              C++ G   + GE +K E C + TC DRR   T   C  TC
Sbjct:  273 CPESKVYMECGSPCMDTCSNPERGQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCIHGGKAYASGE----GYSSSCRECTCSGGQWNCVDKQ-CPGTCSVEGGAHIITFDGKPYTFHGDCSYVLSKECTGTD---FTILGDLVKCGITDSETCLKAVTLALSNGTNVSLSCELNINLLFKKIFRLTQTESDISIFKPSSFYIVIQTTIGLRLEIQLTPIMQVYITADPKFQGQMCGLCGNFNNIQADDFTTMGGLTEGTAVDFANTWKTRASCLDVQRTFENPCSLSTENEKYAQYWCSLLSDASGVFSSCHSEIN-PATYKNCIYDTCNCEKTEDC--MCAALSSYVHACAAKGIYIKGWRDVACKSYTLSCPNTMVYSYNMTSCGRSC--RSLSQTDF-SCSSQFVAVDGCGC------AEGTYLNEKEECVDPSGCPCY--DSNTVIQPGETVSREGTTCTCKQGQLNCIGSGKVQECTSPMTYLNCSAAVPGSTGSECAKSCKTLDMACVSYHIKYTRGCVSGCVCPSGLVSDDNGGCITEDLCP---------CVHNGASYKPGETVK-EDCNTCTCKDRRWQCTTNQCSATC 842          

HSP 3 Score: 152.525 bits (384), Expect = 1.954e-36
Identity = 131/455 (28.79%), Postives = 206/455 (45.27%), Query Frame = 2
Query: 1517 GSSCSQNCEDLITDENCKSF-------CTAGCFCPKDRFW--NGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATK-PSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWA-TAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKC----PNG---MEYMECKNLCSVSCFSLTQTNCSTE--CIDGC--QCKSNM-VYDTAVNQCVNISQCQCSHENAYYPSGST 2812
            GS C+++C+ L  D  C S+       C +GC CP       NG  C+ +  CPC+  NG S   Y  G + K DC  C C K   + C   + CS TC I GD HY TFD +     G+C YT+      S   N   ++  +N  C  +    C+K++ L  G  +    +    +  ++       +P QI             + ++IE+ NG+ ++W +KT + I L   +  +V GLCGN++GN+ +D T  S EL  N  +   SW  +  C   + +     CA +   E +A+  C  +  + F++CH  VDP  F   C  D C C       C C ++A+Y  AC   G+ + WR+  +C   C    P G     Y  C   C  +C +   T CS +   ++GC  +C + +  +D    +CV + +C C     +Y +G T
Sbjct:  753 GSECAKSCKTL--DMACVSYHIKYTRGCVSGCVCPSGLVSDDNGG-CITEDLCPCVH-NGAS---YKPGETVKEDCNTCTC-KDRRWQCTTNQ-CSATCSIYGDGHYITFDDKRYVFNGNCEYTLAQDFCSSSNTNGTFRVITENIPC-GTTGTTCSKAIKLFIGSNE---LVLSDGSYQVVQRDAGQEIPYQI---------RTMGNYLVIETNNGVVLIWDRKTSMYIKLTPDFNGRVCGLCGNFDGNANNDFTTRSQELVVNALDFGNSWKFSPTCPEAMVVQE--PCAHNPYREAWAQRQCSIINSDVFSACHSKVDPASFYSACVRDACACDTGGDCECFCTAVAAYAEACNAVGVCVAWRTPKVCPLFCDYYNPPGECEWHYKPCGAPCMKTCRNPAGT-CSLQLPAMEGCYPECPAGLPFFDEDTMKCVALEECGCYVGMEHYANGQT 1182          
BLAST of Hemocytin vs. Ensembl Cavefish
Match: ENSAMXT00000055757.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:1810216:1822580:1 gene:ENSAMXG00000037407.1 transcript:ENSAMXT00000055757.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 422.165 bits (1084), Expect = 1.244e-120
Identity = 343/1173 (29.24%), Postives = 522/1173 (44.50%), Query Frame = 2
Query:  671 QLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSL---MIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKN--INGESIENVTEFMKYWKN------PDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVF-GGDLSQCT-ILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWN---GTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTM----VATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPN-RLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRL--LYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WR-----SSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTN--CSTE--CIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKN----DCS------NVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLS-NKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGI--GFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC----PP---EKTFKTCINDCPKKC 4027
            Q+CS  G  +  T+DG   + P   ++IL   C     ++ I                   L   ++E A  S+    + N  T+ ++ +   I H     +     I  L+I  + K   FI          CGLCG F+G  + +   K+  +  + +  +   +   KN      P+ ++ N     G +              N CQ++F     S CT ++ V P+  +C  +LC C ++  +  +C  +A       S QC    G+  NWR++   P +CP +K Y ECGS C   C +    + C   C  GCFCP D  ++    T C+P   C CI         Y  G  +   C  C CS GG +NC   + C GTC + G  H  TFD +     G C Y +      T  +I G+ V         C  ++   C K+++L   +  N +      + +I + K  +  + +Q    LRL IQ                       Q+ IT    +Q Q+ GLCGN+N    DD T   G       + A +W T      +  ++   C+ S E EK+A+ +C  L      F+SCH  ++P  +   C +D C C   + ++C C +++SY  AC   G+ +K WR     S +L    CPN M Y      C  SC SL+QT+  CS++   +DGC C     Y     +CV+ S C C   N     G T   +   C C  G  +C  +    +C+      N +   PG    EC    ++C+  D  C+  GC SGC CP G +   N  C+ +  CPC+ +  SY     +     +C + CTC + +W C   Q C  +C  +GD HY TFD K + F   C Y +    C      G F+++TENI CG  GT+C+K+I  +  +  + L  G    V  +       +  +I  R + + L+I T++ ++L WD+  S+ I L P +  +VCGLCGNFD N NNDF +++     N L F +SWK    CP A  V + C  N  R+AWA + C  + +  F+ C   VD   +Y  C+ D C+CD GGDCEC CTA++A+  AC   G+  +WR+ ++CP+ C    PP   E  +K C   C K C
Sbjct:   14 QVCSTWGNYHFKTYDGDVFQLPSTCNHILTSQCRGSYEAFNIQLRRQVENGEPTISKITMKLDGTVVELAKGSI----VVNGETSLSQFFDLVIVHWTFLLWRIRNLIFSLQIELNAK---FI-------NQTCGLCGDFNGVPTYNEFIKDGKLQLQKLFLICRLLMPIKNKTCEEQPERVNENC----GDE--------------NFCQNLFLSKAFSSCTDLVSVEPFTKVCIEDLCQCNSSAGSSCLCDTLA-----EYSRQCVHAGGQPANWRTEHFCPMKCPESKVYMECGSPCMDTCSNPERGQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCIHGGK----AYASGEGYSSSCRECTCS-GGQWNCVD-KQCPGTCSVEGGAHIITFDGKPYTFHGDCSYVLSKECTGTDFTILGDLV--------KCGITDSETCLKAVTLALSNGTNVSL-----SSDISIFKPSSFYIVIQTTIGLRLEIQ------------------LTPIMQVYITADPKFQGQMCGLCGNFNNIQADDFTTMGGLTEGTAVDFANTWKTRASCLDVQRTFENPCSLSTENEKYAQYWCSLLSDASGVFSSCHSEINPATYKANCIYDTCNC--EKTEDCMCAALSSYVHACAAKGIYIKGWRDVACKSYTL---SCPNTMVYSYNMTSCGRSCRSLSQTDFSCSSQFVAVDGCGCAEG-TYLNEKEECVDPSGCPCYDSNTVIQPGETVSREGTTCTCKQGQLNCIGSGKVQECTSPMTYLNCSAAVPGSTGSECA---KSCKTLDMACVSTGCVSGCVCPSGLVSDDNGGCITEDLCPCVHNGASYKPGETVKE---DC-NTCTCKDRRWQCTTNQ-CSATCSIYGDGHYITFDDKRYVFNGNCEYTLAQDFCSSSNTNGTFRVITENIPCGTTGTTCSKAIKLFIGSNELVLSDGSYQVVQRDAG---QEIPYQI--RTMGNYLVIETNNGVVLIWDRKTSMYIKLTPDFNGRVCGLCGNFDGNANNDFTTRSQELVVNALDFGNSWKFSPTCPEAMVVQEPCAHNPYREAWAQRQCSIINSDVFSACHSKVDPASFYSACVRDACACDTGGDCECFCTAVAAYAEACNAVGVCVAWRTPKVCPLFCDYYNPPGECEWHYKPCGAPCMKTC 1093          

HSP 2 Score: 160.999 bits (406), Expect = 4.705e-39
Identity = 156/592 (26.35%), Postives = 245/592 (41.39%), Query Frame = 2
Query: 2894 CPPGKEWKECGH-CDQTCENQD-GFCLEKGCKSGCFCPDGYL---LSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECG-NKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNC-PAAKDVPDMCKSNHERQAWADKMCGTMKNVK--FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELC---PVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKN--CVEGCSCPTEYIEAEGS-----NKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPK---CITSTTSYCIGSKLTKCENGVCARICNGI---------------PECSDGSDEANCXXXXXXXXXXXXXQPHCIYEGRIMQIGEVIKLESCLSVTCTDRRIVETRQNCDKTC 4558
            CP  K + ECG  C  TC N + G    + C  GCFCP   +   ++N  C+P   C C+   K+Y +      G ++   +CTC+ G+W C  +Q C G+C   G AH  TFDGK + F   CSYV+     G     F ++ + ++CG     +C K++     N               N +   D    + S   +V Q  I    +I L     + + I   P++Q Q+CGLCGNF+    +DF +  G  E   + F ++WK+R +C    +   + C  + E + +A   C  + +    F+ C   ++   Y   C+ DTC+C++  DC  +C ALS++  AC   GI      +  C    + CP    +   +  C + C   +L+ T   +C+     V+GC C      AEG+      +CV  + C C   +S+    PGE  +     C C +    C    K   C +  T     + +       CA+ C  +               P      D   C +              C++ G   + GE +K E C + TC DRR   T   C  TC
Sbjct:  263 CPESKVYMECGSPCMDTCSNPERGQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCIHGGKAYASGE----GYSSSCRECTCSGGQWNCVDKQ-CPGTCSVEGGAHIITFDGKPYTFHGDCSYVLSKECTGTD---FTILGDLVKCGITDSETCLKAVTLALSNGT-------------NVSLSSDISIFKPSSFYIVIQTTIGLRLEIQL--TPIMQVYITADPKFQGQMCGLCGNFNNIQADDFTTMGGLTEGTAVDFANTWKTRASCLDVQRTFENPCSLSTENEKYAQYWCSLLSDASGVFSSCHSEINPATYKANCIYDTCNCEKTEDC--MCAALSSYVHACAAKGIYIKGWRDVACKSYTLSCPNTMVYSYNMTSCGRSC--RSLSQTDF-SCSSQFVAVDGCGC------AEGTYLNEKEECVDPSGCPCY--DSNTVIQPGETVSREGTTCTCKQGQLNCIGSGKVQECTSPMTYLNCSAAVPGSTGSECAKSCKTLDMACVSTGCVSGCVCPSGLVSDDNGGCITEDLCP---------CVHNGASYKPGETVK-EDCNTCTCKDRRWQCTTNQCSATC 808          

HSP 3 Score: 111.309 bits (277), Expect = 6.766e-24
Identity = 85/361 (23.55%), Postives = 150/361 (41.55%), Query Frame = 2
Query: 3182 CKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGL--SIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYS-WRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNK-CVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKC 4252
            C +WG+ H+KT+DG  F   S C++++     G    F   +   +E G    S    I       VV+L +G               V G  S       +I++     +L+  + L  S++I L  ++ NQ CGLCG+F+     +   K G  +   L  +      +     ++ P+    N   + +   +     +  F+ C  +V  E + + C+ D C C+      CLC  L+ +   C   G   + WR+   CP+ CP  K +  C + C   C            C ++C++GC CP++ +  + +N  C+  + C C   +  K Y  GE ++ +C  C C+   + C
Sbjct:   16 CSTWGNYHFKTYDGDVFQLPSTCNHILTSQCRGSYEAFNIQLRRQVENGEPTIS---KITMKLDGTVVELAKG------------SIVVNGETSLSQFFDLVIVH--WTFLLWRIRNLIFSLQIELNAKFINQTCGLCGDFNGVPTYNEFIKDGKLQLQKLFLICRLLMPIKNKTCEEQPERVNENCGDENFCQNL---FLSKAFSSCTDLVSVEPFTKVCIEDLCQCNSSAGSSCLCDTLAEYSRQCVHAGGQPANWRTEHFCPMKCPESKVYMECGSPCMDTCSNPERGQV----CGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCI--HGGKAYASGEGYSSSCRECTCSGGQWNC 350          
BLAST of Hemocytin vs. Ensembl Cavefish
Match: ENSAMXT00000051667.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:1810030:1822580:1 gene:ENSAMXG00000037407.1 transcript:ENSAMXT00000051667.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 422.935 bits (1086), Expect = 1.808e-120
Identity = 341/1154 (29.55%), Postives = 527/1154 (45.67%), Query Frame = 2
Query:  674 LCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVT--FLGLSNSSTNSNRNYISS-IQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVF-GGDLSQCT-ILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWN---GTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTM----VATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPN-RLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRL--LYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WR-----SSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTN--CSTE--CIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLS-NKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGI--GFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC----PP---EKTFKTCINDCPKKC 4027
            +CS  G  +  T+DG   + P   ++IL   C   + SY  F             N      +E    +++   + L  +  +    ++ S +  + I  +  +K    L  +++    + I          CGLCG F+G  + +   K+  G  + + T++   WK   P +      T  +    +N++      N CQ++F     S CT ++ V P+  +C  +LC C ++  +  +C  +A       S QC    G+  NWR++   P +CP +K Y ECGS C   C +    + C   C  GCFCP D  ++    T C+P   C CI         Y  G  +   C  C CS GG +NC   + C GTC + G  H  TFD +     G C Y +      T  +I G+ V         C  ++   C K+++L      ++TF++   + +I + K  +  + +Q    LRL IQ                I+     Q+ IT    +Q Q+ GLCGN+N    DD T   G       + A +W T      +  ++   C+ S E EK+A+ +C  L      F+SCH  ++P  + + C +D C C   + ++C C +++SY  AC   G+ +K WR     S +L    CPN M Y      C  SC SL+QT+  CS++   +DGC C     Y     +CV+ S C C   N     G T   +     CT+ +   T  +CS      PG    EC    ++C+  D  C+  GC SGC CP G +   N  C+ +  CPC+ +  SY     +     +C + CTC + +W C   Q C  +C  +GD HY TFD K + F   C Y +    C      G F+++TENI CG  GT+C+K+I  +  +  + L  G    V  +       +  +I  R + + L+I T++ ++L WD+  S+ I L P +  +VCGLCGNFD N NNDF +++     N L F +SWK    CP A  V + C  N  R+AWA + C  + +  F+ C   VD   +Y  C+ D C+CD GGDCEC CTA++A+  AC   G+  +WR+ ++CP+ C    PP   E  +K C   C K C
Sbjct:    3 VCSTWGNYHFKTYDGDVFQLPSTCNHILTSQC---RGSYEAF-------------NIQLRRQVENGEPTISKITMKLDGTVVDVKAPHLGSGVFIETISSYIMVKATVGLTAMWNEDDALMIELNAKFINQTCGLCGDFNGVPTYNEFIKD--GAQL-SATDYGNLWKMDGPTE------TCEEQPERVNENC--GDENFCQNLFLSKAFSSCTDLVSVEPFTKVCIEDLCQCNSSAGSSCLCDTLA-----EYSRQCVHAGGQPANWRTEHFCPMKCPESKVYMECGSPCMDTCSNPERGQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCIHGGK----AYASGEGYSSSCRECTCS-GGQWNCVD-KQCPGTCSVEGGAHIITFDGKPYTFHGDCSYVLSKECTGTDFTILGDLV--------KCGITDSETCLKAVTLT-----DTTFVR---SADISIFKPSSFYIVIQTTIGLRLEIQLTP-------------IM-----QVYITADPKFQGQMCGLCGNFNNIQADDFTTMGGLTEGTAVDFANTWKTRASCLDVQRTFENPCSLSTENEKYAQYWCSLLSDASGVFSSCHSEINPATY-KNCIYDTCNC--EKTEDCMCAALSSYVHACAAKGIYIKGWRDVACKSYTL---SCPNTMVYSYNMTSCGRSCRSLSQTDFSCSSQFVAVDGCGCAEG-TYLNEKEECVDPSGCPCYDSNTVIQPGETVSREGKVQECTSPM---TYLNCSAAV---PGSTGSECA---KSCKTLDMACVSTGCVSGCVCPSGLVSDDNGGCITEDLCPCVHNGASYKPGETVKE---DC-NTCTCKDRRWQCTTNQ-CSATCSIYGDGHYITFDDKRYVFNGNCEYTLAQDFCSSSNTNGTFRVITENIPCGTTGTTCSKAIKLFIGSNELVLSDGSYQVVQRDAG---QEIPYQI--RTMGNYLVIETNNGVVLIWDRKTSMYIKLTPDFNGRVCGLCGNFDGNANNDFTTRSQELVVNALDFGNSWKFSPTCPEAMVVQEPCAHNPYREAWAQRQCSIINSDVFSACHSKVDPASFYSACVRDACACDTGGDCECFCTAVAAYAEACNAVGVCVAWRTPKVCPLFCDYYNPPGECEWHYKPCGAPCMKTC 1058          

HSP 2 Score: 145.591 bits (366), Expect = 2.532e-34
Identity = 157/583 (26.93%), Postives = 246/583 (42.20%), Query Frame = 2
Query: 2894 CPPGKEWKECGH-CDQTCENQD-GFCLEKGCKSGCFCPDGYL---LSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECG-NKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNC-PAAKDVPDMCKSNHERQAWADKMCGTMKNVK--FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGI------DYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKN--CVEGCSCPTEYIEAEGS-----NKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPKCITSTTSYCIGSKLT---KCENGVCARICNGIPECSDG---SDEANCXXXXXXXXXXXXXQPHCIYEGRIMQIGEVIKLESCLSVTCTDRRIVETRQNCDKTC 4558
            CP  K + ECG  C  TC N + G    + C  GCFCP   +   ++N  C+P   C C+   K+Y +      G ++   +CTC+ G+W C  +Q C G+C   G AH  TFDGK + F   CSYV+     G     F ++ + ++CG     +C K++           +R     + +  ++             +V Q  I    +I L     + + I   P++Q Q+CGLCGNF+    +DF +  G  E   + F ++WK+R +C    +   + C  + E + +A   C  + +    F+ C   ++    Y+ C+ DTC+C++  DC  +C ALS++  AC   GI      D + +S  L    CP    +   +  C + C   +L+ T   +C+     V+GC C      AEG+      +CV  + C C   +S+    PGE  +    +  C               ST S C  S  T    C +  C   C     C  G    D   C +              C++ G   + GE +K E C + TC DRR   T   C  TC
Sbjct:  248 CPESKVYMECGSPCMDTCSNPERGQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCIHGGKAYASGE----GYSSSCRECTCSGGQWNCVDKQ-CPGTCSVEGGAHIITFDGKPYTFHGDCSYVLSKECTGTD---FTILGDLVKCGITDSETCLKAVTLTDTT----FVRSADISIFKPSSF------------YIVIQTTIGLRLEIQL--TPIMQVYITADPKFQGQMCGLCGNFNNIQADDFTTMGGLTEGTAVDFANTWKTRASCLDVQRTFENPCSLSTENEKYAQYWCSLLSDASGVFSSCHSEIN-PATYKNCIYDTCNCEKTEDC--MCAALSSYVHACAAKGIYIKGWRDVACKSYTL---SCPNTMVYSYNMTSCGRSC--RSLSQTDF-SCSSQFVAVDGCGC------AEGTYLNEKEECVDPSGCPCY--DSNTVIQPGETVSREGKVQECTSPMTYLNCSAAVPGSTGSECAKSCKTLDMACVSTGCVSGC----VCPSGLVSDDNGGCITEDLC---------PCVHNGASYKPGETVK-EDCNTCTCKDRRWQCTTNQCSATC 773          

HSP 3 Score: 105.145 bits (261), Expect = 5.436e-22
Identity = 78/360 (21.67%), Postives = 147/360 (40.83%), Query Frame = 2
Query: 3182 CKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLN-NDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYS-WRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNK-CVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKC 4252
            C +WG+ H+KT+DG  F   S C++++     G    F   +   +E G    S           ++   + G    V          +   +    + S +++     +   W++  ++ I L  ++ NQ CGLCG+F+     N+F         +   + + WK        ++ P+    N   + +   +     +  F+ C  +V  E + + C+ D C C+      CLC  L+ +   C   G   + WR+   CP+ CP  K +  C + C   C            C ++C++GC CP++ +  + +N  C+  + C C   +  K Y  GE ++ +C  C C+   + C
Sbjct:    4 CSTWGNYHFKTYDGDVFQLPSTCNHILTSQCRGSYEAFNIQLRRQVENGEPTIS-----------KITMKLDGTVVDVK------APHLGSGVFIETISSYIMVKATVGLTAMWNEDDALMIELNAKFINQTCGLCGDFNGVPTYNEFIKDGAQL--SATDYGNLWKMDGPTETCEEQPERVNENCGDENFCQNL---FLSKAFSSCTDLVSVEPFTKVCIEDLCQCNSSAGSSCLCDTLAEYSRQCVHAGGQPANWRTEHFCPMKCPESKVYMECGSPCMDTCSNPERGQV----CGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCI--HGGKAYASGEGYSSSCRECTCSGGQWNC 335          
BLAST of Hemocytin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010519.1 (pep scaffold:Pmarinus_7.0:GL477612:23664:47127:1 gene:ENSPMAG00000009527.1 transcript:ENSPMAT00000010519.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 391.349 bits (1004), Expect = 2.470e-114
Identity = 334/1207 (27.67%), Postives = 523/1207 (43.33%), Query Frame = 2
Query:  674 LCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLM-IETASESVTFLGLSNSSTNSNRNYIS-SIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDR---FWN---GTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQK--TQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTL-KWRSS--SLCDPKCPNGMEYMECKNLCSVSCFSLTQTNC-----------STECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENA--YYPSGSTRKEKCNDCNCTNGVWSC------TKNDCSNVTF---CPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLS-NKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRG-VRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWK-SRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC----PPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGC--SCPTEY-IEAEGSNKCVKENEC 4153
            +CS+ G S++ TFD  S++ PL    + ++  ++  PS  + F  S      D ++ +  ++ +E  S S+T  G S S       Y   SIQ + +G + +   I    +L+D    + +           GLCG F+G   ++ +F      +   +  F+     P     + +             +L++  + M       D    ++L  I +  ICR +     N    +  C   A ++  F       N     WRS       CP  + + ECGS C   C +     NC S C  GCFCP+      W+   G+ C+P+  C C  + G S   Y  G S    C+ C C +G  +NC   R C GTC I G  +++TFD +     G CFYT+        GN+   +  + T C   +   C  S+       D    +    + ++LV++  N++PL         +QE +   +  E+  G+R+    K   Q+ IT    Y ++  GLCGN+N  + DD T S     T      V  A A C     ++ +  C+      ++AK  C  L+    PF++CH  V  + +  +C++D C C   E   C C ++++Y  AC  +G+ L  WRS   SL    CP   E+      C  +    ++  C           S   ++GC C + + YD     CV  S C C  E +     +G T       C CT G   C      + N C  +     C  G   +    C +TC N    C   GC SGC CP G ++  N  CV + +C C  + + Y     I    T   +KCTC   +W C  E  C G C  +G+ H+ TFDGK + F   C Y++    CG   G F++ TEN  CG  GT+C+K + FY     + L  G V+   ++    P          R +    ++ T   + + WD   ++ + + PQ + +VCGLCG++D  + NDF ++ G+   +   F   WK S   CP    V D C  NH R++WA K C  +K+  F  C  +V+   YY  C+ D+C CD GGDC CLCTAL+++  AC   G+   WR+ +LCP+ C      E   +    +C + C +S  N   +       +EGC  +CP++     E S  CV+  +C
Sbjct:    1 ICSVWGTSHLLTFDHASMDLPLSSCALNLVS-ITDSPSLSLSFQRS----ALDRMSVENVVVTMEGISLSLTREGQSISGQRVQLPYKDHSIQIEMVGSYIKCSSIMGFSLLWDQNNAITVKLDPKFNTKTTGLCGDFNG---IADDFYLNVMSTTSVLFSFLLTCDEPTQHIEHLF-----------EDELLSCVSVM-------DHQLKSLLVNILWSDICRLDC----NGTAGLYPCDGCA-TIAEFSRRCTQANESPGTWRSPEFCGVTCPRGQVHRECGSVCKDTCSNPSASVNCPSTCVDGCFCPEGTAGTVWDDVSGSGCIPQSNCGC-NQLGQS---YASGESLITGCKNCTCEQG-QWNCDS-RPCYGTCKILGGSYFSTFDSKTYRFHGDCFYTLTT---DCAGNK-FSVLGELTKCEGRDSKTCLNSVIFYI---DGIRTVVFKASGDVLVHE--NKVPLPFVSASVTIVQESSF-YLRAETNFGLRLRVQLKPLMQLYITAATAYHNKTCGLCGNFNEVTGDDFTHSGIVDATAATFCNVWKAQATCPDREEVT-MDPCSVYITNNEYAKAHCGLLMDNDGPFSTCHSVVSADEYYTRCKYDTCSCSYPEP--CLCAALSAYAYACSAHGVVLVGWRSDICSLDAENCPVSHEFSYAAPECGSASCRTSREVCRGVRPPPFELPSPSPVEGCVCGAGL-YDDEHGVCVLKSDCPCYSEMSGDLIRAGVTVDLHDTQCLCTGGELHCFGLSPISGNTCEGLMTYHNCSDGSS-EGSAACQRTCANPHSICYSPGCVSGCVCPGGLIVDHNGNCVSEEQCTCEHNGRHYDPGDTI----TQLCNKCTCMNARWSCTSE-VCQGLCFVYGEGHHTTFDGKQYVFDGSCQYILSQDSCGNSSGSFRITTENEPCGTTGTTCSKKVHFYAGADELVLTDGTVKGSSLDFPGSP-------FHVRRMGIYTVVETSLGVTIIWDGHTAVSVHVNPQLKGRVCGLCGDYDGKVANDFVTRTGSVAASAPEFAAGWKESGSGCPDLSRVSDPCTINHHRESWAHKQCSVLKDGVFKQCHNMVEYLPYYAACVRDSCGCDTGGDCHCLCTALASYAQACGSAGVCLRWRTPDLCPLGCDLYNKDEGQCEWHYRECGRGCQRSCTNRNAICTANLPPLEGCYPTCPSDRPFLNESSMTCVERCDC 1143          

HSP 2 Score: 71.633 bits (174), Expect = 1.506e-12
Identity = 90/385 (23.38%), Postives = 150/385 (38.96%), Query Frame = 2
Query: 3182 CKSWGDAHYKTFDGKYFDF-VSKCSY--VMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVM-ENENYPKDRVKGRISFRDLVSQLIIYTD----SDII---LYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTE---LYYQKCLSDTCSCDRGGDCECL----CTALSAFYSACKKYGID-YSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCP-----TEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDP 4264
            C  WG +H  TFD    D  +S C+   V +       + F +   + +   N                VV  + G+   +  E ++    RV+  + ++D   Q+ +       S I+   L WD+  +I + L P++  +  GLCG+F+  + +DF     +  + + +F+      + C    D P    + H    + D++           C  V+D +   L      SD C  D  G         C  ++ F   C +      +WRS E C V CP  +  + C + C   C  SN + +V  NC   CV+GC CP     T + +  GS  C+ ++ C C      + Y  GE     C  C C +  + C   P
Sbjct:    2 CSVWGTSHLLTFDHASMDLPLSSCALNLVSITDSPSLSLSFQRSALDRMSVEN----------------VVVTMEGISLSLTREGQSISGQRVQ--LPYKDHSIQIEMVGSYIKCSSIMGFSLLWDQNNAITVKLDPKFNTKTTGLCGDFN-GIADDFYLNVMSTTSVLFSFL------LTC----DEP----TQHIEHLFEDEL---------LSCVSVMDHQLKSLLVNILWSDICRLDCNGTAGLYPCDGCATIAEFSRRCTQANESPGTWRSPEFCGVTCPRGQVHRECGSVCKDTC--SNPSASV--NCPSTCVDGCFCPEGTAGTVWDDVSGSG-CIPQSNCGCN--QLGQSYASGESLITGCKNCTCEQGQWNCDSRP 337          

HSP 3 Score: 70.4774 bits (171), Expect = 3.038e-12
Identity = 90/357 (25.21%), Postives = 144/357 (40.34%), Query Frame = 2
Query:  674 LCSIMGGSYVTTFDGISIENPLRGSNILVID-CLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQH-KNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPA-NKE-------YSECGSSCSQNCEDLITDENCKSFCTA------GCF--CPKDR-FWNGTYCVPKPQCPCIRKNGNSMVV 1684
            LC + G  + TTFDG           IL  D C +   S+RI   +   C T     C   +     ++ +       +   S+ ++  S  H + +G +  ++    + I++DG   V +     +K  VCGLCG +DG   ++++F    G    +  EF   WK      P+    +  D CT +N    + A+  C  +  G   QC  ++  +PY + C  + C C   G    +C  +A       +  C   G  + WR+    P  C   NK+       Y ECG  C ++C       N  + CTA      GC+  CP DR F N +      +C C+  NG +  V
Sbjct:  817 LCFVYGEGHHTTFDGKQYVFDGSCQYILSQDSCGNSSGSFRITTENE-PCGTTG-TTCSKKVHFYAGADELVLT--DGTVKGSSLDFPGSPFHVRRMGIYTVVETSLGVTIIWDGHTAVSVHVNPQLKGRVCGLCGDYDGK--VANDFVTRTGSVAASAPEFAAGWKESGSGCPDLSRVS--DPCT-INHHRESWAHKQCSVLKDGVFKQCHNMVEYLPYYAACVRDSCGCDTGGDCHCLCTALA-----SYAQACGSAGVCLRWRTPDLCPLGCDLYNKDEGQCEWHYRECGRGCQRSC------TNRNAICTANLPPLEGCYPTCPSDRPFLNESSMTCVERCDCV-SNGTTYKV 1152          
BLAST of Hemocytin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008773.1 (pep scaffold:Pmarinus_7.0:GL476328:703641:749596:1 gene:ENSPMAG00000007891.1 transcript:ENSPMAT00000008773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 394.815 bits (1013), Expect = 4.865e-112
Identity = 325/1164 (27.92%), Postives = 499/1164 (42.87%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYIS----SIQHKNIGDFNQIKG--IGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGG-DLSQCTI-LPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSY--QC-TLNGKLINWR--SQLC-APRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTY---CVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQK--TQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLC---DPKCPNGMEY----MECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGH---------CDQTCENQDGFCLEKGCKSGCFCPDGYLLSNK-TCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDC--GKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC-----PPEKT--FKTCINDCPKKC 4027
            CS  G ++  TFDG   +  +  + +   +C    P++ +    S N P         S +  +  +    L    ++ N     +      IQ   +GD  +I    IG  ++ ++ K ++ +    + +   CGLCG ++G++    EFK      I +V E+    K  DP+           +      D  +   ++C+ V    + + C   L V PY   C  + C C       S C +     G+ + Y  +C ++ G   NWR  S+ C A  EC     Y ECG  C  +C        C   C  GCFCP+   W+      C+P  +C C+         Y+ G    +DC+ C C  GGV+NC + + C+ TC + G  H  TFD+      G C+Y M           +  + V+   C   N   C KSL+L  G   N   I +  +  + VN +   LP   N    +TI   +   + + +  G+ +L       Q+ +TL   +     GLCG+YNG   DD   S+G +       A SW         + S    C  S  ++++A++ C  +     PF++CH +V P  F ++C +D C C  +E   C C +++SY  AC    + L+     LC      CP    Y    + C N C V   + +Q   S   +DGC C     YD+    C+   +C C +     P G++ ++    C C  G   C          CP    +  C           C QTC  Q+  C    C SGC CP G + S+  TC+    CPC  + +       I        + CTC   KW C     C+ +C  +G  HY+TFDG+ F F   C+YV+   +C      G F + TEN+ CG  GT+C++SI     N V++L +            P+     +I  R L   L++ T + I L WDK   + I+L P+Y+  VCGLCGN D    ND  ++      + L F +SWK    C  AK+    C     R  WA + CG +K+  FA C  +VD   +++ C+ D C CD GGDCECLC A++ +  AC + G    WR+ +LCP+ C     P + T  ++ C   CPK C
Sbjct:    1 CSTWGQNHFKTFDGKFFDLGISCNYLFASNCKDATPNFNVIIRRSVNNPQI------ISSINISIIDINIDLSAEGAAVNKESQDLPFNQYGIQIIALGDDVKITATNIG-FKLFWNKKDSLLLQVTESYRNKTCGLCGDYNGDAEYP-EFKG----GILSVAEYALNNKYYDPM------VQCDQIEQPPTPDDCSMHESLCELVLNTPEFADCKARLDVRPYIGACIVDQCSC------TSDCPD----FGTVEEYSRECRSIGGTPGNWRNTSETCGAAPECLPGTIYQECGIPCPNSCSQPSLSNMCIEECVPGCFCPRGTIWDDLTDKGCIPLEECSCVFNKH----TYNAGDILHQDCQDCVC-HGGVWNCEE-QPCTRTCALEGGSHIKTFDQNQFTFHGDCYYFMAMD----CRTHLFNLMVKLKPCETKNT--CLKSLALILGR--NVLKIMISDSGEVSVNDVEVNLPYDSN---AITIFYQSSFYIHLHTSIGVNLLVQLSPVMQLYLTLDPSFHTATCGLCGDYNGIQSDDFKTSNGLIEGTAIYFANSWKAQNTCPPPTESTEEPCMLSLNHKQYAEDMCSNMKTPDGPFSACHGTVSPEAFYKRCLYDTCSCQDSEA--CLCAALSSYALACASKHVVLEGWREHLCAKYTENCPGSQVYSYNALPCVNTCRVLQETGSQCFSSGVAVDGCTCPKG-TYDSGGGFCMAPEECPCYYRGNVLPLGNSVQQGKYICECRAGTMLCMNPQGPTPQPCPHPMVYFNCNQSTANGNSFPCHQTCSLQE--CYNPECNSGCVCPKGLVYSDDGTCIQPEACPCEHNGQKTAPGESIEVD----CNTCTCVNRKWECTN-NTCLSTCSLYGQGHYRTFDGQRFLFEGSCTYVIAQDNCQNPNNEGTFNITTENVPCGTTGTTCSRSINVQVGNWVIKLFQKSYSIDFLGSG-PETINPFQIKHRGLY--LVVETSNRITLTWDKNTGVFISLGPEYKGTVCGLCGNHDGRAANDLTTRTHMVVEDPLEFGNSWKLSGLCADAKETSSPCALMSHRLPWAQQRCGILKSDTFASCHALVDVLPFHEACVHDACGCDTGGDCECLCNAVAVYAKACNEAGQCIKWRTPDLCPLFCEYYDAPDDCTWHYRPCGQSCPKTC 1106          

HSP 2 Score: 177.563 bits (449), Expect = 9.202e-45
Identity = 178/657 (27.09%), Postives = 281/657 (42.77%), Query Frame = 2
Query: 2711 CKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECG-HCDQTCENQD--GFCLEKGCKSGCFCPDGYL---LSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENE---NYPKDRVKGRISFRD-LVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPA---AKDVPDMCKSNHERQAWADKMCGTMK--NVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSAC-KKYGIDYSWRSNELCPVM---CPPEKTFK----TCINDC------PKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCR----PDPKCITSTTSYCIGSKLTKCENGV-CARICNGI----PECSDGSDEANCXXXXXXXXXXXXXQPH---CIYEGRIMQIGEVIKLESCLSVTCTDRRIVETRQNCDKTC 4558
            CK+ +     +  C+ + QC C+ +   + +      +C     T G W  T   C     C PG  ++ECG  C  +C        C+E+ C  GCFCP G +   L++K C+P  +C C+++  +Y    +++         C C+ G W CE EQ C  +C   G +H KTFD   F F   C Y M   DC   +  F L+ +   C  K T C KS+       V++++     +V  N+   N P D     I ++      L      ++++     + + + L P +    CGLCG+++   ++DFK+  G  E   + F +SWK++  CP    + + P M   NH++  +A+ MC  MK  +  F+ C   V  E +Y++CL DTCSC       CLC ALS++  AC  K+ +   WR + LC      CP  + +      C+N C        +CF S +            V+GC+CP    ++ G   C+   EC C    +      G    +   IC C      C     P P+       Y   ++ T   N   C + C+      PEC+ G     C      +   T  QP    C + G+    GE I+++ C + TC +R+   T   C  TC
Sbjct:  197 CKARLDVRPYIGACI-VDQCSCTSDCPDFGTVEEYSRECRSIGGTPGNWRNTSETCGAAPECLPGTIYQECGIPCPNSCSQPSLSNMCIEE-CVPGCFCPRGTIWDDLTDKGCIPLEECSCVFNKHTYNAGDILHQD----CQDCVCHGGVWNCE-EQPCTRTCALEGGSHIKTFDQNQFTFHGDCYYFMA-MDCRTHL--FNLMVKLKPCETKNT-CLKSLALILGRNVLKIMISDSGEVSVNDVEVNLPYDSNAITIFYQSSFYIHLHTSIGVNLLVQLSPVMQLYLTLDPSFHTATCGLCGDYNGIQSDDFKTSNGLIEGTAIYFANSWKAQNTCPPPTESTEEPCMLSLNHKQ--YAEDMCSNMKTPDGPFSACHGTVSPEAFYKRCLYDTCSCQDSE--ACLCAALSSYALACASKHVVLEGWREH-LCAKYTENCPGSQVYSYNALPCVNTCRVLQETGSQCFSSGVA-----------VDGCTCPKGTYDS-GGGFCMAPEECPCYYRGNVLPL--GNSVQQGKYICECRAGTMLCMNPQGPTPQPCPHPMVYFNCNQSTANGNSFPCHQTCSLQECYNPECNSG---CVCPKGLVYSDDGTCIQPEACPCEHNGQKTAPGESIEVD-CNTCTCVNRKWECTNNTCLSTC 819          

HSP 3 Score: 105.916 bits (263), Expect = 6.116e-23
Identity = 108/410 (26.34%), Postives = 165/410 (40.24%), Query Frame = 2
Query: 3149 GCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYR--NQVVQLIRGVRP-----KVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQ-YQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPD-MCKSNHERQAWAD------KMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWR--SNELCPVMCPPEKTFKTCINDCPKKC------------FKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNS-DKKYNPGEIFTENCLICVCNEN-------NFKCRPDPK 4267
            GC    +C   C +WGD HY TFDG Y+ F   C+YV+V+        F   V     C   G +C +SI   Y   N +++  +  +P     K       P     G       +S  +   + + ++ ++  +   I LP + + N   G CG    N  +D + + G  + + +     WK          VPD  CK+N       D       +C  + +  FA+C++V+D + +   C  D C+  R  D  CL  ++ A+ S C   GI   WR  +N  C   CP  K +  C    P  C            +K+ +    +E+      EGC CP   I    S   +    C C  PN   K+Y  G+ +  NCL CVC+E+       N  C P PK
Sbjct: 1321 GCCIRYECECICSAWGDPHYTTFDGTYYTFTDDCTYVLVEQIIPVLPDFRVTVNNFRGCSGGGPACPRSITITYNGTNVIMETSQRKKPTRLFVKFNGVGVTPVYSENGMTVASSGISTRVDIPEIEAVITFEY-VRFSITLPYKFFFNNTQGQCGTCTNNRQDDCRMRNGVVDKSCVNMARDWK----------VPDPSCKTNPSSSPPPDVTCPPHPLCNLIGSDLFAECKRVIDPQPFVMGCQFDWCA-TRKDDIPCL--SIKAYASQCLDRGICVDWRNFTNNRCSYTCPIGKVYNACGPSIPPTCDTRLVWQSYLCYYKNFVYWLTMED------EGCFCPEGTI-LHNSQTDICTTSCGCTGPNGYPKQY--GDRWISNCLDCVCDEHSSSVVCVNHSCPPVPK 1707          

HSP 4 Score: 87.8113 bits (216), Expect = 2.343e-17
Identity = 73/303 (24.09%), Postives = 125/303 (41.25%), Query Frame = 2
Query: 1772 CSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIR----------ILWHQKTQIEITLP-EFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAE--CKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWR--SSSLCDPKCPNGMEYMEC 2635
            C   C   GDPHYTTFD  +      C Y +V     +  +   ++ V N          C +S+++ +    N T + + T++     K P RL ++ N    + +  V  +  +  + +GI           ++  +  +  ITLP +F+ +  QG CG    N +DD    +G +  +   +A  W   +  CK+  S S         +        C  +  + F  C   +DP PF+  C+ D C      KD+  C S+ +Y   C+  G+ + WR  +++ C   CP G  Y  C
Sbjct: 1328 CECICSAWGDPHYTTFDGTYYTFTDDCTYVLVEQIIPVLPD--FRVTVNNFRGCSGGGPACPRSITITY----NGTNVIMETSQ----RKKPTRLFVKFNG---VGVTPVYSENGMTVASSGISTRVDIPEIEAVITFEYVRFSITLPYKFFFNNTQGQCGTCTNNRQDDCRMRNGVVDKSCVNMARDWKVPDPSCKTNPSSS------PPPDVTCPPHPLCNLIGSDLFAECKRVIDPQPFVMGCQFDWC---ATRKDDIPCLSIKAYASQCLDRGICVDWRNFTNNRCSYTCPIGKVYNAC 1608          

HSP 5 Score: 61.2326 bits (147), Expect = 2.266e-9
Identity = 91/400 (22.75%), Postives = 147/400 (36.75%), Query Frame = 2
Query:  422 PCIQGCIRGKCKNGDCLCDSGYEGERCDRAFCQYGCGTGICVEPNVCQCPENFRGRNCETFFREPNTSNLKISDVINTKYK-----DYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCP-TKDFVNCDTSLMIETA---------SESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRS-QLC--------APRECPANKEYSECGSSCSQNCED 1546
            PC Q C   +C N +C       G  C +       GT  C++P  C C  N +    +T   E    +      +N K++         CS+ G  +  TFDG         + ++  D      +   F  ++ N P       C  S+ ++           S S+ FLG       S    I+  Q K+ G +  ++    + + +D    VFI      K +VCGLCG  DG +  +++        +E+  EF   WK    +  +   T+       L    +  A   C  +     + C  ++ V+P+   C  + C C   G    +C  +A       +  C   G+ I WR+  LC        AP +C     Y  CG SC + C D
Sbjct:  740 PCHQTCSLQECYNPEC-----NSGCVCPKGLVYSDDGT--CIQPEACPCEHNGQ----KTAPGESIEVDCNTCTCVNRKWECTNNTCLSTCSLYGQGHYRTFDGQRFLFEGSCTYVIAQDNCQNPNNEGTFNITTENVPCGTTGTTCSRSINVQVGNWVIKLFQKSYSIDFLG-------SGPETINPFQIKHRGLYLVVETSNRITLTWDKNTGVFISLGPEYKGTVCGLCGNHDGRA--ANDLTTRTHMVVEDPLEFGNSWKLSG-LCADAKETSSP---CALMSHRLPWAQQRCGILKSDTFASCHALVDVLPFHEACVHDACGCDTGGDCECLCNAVA-----VYAKACNEAGQCIKWRTPDLCPLFCEYYDAPDDC--TWHYRPCGQSCPKTCRD 1108          
BLAST of Hemocytin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008652.1 (pep scaffold:Pmarinus_7.0:GL477625:577100:586386:1 gene:ENSPMAG00000007836.1 transcript:ENSPMAT00000008652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 343.199 bits (879), Expect = 9.545e-103
Identity = 214/649 (32.97%), Postives = 303/649 (46.69%), Query Frame = 2
Query: 2132 NGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-----ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQT-NCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKND--CSNVTFCPPGKEWKEC-GHCDQTCENQD----GFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVM--------------------VDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYY---RNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKS-KAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELC 3964
            NG+RI+W    ++ +T P   +  V GLCG +  +  DD    +G++          W     AT  C    SL+    C    +    A+E C +L+ +PFN CH  V+P+ F + C +++C  G        C++ A Y   C   G+ L  WR    C   CP  M Y +C + C  +C SL+   +C  EC +GC C   ++ D     CV+ SQC+CS+ +  Y  GS  +  C +C C  G WSC  ++    +   CP   +W  C   C  TC N +      C+ + C +GC C  G +     CV    CPC    +S+     I     NC+    CN   W CE  ++C G C  +GD HYKTFDG+ +DF   C YV+                    VD+D       F L  EN+ CG+ G +CTK+I   Y    N  +  I  VR K + +         G    R     L + T   + + WD    + I L P+Y   V GLCGNF+ + N+DF +  AG  E     F DSWK    C  A  + D C ++  R AW+ + CG +++  FADCQ VV    Y  +CL D C CD GGDCECLCTA++A+   C   G+   WRS+ELC
Sbjct:    6 NGMRIVWDGVRRLYVTAPPELEGTVAGLCGTFTRDQRDDFMTRAGDVEIEVWAFTARWKVAQGATNSCPEANSLALASPCNTYAQLNSAAQETCNKLMNDPFNLCHTRVNPDAFKKDCTYEVCTAGA--LTGAECKTFADYAYICASRGVVLANWRLLLDCTVTCPGDMVYQQCASSCRSTCASLSNIEDCHEECAEGCNCPDGLLLDFDGLSCVDQSQCKCSYSSTNYAPGSILQMGCKNCTCEYGGWSCWSSEGCVDDSGLCPENMQWSPCKSSCPVTCGNMNNPSLSSCITETCDAGCECSTGLVWDGSKCVQPANCPCYHGGQSFQTGQSITLDCNNCV----CNGQVWECEH-KRCPGVCSVYGDPHYKTFDGRAYDFQGNCQYVLARTIYSLIDYSSLNLTDMGDVDND------GFVLTVENVPCGSSGVTCTKNIGLKYWRAHNGDIFKIDLVRGKNVVDPT-------GNFIIRRAGLYLFVDTPIGVSIQWDYSTRLYIRLHPKYMGLVEGLCGNFNGDQNDDFVTPAAGPPEEMPNIFGDSWKVHAYCAPAVVINDTCLTHPHRAAWSQRKCGVLRSSLFADCQGVVAVAPYVDRCLYDACGCDSGGDCECLCTAIAAYAYECSANGVPIEWRSDELC 634          

HSP 2 Score: 155.606 bits (392), Expect = 2.901e-39
Identity = 123/411 (29.93%), Postives = 177/411 (43.07%), Query Frame = 2
Query: 1457 WRSQLCAPRE--CPANKEYSECGSSCSQNCEDL--ITDENC-KSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSI-------------TGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTF--IQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDD-ATKSSGELTTNDNELAVSWAT-AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLC--DPKCPNG 2617
            W S+ C      CP N ++S C SSC   C ++   +  +C    C AGC C     W+G+ CV    CPC    G S   +  G S   DC  C C+ G V+ C   R C G C + GDPHY TFD R    +G+C Y +  T  S+               N    + V+N  C  S+   CTK++ L++    N     I LV  KN++             DP    I   A   + +++  G+ I W   T++ I L   Y   V+GLCGN+NG+  DD  T ++G      N    SW   A C   + ++    C        +++  C  L    F  C   V   P++ +C +D C C       C C ++A+Y   C  NG+ ++WRS  LC   P C  G
Sbjct:  255 WSSEGCVDDSGLCPENMQWSPCKSSCPVTCGNMNNPSLSSCITETCDAGCECSTGLVWDGSKCVQPANCPCYH-GGQS---FQTGQSITLDCNNCVCN-GQVWECEHKR-CPGVCSVYGDPHYKTFDGRAYDFQGNCQYVLARTIYSLIDYSSLNLTDMGDVDNDGFVLTVENVPC-GSSGVTCTKNIGLKYWRAHNGDIFKIDLVRGKNVV-------------DPTGNFIIRRAGLYLFVDTPIGVSIQWDYSTRLYIRLHPKYMGLVEGLCGNFNGDQNDDFVTPAAGPPEEMPNIFGDSWKVHAYCAPAVVIN--DTCLTHPHRAAWSQRKCGVLRSSLFADCQGVVAVAPYVDRCLYDACGCDSGGDCECLCTAIAAYAYECSANGVPIEWRSDELCRKSPLCKKG 643          

HSP 3 Score: 107.457 bits (267), Expect = 7.603e-24
Identity = 70/267 (26.22%), Postives = 120/267 (44.94%), Query Frame = 2
Query: 3491 IYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWK----SRVNCPAAKD--VPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPKCI 4273
            +  D+ + + WD    + +  PP+ +  V GLCG F ++  +DF ++AG+ E  + AF   WK    +  +CP A    +   C +  +  + A + C  + N  F  C   V+ + + + C  + C+       EC   A  A+  A +   +  +WR    C V CP +  ++ C + C   C  ++L+N  +E+C + C EGC+CP   +       CV +++C C    S   Y PG I    C  C C    + C     C+
Sbjct:    2 VTLDNGMRIVWDGVRRLYVTAPPELEGTVAGLCGTFTRDQRDDFMTRAGDVEIEVWAFTARWKVAQGATNSCPEANSLALASPCNTYAQLNSAAQETCNKLMNDPFNLCHTRVNPDAFKKDCTYEVCTAGALTGAECKTFADYAYICASRGV-VLANWRLLLDCTVTCPGDMVYQQCASSCRSTC--ASLSN--IEDCHEECAEGCNCPDGLLLDFDGLSCVDQSQCKCSY--SSTNYAPGSILQMGCKNCTCEYGGWSCWSSEGCV 261          

HSP 4 Score: 79.337 bits (194), Expect = 4.711e-15
Identity = 76/277 (27.44%), Postives = 110/277 (39.71%), Query Frame = 2
Query:  992 LEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWK------NPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGK-LINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRF--WNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGC---SGTC 1786
            + I++DG R +++ AP  ++ +V GLCG F  +     +F    G+    V  F   WK      N  P   +    +  +    LN     T N +  D F  +L    + P   ++  C  E+C                C   +  +Y C   G  L NWR  L     CP +  Y +C SSC   C  L   E+C   C  GC CP      ++G  CV + QC C   + N    Y  G   +  C+ C C  GG ++C    GC   SG C
Sbjct:    8 MRIVWDGVRRLYVTAPPELEGTVAGLCGTFTRDQR--DDFMTRAGDVEIEVWAFTARWKVAQGATNSCPEANSLALASPCNTYAQLNSAAQETCNKLMNDPF--NLCHTRVNP-DAFKKDCTYEVC-------TAGALTGAECKTFADYAYICASRGVVLANWRLLLDCTVTCPGDMVYQQCASSCRSTCASLSNIEDCHEECAEGCNCPDGLLLDFDGLSCVDQSQCKCSYSSTN----YAPGSILQMGCKNCTCEYGG-WSCWSSEGCVDDSGLC 267          
BLAST of Hemocytin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008716.1 (pep scaffold:Pmarinus_7.0:GL476328:595486:663084:-1 gene:ENSPMAG00000007851.1 transcript:ENSPMAT00000008716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 351.288 bits (900), Expect = 5.664e-98
Identity = 329/1269 (25.93%), Postives = 533/1269 (42.00%), Query Frame = 2
Query:  674 LCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIG------ELEILYDGKRNVF-IFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTT-----------ANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGK-LINWRS-QLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFW---NGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKT-QIEITLPE--FYQDQV---QGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP--FNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCD-PKCPNGMEYMECKNLCSVSCFSLTQTNCSTE----CIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVT--FCPPGKEWKECGHCDQTCENQDGFCLEKG--CKSGCFCPDGYL-------LSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDC--GKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMC----PPEK---TFKTCINDCPKKCFKSNLNNTVLENCAK--NCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRP--DPKCITSTTSYCI 4297
            +C+  GG +  TFD    +     S +   DC S    + I  +   N    + +    + + + A+  V+F            N I ++   N     Q  G G      +LEI      + F + A    ++ +CGLCG FDG+S++++ +  +      +  E + + K                 C+ L+ +L T            ++  C  V          L    Y ++C  E C C +A           C+  S  S +C+L  K L NWRS Q+C P++CP N EY ECGS+C   C ++     C+  C AGC CP        N   C+   +C C   NG   + Y        DC  C C + G + C   R C   C +    H+ TFD R     G C Y +   +  +     L+   Q   C   N +      SL   D      ++  +   I+ +++   LP  I+D +++  ++ +    +  SY  + ++ +  T Q+ I L +   +++ V    GLCGN+NG + DD   S G +       A SW        +       C  +    K A+  C  L      F  CH  VDP  +  +C+ D C C   +  +C  E+  SY  AC   GL  + WR ++     +CPN   Y    N C+ +C SL+  + + +      +GCQC   + +      CV    C C         G         C C  G   C+++   +    + PP    +      +  E    + L+ G  C+ GC CP+G +       ++N  C   H       ++ +   SV             C  G W C + Q C  +CK +GD HY TFDG+ F F   C YV+    C     +G F+++TENI CG+  T C+KSI F+ +N+ ++L  G + ++ +         +   +   +   LI+   + I L WD+  S+ I  PP  QNQ+CGLCG ++ ++++DF  +  +   + L F +SWK+   C    D    C+ N  R+AW+++ C  +K   F  C   VD   +Y+ C+ D+C+C+ GGDCEC CT+++A+  AC   G   +WR+ +LCPV C     P+     ++ C     K C   N     L N  +   C   C   T Y++ E    CV  ++C C++ +     N   +  + C  C C   N +C P    K +  + +YC+
Sbjct:    5 VCTTWGGGFFKTFDEAFFKFSSNCSYMFFQDCRSSYEEFNIKISHGANEQFSEILFKIDTDVAQFANGKVSF-----------NNRILTLPFSNNKILIQTHGSGVKLAFRQLEISAYLNDDAFTVVAGDEFRQQLCGLCGNFDGSSTVTTSYSRLKMLLSFSAYEVLFFVK-----------------CSQLHLNLKTLPAIQQYLIQPKSSGKCTAVVTSSCKGSCGLNQEGYAAMCAIEKCQCGSA-------TTCGCAALSAYSRECSLQYKPLPNWRSSQMCPPQDCPGNLEYQECGSTCPPTCANM-DPSKCQEPCVAGCVCPSGTVLSAINEETCIAPEECRC-NYNG---ITYDASDKITIDCNSCTC-EAGSWTCT-TRLCPKACSLESGAHFNTFDSRSYTFHGVCSYYLAVKQAHV----ALRALGQKLECSAKNPSDLGSISSLT--DKKRIRSLEFKSNGKIISSQMSVSLPY-ISDSVKI-FRKSSMFIQVDTSYGMMMLVQNSPTMQVYIGLIDSVMFRETVCTPTGLCGNFNGIASDDFMSSQGLVEGTAAAFANSWKVNPDCEDVGTVIRDPCQLNTAVAKQAELRCAILRNSTAFFKDCHYLVDPYSYYSRCKQDACSCPSGQ--DCITETFLSYALACASKGLIFENWRKATDSQLVECPNAEVYSYNANACNQTCRSLSSVDLACQESGLVAEGCQCAEGL-FANDEGMCVPAVSCPCYVNGDILKPGEKVTIADIPCYCREGQLLCSESKKEDHVDPYPPPPVAIQNISTLVRINECVVLYFLQLGRQCQPGCICPEGLINNGNGDCVNNSPCSVCHLVMSGRKEQCHCGASVY-----------KCYSGSWNCTELQ-CDSTCKMYGDGHYTTFDGQRFQFDGNCEYVVAQDFCVSDPKVGTFQIITENIPCGSMST-CSKSIRFFLQNKEIKLADG-KYEIHDVSGSASKGSEEVFTVHTVGLYLIVKASNGIKLIWDRRTSLFIIAPPDKQNQLCGLCGKYNFDMSDDFTMRDHSLSASPLHFGNSWKASDACSDVTDEASPCEMNPYRKAWSERKCSILKTDVFDACHSQVDHIPFYEACVRDSCACNIGGDCECFCTSVAAYAEACTSAGQCVAWRTPDLCPVFCDYYNSPDSCTWHYRPCGIVNTKTC--GNPAGIDLGNFPQLEGCYPKCPAKTPYLD-EHMMTCVSMDKCSCEMGSQIVPANGTVVNRDTCETCTCVMGNMECVPYGKLKTVAHSQTYCV 1203          

HSP 2 Score: 63.929 bits (154), Expect = 3.841e-10
Identity = 69/305 (22.62%), Postives = 110/305 (36.07%), Query Frame = 2
Query: 3149 GCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENE-NYPKDRVKGR-------------ISFRDLVSQLIIYTDSDIILYWDK---------GLSIEIALP-PQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDS--W----KSRVNCPA-----AKDVPDMCKSNHER-QAWADKMCGTM-KNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRS 3952
            GC    KC   C+ WGD HY+TFDG+ + F+  C+Y +V+    K    F ++ +N              +++Y+      +RG+      N  N      KGR             ++F  +    +I      IL             G+   + LP   + N   G CG  +    +D   ++G  E+     V +  W     S+ +C A      K  P    +      A    +C  +  N  FA C +  D   ++  C+ DTC+       E  C +L      C   G    WRS
Sbjct: 1948 GCCYTWKCNCQCQGWGDPHYRTFDGQKYTFLEDCTYTLVEEKINKYA--FSVLVDN--------------YYFYKQTPASFVRGITVNYNGNSANISLPAAKGRQTVINKVIFNGQAVAFPFVGKGFVITNHETQILVEIPAIGASVSFTGMMFTVDLPYSLFGNNTQGQCGTCNNARGDDCMRQSGVVEDASCCAVTAADWMVPDASKPHCRAKAPTGQKPCPSTTPTTRPYCTADTATICDIITSNRAFAGCAEATDLSEFFDSCVYDTCAVPTA--LEVGCASLQVAAEQCAALGFYVDWRS 2234          

HSP 3 Score: 51.9878 bits (123), Expect = 1.581e-6
Identity = 77/385 (20.00%), Postives = 134/385 (34.81%), Query Frame = 2
Query: 1796 GDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKI-----PNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLP-EFYQDQVQGLCGNYNGNSEDDATKSSGEL-------TTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKF----AKEFCQRLLY-EPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSS--LCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNM-VYDTAVNQCVNISQCQC-SHENAYYPSGSTRKEKCNDCNCTNGVWS--CTKNDC 2878
            GDPHY TFD +       C YT+V  K          + V N +  K   A   + +++ +     +  +     +  ++NK+         P  +     +T  E     +L+E       +        + LP   + +  QG CG  N    DD  + SG +        T  + +    +   C++          + +     +        C  +     F  C  + D + F   C +D C      +  CA  S+      C   G  + WRS +  +C   C +G EY        +SC     T  ++   +GC C   M ++++    CV   +C C   +      G++ +  C +C C     S  C  N C
Sbjct: 1963 GDPHYRTFDGQKYTFLEDCTYTLVEEK---INKYAFSVLVDNYYFYKQTPASFVRGITVNYNGNSANISLPAAKGRQTVINKVIFNGQAVAFPF-VGKGFVITNHETQ---ILVEIPAIGASVSFTGMMFTVDLPYSLFGNNTQGQCGTCNNARGDDCMRQSGVVEDASCCAVTAADWMVPDASKPHCRAKAPTGQKPCPSTTPTTRPYCTADTATICDIITSNRAFAGCAEATDLSEFFDSCVYDTCAVPTALEVGCA--SLQVAAEQCAALGFYVDWRSLTRGMCQYNCSSGFEYQPIGPKEQLSCDYSGATIQTSILEEGCFCPKGMKMFNSQAQTCV--VECGCMGPQGKPVMFGNSWQSDCKECVCDKASASVRCAPNKC 2336          
BLAST of Hemocytin vs. Ensembl Sea Lamprey
Match: tecta (tectorin alpha [Source:ZFIN;Acc:ZDB-GENE-110411-120])

HSP 1 Score: 283.878 bits (725), Expect = 2.696e-77
Identity = 288/1115 (25.83%), Postives = 430/1115 (38.57%), Query Frame = 2
Query:  992 LEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKN---------PDPIDPNTYYTT--GRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQL--CAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQ-GMSFKRDCE---ICECSKGGVFNCAK----------IRGCSGTCV---------ISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWAT---AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLL--YEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQ-TNCST-ECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGST--RKEKCND-CNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPC-LWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVME---NENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVN----CPAAKDVPDMCKSNHERQAWADKMCG--TMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDY-SWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFC 4159
            L + YD      I  P   K  +CG+CG +  N     EF   NG    +VTEF   W           P P       +T  G   C      L++  N        G  + C T+L    +   C  ++C     G    +C +++    + ++++ T+      WR Q+   + ++C AN  Y  C SSC ++C+       C   C  GC C +    +G  CVP   C C   +G S   YH  G  F  D      C C   G   C            +R     C+          +GDPHY TFD       G+C YT+  T     G     + V+N        +Y        +G   +S  I       + V+ +   LP+ I  P  LT+Q       L+E+  G+R+ +       + LP  Y+    GLCGNYNGN+ DD     G L  + N    +W      +C++T   S    C  +   +  +  FC  L+    PF  CH  V P P    C  D+C  GG  +    C+++++Y  AC   G+ +  WR+S+ C   C +   Y  C N C  SC  L Q T CS   C +GC+C    V+ +   +CV +++C C H    Y SG     +E C + C C        + D S V              C+ T           GC  G  C  G L   + C P  +  C  WSD                                             HY TFDG  FDF   C+Y +   +C + +  F++   N   G+   S  + +      Q V +  G    V     N N P     GR+S     S  ++ TD  + + ++    + + +   +Q+++CGLCGN++ N  ++F S  G    + + F  SW  RVN    C      P +C         +D  CG  T  +  FA C   V  + YY  C+ D C+   GG  + L  AL A+  AC+  G     WR++ L    CP    ++ C + CP  C +     T    C + C EGC C   Y+ +    +CV   +C C
Sbjct:  434 LTVTYDTDHYATITVPGAFKGRLCGVCGNY--NDDERDEFTMPNGTVTTSVTEFGNSWVQEAGCDQVILPPPACTEAVLSTYRGESFC-----GLISNPN--------GPFAVCGTVLSAFNFLESCVFDMC--ATGGDRDVLCQSLSAFASACQAHRATIQA----WRQQVNCLSAKQCGANSHYEVCTSSCPESCDGQGRRSRCGLPCHEGCRCDEGHVLSGGRCVPPSACGC--SHGGS---YHALGEPFWEDARCSSRCTCRAVGAVGCEPASCGPSTVCGVRAGEVACLPQEAPAFCQAAGDPHYYTFDGAAFDFMGTCRYTLAKTCAGGGGAVPFNVEVENDDRGSLVVSYTNLVKVDVYG---HSIVIGRADYPRVRVDGVLVNLPVTI-IPGNLTVQ--TGSATLVETNFGLRVQYDGHHVATVWLPRDYRGLTCGLCGNYNGNATDDFLLPDGSLAASQNHFGQAWTVRGDGDCQATEPPSE--PCPDAERPQYASGAFCGPLVDPEGPFRECHRIVRPEPHFGSCVTDVCALGG--RITALCDALSAYAAACQAAGVGVSGWRNSTFCPMSCQSNSHYELCSNTCQRSCSDLAQPTICSRGPCAEGCRCNPGTVWRSG--RCVPLAECGCFHGGRNYASGEAFWPEELCRERCEC--------RRDGSVV--------------CEAT----------GGCGVGESC--GVLAGARGCHPAGRASCRAWSDP--------------------------------------------HYVTFDGLAFDFQGACTYTLA-RNCSRELPRFEVRARNGNLGSSAVSVPRQVTVTVYGQQVDIFAGDGANVQVNGLNRNLPVSHDDGRLSVYRSGSSTVVSTDFGLQVSYNHRYHVTVEVASTFQSKLCGLCGNYNLNATDEFLSPEGRPVADPVQFGISW--RVNDGSVCHDGSGTPPVCDPEQRALYGSDGYCGILTSPDGPFAGCHATVSPDSYYNSCVFDLCAL--GGGADLLAGALEAYTGACQSDGGPVEEWRNDTLGQHSCPLHSHYELCGSACPSSCAQL----TGPAGCHRPCGEGCQCDRGYVWS--GAECVSVAQCGC 1421          

HSP 2 Score: 166.007 bits (419), Expect = 3.579e-41
Identity = 159/678 (23.45%), Postives = 266/678 (39.23%), Query Frame = 2
Query:  992 LEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYW--------------KNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENC-KSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRD---CEICECSKGGVFNC---------------AKIRGCS----GTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTT-------------KNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYL-GVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTL-KWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLT-QTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSG-STRKEKCND-CNCTNG 2851
            L + YDG     ++ P   +   CGLCG ++GN++   +F   +G    +   F + W                P P      Y +G   C  L                 G   +C  I+   P+   C +++C     G+  ++C  ++    + ++    ++G    WR+    P  C +N  Y  C ++C ++C DL     C +  C  GC C     W    CVP  +C C     N    Y  G +F  +    E CEC + G   C               A  RGC      +C    DPHY TFD      +G+C YT+                    +C +    +  ++ +   G +  S   Q+  T              N+ VN +   LP+  +D  RL++      TV+   + G+++ ++ +  + + +   +Q ++ GLCGNYN N+ D+     G    +  +  +SW   +       S    VC         +  +C  L     PF  CH +V P+ +   C  D+C  GG    +    ++ +Y  AC  +G  + +WR+ +L    CP    Y  C + C  SC  LT    C   C +GCQC    V+  A  +CV+++QC C +   Y  +G +   + C++ C C+ G
Sbjct:  821 LRVQYDGHHVATVWLPRDYRGLTCGLCGNYNGNAT--DDFLLPDGSLAASQNHFGQAWTVRGDGDCQATEPPSEPCPDAERPQYASGA-FCGPLVDPE-------------GPFRECHRIVRPEPHFGSCVTDVCAL--GGRITALCDALSAYAAACQAAGVGVSG----WRNSTFCPMSCQSNSHYELCSNTCQRSCSDLAQPTICSRGPCAEGCRCNPGTVWRSGRCVPLAECGCFHGGRN----YASGEAFWPEELCRERCECRRDGSVVCEATGGCGVGESCGVLAGARGCHPAGRASCRAWSDPHYVTFDGLAFDFQGACTYTLA------------------RNCSRELPRFEVRARNGNLGSSAVSVPRQVTVTVYGQQVDIFAGDGANVQVNGLNRNLPVSHDDG-RLSVYRSGSSTVVSTDF-GLQVSYNHRYHVTVEVASTFQSKLCGLCGNYNLNATDEFLSPEGRPVADPVQFGISWRVNDGSVCHDGSGTPPVCDPEQRALYGSDGYCGILTSPDGPFAGCHATVSPDSYYNSCVFDLCALGGGA--DLLAGALEAYTGACQSDGGPVEEWRNDTLGQHSCPLHSHYELCGSACPSSCAQLTGPAGCHRPCGEGCQCDRGYVWSGA--ECVSVAQCGCDYNGRYLQAGEAVWSDGCSERCECSAG 1448          

HSP 3 Score: 155.221 bits (391), Expect = 7.528e-38
Identity = 150/600 (25.00%), Postives = 248/600 (41.33%), Query Frame = 2
Query:  992 LEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWK------------NPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC--TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSM----VVYHQGMSFKRDCEICECSKGGVFNC--------------AKIRGC----SGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGD--TDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWAT----AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTL-KWRSSSLCDPKCPNGMEYMECKNLCS-VSC 2659
            L++ Y+ + +V +    T +  +CGLCG ++ N++   EF +  G  + +  +F   W+             P   DP      G D   G+    +T+ +        G  + C  T+ P   Y S C  +LC  L  G ++     +A ++ ++     +  G +  WR+       CP +  Y  CGS+C  +C  L     C   C  GC C +   W+G  CV   QC C   NG  +     V+  G S     E CECS GG+  C              A  RGC    +  C ++ DPHY TFD   ++ +G C Y  VA     +G +    +      +  N    T ++S   G      S  + L   + + VN +   LP+ + + + L+  E A   V+  + + + + + +     + +   Y  ++ G+CGNYNG+  DD    SGE+  +  +   SW      A C+ T+     G C    E E +           PF SCH  VDP  +++ C +D+C     +     C ++ +Y +AC   G+ L  WR         P+G  ++   + CS +SC
Sbjct: 1208 LQVSYNHRYHVTVEVASTFQSKLCGLCGNYNLNAT--DEFLSPEGRPVADPVQFGISWRVNDGSVCHDGSGTPPVCDPEQRALYGSDGYCGI----LTSPD--------GPFAGCHATVSPDSYYNS-CVFDLC-ALGGGADL-----LAGALEAYTGACQSDGGPVEEWRNDTLGQHSCPLHSHYELCGSACPSSCAQLTGPAGCHRPCGEGCQCDRGYVWSGAECVSVAQCGC-DYNGRYLQAGEAVWSDGCS-----ERCECSAGGLVRCSPASCPVGLACSVRAGARGCFQAATARCTVTNDPHYFTFDGAVVHYQGVCAYD-VARPCGGSGGEPYPFF----RVVMENKRRGTGAVSFISGVHLIVGSAHVLLRGREVLKVNGMRTLLPVVVAEGVALS--EEASGFVVARTPHNVTVRYDRLYTAHVEVGAEYAGRLCGMCGNYNGDPRDDLLTPSGEIALDARQFGRSWRAPDVDAGCEDTVDHVEPGRCN---EEEMWGHCGVLSDPEGPFRSCHWFVDPALYLESCVYDLCSYEATKVQ--LCRALEAYAQACGLAGVPLVDWRG--------PSGCHFIPASDPCSAISC 1760          

HSP 4 Score: 152.14 bits (383), Expect = 5.906e-37
Identity = 136/477 (28.51%), Postives = 205/477 (42.98%), Query Frame = 2
Query: 2978 CKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNE-GKWGCEQE-------------------QKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGF-FKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKG---RISFRDLVSQLIIYTDSDIILYWDKGLSIE--------IALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSR--VNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVK--FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYS-WRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKN-CVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPKCITSTTSYC 4294
            C  GC C +G++LS   CVP   C C     SY      +     C S+CTC   G  GCE                     Q+    C++ GD HY TFDG  FDF+  C Y +  +  G G    F +  EN + G        S+   Y N V   + G    V+   +YP+ RV G    +    +   L + T S  ++  + GL ++        + LP  Y+   CGLCGN++ N  +DF    G+   +   F  +W  R   +C A +   + C      Q  +   CG + + +  F +C ++V  E ++  C++D C+   GG    LC ALSA+ +AC+  G+  S WR++  CP+ C     ++ C N C + C  S+L    +  C++  C EGC C    +   G  +CV   EC C   +  + Y  GE F    L   C E   +CR D   +   T  C
Sbjct:  622 CHEGCRCDEGHVLSGGRCVPPSACGCS-HGGSYHALGEPFWEDARCSSRCTCRAVGAVGCEPASCGPSTVCGVRAGEVACLPQEAPAFCQAAGDPHYYTFDGAAFDFMGTCRYTLAKTCAGGGGAVPFNVEVENDDRG--------SLVVSYTNLVKVDVYG-HSIVIGRADYPRVRVDGVLVNLPVTIIPGNLTVQTGSATLVETNFGLRVQYDGHHVATVWLPRDYRGLTCGLCGNYNGNATDDFLLPDGSLAASQNHFGQAWTVRGDGDCQATEPPSEPCPDAERPQYASGAFCGPLVDPEGPFRECHRIVRPEPHFGSCVTDVCAL--GGRITALCDALSAYAAACQAAGVGVSGWRNSTFCPMSCQSNSHYELCSNTCQRSC--SDLAQPTI--CSRGPCAEGCRCNPGTVWRSG--RCVPLAECGCF--HGGRNYASGEAFWPEEL---CRE-RCECRRDGSVVCEATGGC 1074          

HSP 5 Score: 123.25 bits (308), Expect = 3.431e-28
Identity = 107/430 (24.88%), Postives = 176/430 (40.93%), Query Frame = 2
Query: 2954 DGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDS--DCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENE---NYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNV--KFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKY-GIDYSWRS--NELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTEN 4213
            D +  +  C + C C  G   +   C P+   PC  S++  L  SV    P                 QE +    C   GD HY TFD     F   C+Y +  +  +    +  F ++ ++   G+   S TK +        + + +G R +V+ NE   + P   + GRI      S + I TD  + + +D      I +P  ++ ++CG+CGN++ +  ++F    G    ++  F +SW     C      P  C          +  CG + N    FA C  V+    + + C+ D C+   GGD + LC +LSAF SAC+ +     +WR   N L    C     ++ C + CP+ C      +     C   C EGC C   ++ + G  +CV  + C C   +    +  GE F E+
Sbjct:  267 DVYWTDGTCTTRCKCVGGETANGLECRPR---PCSDSERCILQDSVHQCAP-----------------QETRI---CTVSGDPHYNTFDRVVHHFQGTCAYTLARTCLERPTELSSFHVIAKSEHRGSSTVSWTKLVQLEVYGFSLIINKGDRSRVLVNEELTSLPFTLLNGRIRASQSGSSVAISTDFGLTVTYDTDHYATITVPGAFKGRLCGVCGNYNDDERDEFTMPNGTVTTSVTEFGNSWVQEAGCDQVILPPPACTEAVLSTYRGESFCGLISNPNGPFAVCGTVLSAFNFLESCVFDMCA--TGGDRDVLCQSLSAFASACQAHRATIQAWRQQVNCLSAKQCGANSHYEVCTSSCPESCDGQGRRS----RCGLPCHEGCRCDEGHVLSGG--RCVPPSACGCS--HGGSYHALGEPFWED 663          

HSP 6 Score: 112.849 bits (281), Expect = 4.789e-25
Identity = 101/386 (26.17%), Postives = 168/386 (43.52%), Query Frame = 2
Query: 1784 CVISGDPHYTTFDKRHIYVEGSCFYTMVAT---KPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQI-NDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWAT-AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSS--LCDPKCPNGMEYMECKNLCSVSCFSL-TQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKC---NDCNCTN-GVWSCTKNDCSNVTFC 2896
            C +SGDPHY TFD+   + +G+C YT+  T   +P+   +    +  ++ H   S  ++ TK + L+      S  I       +LVN+    LP  + N  +R +    +  +V I +  G+ + +       IT+P  ++ ++ G+CGNYN +  D+ T  +G +TT+  E   SW   A C   +       C ++       + FC  +     PF  C   +    F++ C  D+C  GG+   +  C+S++++  AC  +  T++ WR     L   +C     Y  C + C  SC     ++ C   C +GC+C    V      +CV  S C CSH  +Y+  G    E     + C C   G   C    C   T C
Sbjct:  320 CTVSGDPHYNTFDRVVHHFQGTCAYTLARTCLERPTELSS--FHVIAKSEHRGSSTVSW-TKLVQLEV--YGFSLIINKGDRSRVLVNEELTSLPFTLLNGRIRAS---QSGSSVAISTDFGLTVTYDTDHYATITVPGAFKGRLCGVCGNYNDDERDEFTMPNGTVTTSVTEFGNSWVQEAGCDQVILPP--PACTEAVLSTYRGESFCGLISNPNGPFAVCGTVLSAFNFLESCVFDMCATGGDR--DVLCQSLSAFASACQAHRATIQAWRQQVNCLSAKQCGANSHYEVCTSSCPESCDGQGRRSRCGLPCHEGCRCDEGHVLSGG--RCVPPSACGCSHGGSYHALGEPFWEDARCSSRCTCRAVGAVGCEPASCGPSTVC 691          

HSP 7 Score: 102.064 bits (253), Expect = 9.108e-22
Identity = 99/398 (24.87%), Postives = 156/398 (39.20%), Query Frame = 2
Query: 2867 KNDCSNVTFCPPGKEWKECGH-CDQTCENQDGFCL-EKGCKSGCFCPDGYLLSNKTCVPKHKCPC------------LWSDKSYLN-----QSVIYTGPTNCLS--KCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIG----FFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRP-KVMENENYPKDRVKGRISFRDLVSQLIIY-TDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSN--HERQAWADKMCGTMKNVK--FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDY-SWRSNELC 3964
            +ND      CP    ++ CG  C  +C    G     + C  GC C  GY+ S   CV   +C C            +WSD            ++   P +C     C+   G  GC Q       C    D HY TFDG    +   C+Y  V   CG   G    FF++V EN   G    S    +     +  V L+RG    KV          V   ++  +  S  ++  T  ++ + +D+  +  + +  +Y  ++CG+CGN++ +  +D  + +G    +   F  SW++       +D  D  +    +E + W    CG + + +  F  C   VD  LY + C+ D CS +       LC AL A+  AC   G+    WR    C
Sbjct: 1357 RNDTLGQHSCPLHSHYELCGSACPSSCAQLTGPAGCHRPCGEGCQCDRGYVWSGAECVSVAQCGCDYNGRYLQAGEAVWSDGCSERCECSAGGLVRCSPASCPVGLACSVRAGARGCFQ--AATARCTVTNDPHYFTFDGAVVHYQGVCAY-DVARPCGGSGGEPYPFFRVVMENKRRGTGAVSFISGVHLIVGSAHV-LLRGREVLKVNGMRTLLPVVVAEGVALSEEASGFVVARTPHNVTVRYDRLYTAHVEVGAEYAGRLCGMCGNYNGDPRDDLLTPSGEIALDARQFGRSWRAPDVDAGCEDTVDHVEPGRCNEEEMWGH--CGVLSDPEGPFRSCHWFVDPALYLESCVYDLCSYE--ATKVQLCRALEAYAQACGLAGVPLVDWRGPSGC 1746          
BLAST of Hemocytin vs. Ensembl Nematostella
Match: EDO44199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWN6])

HSP 1 Score: 349.747 bits (896), Expect = 5.852e-98
Identity = 328/1194 (27.47%), Postives = 523/1194 (43.80%), Query Frame = 2
Query:  674 LCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCP-----TKDF-VNCDTSLMIETASESVTFLGLSN-SSTNSNRNYISSIQH-KNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKK------SVCGLCGYFDGNSSLSSEFKNINGESI--ENVTEF-MKYWKNP---DPIDPNT--YYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKL-INWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDEN-CKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQF---GDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLR-----LTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW------ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRL--LYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSS-SLCDPK--CPNGMEYMEC-------KNLCSVSCFSL---TQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGF-CLEKGCKSGCFCPDGYLL-SNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCN---EGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSK-CSYVMVDSDCGKGIGFFKLVTENIECGNKG----------TSCTKSIFFYYRNQVVQLIRGVRPKVMENENYP---KDRVKGRISFRDL--VSQLIIYTDSDII--------LYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMK-NVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELC--PVMCPPEKTF 3994
            LC I G  + TTFD          S   +ID  + K  +++  N+  NC      TK   VN D    +    E  +  G         N  Y  S  + +  G +  ++   E+ I +DG   + I  P + K        + GLCG +DGN++  ++F  ++G +   +N+ +F +    +P   +P  P +  Y     D+ + +       A  MC  +     S C + +    +++ C +++C C     N +  ++  C++ S  S  C  N  + ++WRS    P  CP+  E+SEC S+C ++C ++ +D N C S C  GCFCP+ +  +   CV   QC C     +S + Y  G   K +C  C C+ GG++NC     CSGTC + G+ H+TTFD R   + G C Y +                  + HC  SND   TK  ++      D      + L     + +  +    P  +N   +     L+++ +    VL+ +Y G+ ILW          P+F + Q  GLCG +N N  DD     G+   +    A  W      A + C  +        C+     E +AK  C  +  L  PF +CH  V P    Q+C  D C+C      +C C   A+Y +AC   G+ +  WR + S+C PK  CP G    +C       K  C  +C  L   T T  S  C++GC C+         ++CV+ +QC C + +  Y  G  RK++CN+C C  GV+ CT  DC  +     G  + +CG    TCEN       E+ C SGC+CPDG ++  N TCV   +C C  ++K Y   ++    PT+C  KC  +   E   G + + +    C ++G  HY+TFDG  ++F S+ C Y  ++ +        K+V +N++C N            T   +++      +   L R          +YP   K  +   ++  ++  V   +I    D +        + +D+G  + +     Y+  V GLCGNFD   +ND ++  G+   +I  F DSW+    C   K V   C    +R+ WADK C  ++ N  F  C   V+   Y + C  +TC    GGDC   C+A++A+  AC +YGI   WR    C   +  P  K+F
Sbjct:  477 LCYISGRGHFTTFDHQEYSFYGTCSYKALIDNSNVKQIFQVVLNNDKNCDINAPCTKSVDVNVDGK-KVHLGQEVASRHGFVKVDGVTENLPYTKSWPNIRQAGKYVIVRTSDEVLIYFDGSEELMIKVPDSYKTVNSSDTRLKGLCGNYDGNNT--NDFIGLDGTTYTKDNINDFGVSMLDDPLCTNPPKPPSGCYSEVAGDVFSAMQN-----AEKMCSVIQSDAFSACRSKVDFRDFKAQCIADVCAC-----NSTSRSDCMCNVLSTYSKACAWNHNITLSWRSPSLCPVTCPSGMEHSECSSACPRDCSNMNSDPNACNSKCVDGCFCPEGKIQDRGKCVDPGQCSCY----HSGIPYAHGAIRKSECSSCLCN-GGMWNCTDTP-CSGTCTMVGNSHFTTFDSRSYSMHGQCDYVL------------------SEHCHFSNDT--TKQFTIHIKISSDGSRQLIVSLAGATPVTLGGVEGS-PTVLNSNGKATSHILSVEHIGVQNVLVHAYAGLTILWTGYNAYITVGPDF-KSQTCGLCGTFNQNDADDFHTRDGDNEADAYAFAQEWQVVSSVAASNCHRSNWNQLDQPCSTYSSNEGYAKSGCNAIIDLNGPFKACHRYVPPQDMYQKCVKDGCMC-----KDCLCSVAAAYAKACADKGIVIDGWRDTISVCKPKFVCPAGTVLKQCNRDPLTRKLRCPSTCDDLANVTDTCPSRRCVEGCYCEKEGELMNNEHKCVDKTQCPCYYGDTMYKYGEIRKDRCNNCTCKGGVFDCTNVDCEAMCL-TRGLVYSDCG---ITCENLHPINGGERPCVSGCYCPDGLIMHDNGTCVQSMQCQCKHNNKYYDAGAI---SPTDCSRKCRGDRYWEQLAGIQAQPE--YECSAFGKGHYRTFDGMLYNFESEGCGYTFMEHE------DVKVVVKNMKCVNSFELQMCKEVTITLVKENVEVVMMQKSFTLKRNGIDTAYNPGSYPPPCKPFLNTYMNTLEIFQVGLFMIVRIVDRVNPNHIKFEIRFDQGTRVYVMANTDYKGTVQGLCGNFDGKDSNDKRTSTGSIATSIPEFADSWRVGSACLDTKTV-SPCVLYPDRKPWADKGCEEIRANPNFTICHDAVNPAPYIEACKYETCMSHMGGDCGAFCSAIAAYVRACNRYGISILWRREGFCGKKINMPMNKSF 1608          

HSP 2 Score: 166.777 bits (421), Expect = 3.256e-41
Identity = 114/385 (29.61%), Postives = 186/385 (48.31%), Query Frame = 2
Query: 1778 GTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKN--ILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQ------DQVQGLCGNYNGNSEDDATKSSGELTTND--NELAVSWAT----AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKN-GLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQ--TNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCS 2881
            G C ISG  H+TTFD +     G+C Y  +    ++   Q+ ++ + N      N A CTKS+ +   D       Q V +++  + V+ +   LP   + P    I++ A   V++ + + + I +    ++ I +P+ Y+       +++GLCGNY+GN+ +D     G   T D  N+  VS              S  Y  V    +   + A++ C  +  + F++C   VD   F  QC  D+C C    + +C C  +++Y +AC  N  +TL WRS SLC   CP+GME+ EC + C   C ++      C+++C+DGC C    + D    +CV+  QC C H    Y  G+ RK +C+ C C  G+W+CT   CS
Sbjct:  476 GLCYISGRGHFTTFDHQEYSFYGTCSYKALIDNSNV--KQIFQVVLNNDKNCDIN-APCTKSVDVNV-DGKKVHLGQEVASRHGFVKVDGVTENLPYTKSWP---NIRQ-AGKYVIVRTSDEVLIYFDGSEELMIKVPDSYKTVNSSDTRLKGLCGNYDGNNTNDFIGLDGTTYTKDNINDFGVSMLDDPLCTNPPKPPSGCYSEVAGDVFSAMQNAEKMCSVIQSDAFSACRSKVDFRDFKAQCIADVCACNSTSRSDCMCNVLSTYSKACAWNHNITLSWRSPSLCPVTCPSGMEHSECSSACPRDCSNMNSDPNACNSKCVDGCFCPEGKIQDRG--KCVDPGQCSCYHSGIPYAHGAIRKSECSSCLCNGGMWNCTDTPCS 850          

HSP 3 Score: 147.902 bits (372), Expect = 1.734e-35
Identity = 130/479 (27.14%), Postives = 204/479 (42.59%), Query Frame = 2
Query: 2894 CPPGKEWKECGH-CDQTCENQ--DGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVR--PKVMENENYPKDRVKGRISFRDL-VSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAA-------KDVPDMCKSNHERQAWADKMCGTM--KNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDY-SWRSN-ELC--PVMCPPEKTFKTCIND-------CPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKC 4252
            CP G E  EC   C + C N   D       C  GCFCP+G +     CV   +C C  S   Y + ++  +  ++CL    CN G W C  +  C G+C   G++H+ TFD + +    +C YV+ +  C       K  T +I+  + G+   + +           + GV   P V+ +       +   +S   + V  ++++  + + + W  G +  I + P +++Q CGLCG F+QN  +DF ++ G+ E +  AF   W+   +  A+         +   C +    + +A   C  +   N  F  C + V  +  YQKC+ D C C      +CLC+  +A+  AC   GI    WR    +C    +CP     K C  D       CP  C   +L N      ++ CVEGC C  E       +KCV + +C C     D  Y  GEI  + C  C C    F C
Sbjct:  759 CPSGMEHSECSSACPRDCSNMNSDPNACNSKCVDGCFCPEGKIQDRGKCVDPGQCSCYHSGIPYAHGAIRKSECSSCL----CNGGMWNC-TDTPCSGTCTMVGNSHFTTFDSRSYSMHGQCDYVLSEH-CHFSNDTTKQFTIHIKISSDGS---RQLIVSLAGATPVTLGGVEGSPTVLNSNGKATSHI---LSVEHIGVQNVLVHAYAGLTILW-TGYNAYITVGPDFKSQTCGLCGTFNQNDADDFHTRDGDNEADAYAFAQEWQVVSSVAASNCHRSNWNQLDQPCSTYSSNEGYAKSGCNAIIDLNGPFKACHRYVPPQDMYQKCVKDGCMCK-----DCLCSVAAAYAKACADKGIVIDGWRDTISVCKPKFVCPAGTVLKQCNRDPLTRKLRCPSTC--DDLANVTDTCPSRRCVEGCYCEKEGELMNNEHKCVDKTQCPCYY--GDTMYKYGEIRKDRCNNCTCKGGVFDC 1215          

HSP 4 Score: 145.976 bits (367), Expect = 7.239e-35
Identity = 116/386 (30.05%), Postives = 173/386 (44.82%), Query Frame = 2
Query: 3176 GSCKSWGDAHYKTFDGKYFDFVSKCSY-VMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPK--------VMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQN------QVCGLCGNFDQNLNNDFKSKAGNY--ENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAW-----ADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACK-KYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDP 4264
            G C   G  H+ TFD + + F   CSY  ++D+   K I  F++V  N +  +    CTKS+      + V L + V  +        V EN  Y     K   + R     +I+ T  ++++Y+D    + I +P  Y+       ++ GLCGN+D N  NDF    G    ++NI  F  S      C      P  C S      +     A+KMC  +++  F+ C+  VD   +  +C++D C+C+     +C+C  LS +  AC   + I  SWRS  LCPV CP       C + CP+ C  SN+N+     C   CV+GC CP   I+  G  KCV   +C C   +S   Y  G I    C  C+CN   + C   P
Sbjct:  476 GLCYISGRGHFTTFDHQEYSFYGTCSYKALIDNSNVKQI--FQVVLNNDKNCDINAPCTKSVDVNVDGKKVHLGQEVASRHGFVKVDGVTENLPY----TKSWPNIRQAGKYVIVRTSDEVLIYFDGSEELMIKVPDSYKTVNSSDTRLKGLCGNYDGNNTNDFIGLDGTTYTKDNINDFGVSMLDDPLCTNPPKPPSGCYSEVAGDVFSAMQNAEKMCSVIQSDAFSACRSKVDFRDFKAQCIADVCACNSTSRSDCMCNVLSTYSKACAWNHNITLSWRSPSLCPVTCPSGMEHSECSSACPRDC--SNMNSDP-NACNSKCVDGCFCPEGKIQDRG--KCVDPGQCSCY--HSGIPYAHGAIRKSECSSCLCNGGMWNCTDTP 848          

HSP 5 Score: 69.3218 bits (168), Expect = 1.664e-11
Identity = 124/501 (24.75%), Postives = 195/501 (38.92%), Query Frame = 2
Query:  392 DCSFRIADEKPCIQGCIRGKCKNGDCLCDSGYEGERCDRAFCQYGCGTGICVEPNVCQCPENFRGRNCETFFREPNTSNLKISDVIN-TKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASES-VTFLGLSNSSTNSNRN-----YISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVI--PYQSICRSELCHCLNAGQNIS--------VCANIACSMGSFKSYQCTLNGKLIN-WRSQL--CAPR-ECPANKEYSECGSS-------CSQNCEDL--ITDENCKSFCTAGCFCPK--DRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISG 1798
            DCS   +D   C   C+ G      C C  G   +R            G CV+P  C C  +          +   +S L    + N T       C+++G S+ TTFD  S     +   +L   C     + + F         K   +    L++  A  + VT  G+  S T  N N     +I S++H  + +   +     L IL+ G  N +I      K   CGLCG F+ N   + +F   +G++  +   F + W+    +  +  +   R     L++   T ++N      G   S C  +  +  P+++      CH     Q++         +C +  CS+ +  +  C   G +I+ WR  +  C P+  CPA     +C          C   C+DL  +TD      C  GC+C K  +   N   CV K QCPC    G++M  Y  G   K  C  C C KGGVF+C  +  C   C+  G
Sbjct:  775 DCSNMNSDPNACNSKCVDG------CFCPEGKIQDR------------GKCVDPGQCSCYHSGIPYAHGAIRKSECSSCLCNGGMWNCTDTPCSGTCTMVGNSHFTTFDSRSYSMHGQCDYVLSEHCHFSNDTTKQF-----TIHIKISSDGSRQLIVSLAGATPVTLGGVEGSPTVLNSNGKATSHILSVEHIGVQNV-LVHAYAGLTILWTG-YNAYITVGPDFKSQTCGLCGTFNQND--ADDFHTRDGDNEADAYAFAQEWQVVSSVAASNCH---RSNWNQLDQPCSTYSSNE-----GYAKSGCNAIIDLNGPFKA------CHRYVPPQDMYQKCVKDGCMCKDCLCSVAAAYAKACADKGIVIDGWRDTISVCKPKFVCPAGTVLKQCNRDPLTRKLRCPSTCDDLANVTDTCPSRRCVEGCYCEKEGELMNNEHKCVDKTQCPCYY--GDTM--YKYGEIRKDRCNNCTC-KGGVFDCTNV-DCEAMCLTRG 1228          

HSP 6 Score: 56.225 bits (134), Expect = 1.302e-7
Identity = 39/106 (36.79%), Postives = 48/106 (45.28%), Query Frame = 2
Query:  314 CQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGCIRGKCKNGDCLCDSGYEGERCDRA----------FCQYGCGTGICVEPNVCQCPENFRGRNCET 601
            C   C NGG CI   +C C   F+G  C  R+ D  PC      G C NG C+C   Y G+ C+            FCQ G   G C  PN C+CP  + G  C+T
Sbjct:  222 CLYPCMNGGSCIN-GKCVCAVGFTGNTCEERLCDP-PCQNS---GTCNNGTCICTKQYTGKSCEHGINLVLSSCVPFCQNG---GTCSSPNTCKCPFAYTGNLCQT 319          
BLAST of Hemocytin vs. Ensembl Nematostella
Match: EDO41877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S313])

HSP 1 Score: 205.682 bits (522), Expect = 1.610e-58
Identity = 117/341 (34.31%), Postives = 184/341 (53.96%), Query Frame = 2
Query: 2963 CLEKGCKSGCFCPDGYLLSN-KTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDC-GKGIGF--FKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRG-VRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPP--QYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQ--KCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNE 3958
            C +  CKSGC CP G +L +   C+ + +CPC  + KSY    VI     +C + CTC    W C + ++C  +C ++GD HYKTFDG+ + F   C+YVM    C G  +    F++  ENI CG+ G +CTKS+     + ++ ++RG   P V +  +      +  + +  L   +II     + + WD+G  + I L P  Q+ ++VCGLCGNFD ++ ND+ +K G  E +   F D+W++R +C    +    CK N  R++ +   C  +K+  F  C   VD + YY+  +C+ DTC CD  GDCEC C A++A+   C   G+   WR ++
Sbjct:    5 CGQVFCKSGCVCPVGSVLDDFGRCILETECPCHHNGKSYKTDDVIRR---DC-NTCTCVRNTWECTK-KRCRATCTAFGDPHYKTFDGRLYSFQGGCNYVMSTDKCPGSKLTLQSFRIDAENIPCGSAGVTCTKSVTVTLHDTIIHMVRGKAVPSVTKVSSLSPVHARYELVYAGLY--VIIKAPFGLNVIWDRGTRLYIELSPDSQHWSKVCGLCGNFDGDMTNDYMAKNGITETSPYPFGDTWRARGDCTKTMEPIHPCKQNKHRESKSHAACAIIKSGTFKPCHISVDPDPYYERCRCVYDTCGCDSVGDCECTCEAIAAYAYECLAAGVVVKWRQDK 338          

HSP 2 Score: 141.739 bits (356), Expect = 1.726e-36
Identity = 106/345 (30.72%), Postives = 161/345 (46.67%), Query Frame = 2
Query: 1574 FCTAGCFCPKDRFWNG-TYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATK--PSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNIL-VNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQ--DQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW-ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCE--HDICLCGGNEKDNCACESMASYGRACMKNGLTLKWR 2581
            FC +GC CP     +    C+ + +CPC   NG S   Y      +RDC  C C +   + C K R C  TC   GDPHY TFD R    +G C Y M   K   S    Q  +I  +N  C  S    CTKS+++   D    T I +V  K +  V K+ +  P+     L       A   V+I++  G+ ++W + T++ I L    Q   +V GLCGN++G+  +D    +G   T+      +W A  +C  T+    +  C ++   E  +   C  +    F  CH+SVDP+P+ ++C   +D C C       C CE++A+Y   C+  G+ +KWR
Sbjct:    9 FCKSGCVCPVGSVLDDFGRCILETECPC-HHNGKS---YKTDDVIRRDCNTCTCVRN-TWECTKKR-CRATCTAFGDPHYKTFDGRLYSFQGGCNYVMSTDKCPGSKLTLQSFRIDAENIPC-GSAGVTCTKSVTVTLHD----TIIHMVRGKAVPSVTKVSSLSPVHARYELVY-----AGLYVIIKAPFGLNVIWDRGTRLYIELSPDSQHWSKVCGLCGNFDGDMTNDYMAKNGITETSPYPFGDTWRARGDCTKTMEP--IHPCKQNKHRESKSHAACAIIKSGTFKPCHISVDPDPYYERCRCVYDTCGCDSVGDCECTCEAIAAYAYECLAAGVVVKWR 335          

HSP 3 Score: 52.7582 bits (125), Expect = 7.057e-7
Identity = 78/354 (22.03%), Postives = 131/354 (37.01%), Query Frame = 2
Query:  500 CDRAFCQYGC---------GTGICVEPNVCQCPENFRGRNCETFFREP-NTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVID-CLSRKPSYRIFFNSSYNCPTKDF-VNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKN----IGDFNQIKGIGELEILYDGKRNVFI-FAPLTMKKS-VCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYW-------KNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTI-LPVIPYQSICR--SELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCA 1477
            C + FC+ GC           G C+    C C  N +    +   R   NT     +    TK +    C+  G  +  TFDG         + ++  D C   K + + F   + N P     V C  S+ +      +  +      + +  + +S +  +      G +  IK    L +++D    ++I  +P +   S VCGLCG FDG+  +++++   NG +  +   F   W       K  +PI P              NK   + ++  C  +  G    C I +   PY   CR   + C C + G     C  IA       +Y+C   G ++ WR   C 
Sbjct:    5 CGQVFCKSGCVCPVGSVLDDFGRCILETECPCHHNGKSYKTDDVIRRDCNTCTCVRNTWECTKKRCRATCTAFGDPHYKTFDGRLYSFQGGCNYVMSTDKCPGSKLTLQSFRIDAENIPCGSAGVTCTKSVTVTLHDTIIHMVRGKAVPSVTKVSSLSPVHARYELVYAGLYVIIKAPFGLNVIWDRGTRLYIELSPDSQHWSKVCGLCGNFDGD--MTNDYMAKNGITETSPYPFGDTWRARGDCTKTMEPIHP-----------CKQNKHRESKSHAACAIIKSGTFKPCHISVDPDPYYERCRCVYDTCGCDSVGDCECTCEAIAAY-----AYECLAAGVVVKWRQDKCG 340          
BLAST of Hemocytin vs. Ensembl Nematostella
Match: EDO41876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S312])

HSP 1 Score: 188.348 bits (477), Expect = 3.380e-52
Identity = 120/376 (31.91%), Postives = 178/376 (47.34%), Query Frame = 2
Query: 1778 GTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNST--FIQLVTTKN-ILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKS-SGELTTNDNELAVSWATAE----CKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFS-LTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDC 2878
            G C   G  HY TFD RHI   G C YT+   +  I G+    + VQN     S    C ++L L  G+        + L+++   I VN      P +  +   + + +V   T++    + + I +   + I++ +   Y++   GLCGN NG  +DD   + + +  T+  E A SWA  E    C+S L ++       S      AK  C  LL E F++CH  VDP PF+++CE D+C C   E   C C+++  Y RAC    + L WRS  LC  +C     Y EC   C  +C +   Q  C   CIDGC C    V     N+C+ ++QC C H    Y +G+T +  CN C C  G W+C+K+ C
Sbjct:    2 GACSTWGQRHYRTFDGRHIDFIGKCSYTLA--QDCIPGSDQFSLHVQNDKTCGSAGMDCERALLLYIGEKTYKVRWLVHLISSHGAIRVNGAKVSAPYKDTN---VEVSKVHSYTIIRSQGDELGIKFDGASSIQVAVSHKYRNNTCGLCGNNNGIPDDDLLMAVTNKPATSVAEFAESWAMPEPNEKCESPLEVTRDVCSNASSVIRDAAKRICMVLLSENFSACHTKVDPVPFVKRCEEDVCSCKFGEHSGCQCQALTEYSRACASREIMLDWRSQHLCPKQCIQPKVYSECGPACVKTCDADGLQPTCHETCIDGCHCPEGTVQTD--NRCLPVNQCPCQHNGITYVTGTTIRVGCNTCKCRGGSWTCSKHRC 370          

HSP 2 Score: 156.762 bits (395), Expect = 2.757e-41
Identity = 112/379 (29.55%), Postives = 176/379 (46.44%), Query Frame = 2
Query: 3173 VGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIE-CGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKG----------RISFRDLVSQLIIYTDSDII-LYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILA-FVDSW---KSRVNCPAAKDVP-DMCK--SNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKC 4252
            +G+C +WG  HY+TFDG++ DF+ KCSY +   DC  G   F L  +N + CG+ G  C +++  Y   +  +    VR  V    ++   RV G           +    + S  II +  D + + +D   SI++A+  +Y+N  CGLCGN +   ++D      N     +A F +SW   +    C +  +V  D+C   S+  R A A ++C  + +  F+ C   VD   + ++C  D CSC  G    C C AL+ +  AC    I   WRS  LCP  C   K +  C   C K C    L  T    C + C++GC CP   ++ +  N+C+  N+C C+  ++   Y  G      C  C C   ++ C
Sbjct:    1 MGACSTWGQRHYRTFDGRHIDFIGKCSYTLAQ-DCIPGSDQFSLHVQNDKTCGSAGMDCERALLLYIGEKTYK----VRWLVHLISSHGAIRVNGAKVSAPYKDTNVEVSKVHSYTIIRSQGDELGIKFDGASSIQVAVSHKYRNNTCGLCGNNNGIPDDDLLMAVTNKPATSVAEFAESWAMPEPNEKCESPLEVTRDVCSNASSVIRDA-AKRICMVLLSENFSACHTKVDPVPFVKRCEEDVCSCKFGEHSGCQCQALTEYSRACASREIMLDWRSQHLCPKQCIQPKVYSECGPACVKTCDADGLQPT----CHETCIDGCHCPEGTVQTD--NRCLPVNQCPCQ--HNGITYVTGTTIRVGCNTCKCRGGSWTC 365          

HSP 3 Score: 122.094 bits (305), Expect = 1.470e-29
Identity = 96/393 (24.43%), Postives = 169/393 (43.00%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASES-----VTFLGLSNSSTNSNRNYISS------IQHKNIGDFNQIKGIG-ELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDP-NTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYT 1813
            CS  G  +  TFDG  I+   + S  L  DC+     + +   +   C +    +C+ +L++    ++     +  L  S+ +   N   +S+      ++   +  +  I+  G EL I +DG  ++ +      + + CGLCG  +G          +  +   +V EF + W  P+P +   +     RD+C+  +  +   A  +C  +   + S C T +  +P+   C  ++C C   G++    +   C   +  S  C     +++WRSQ   P++C   K YSECG +C + C+       C   C  GC CP+        C+P  QCPC + NG   + Y  G + +  C  C+C +GG + C+K R         G PH T
Sbjct:    4 CSTWGQRHYRTFDGRHIDFIGKCSYTLAQDCIPGSDQFSLHVQNDKTCGSAGM-DCERALLLYIGEKTYKVRWLVHLISSHGAIRVNGAKVSAPYKDTNVEVSKVHSYTIIRSQGDELGIKFDGASSIQVAVSHKYRNNTCGLCGNNNGIPD-DDLLMAVTNKPATSVAEFAESWAMPEPNEKCESPLEVTRDVCSNASSVIRDAAKRICMVLLSENFSACHTKVDPVPFVKRCEEDVCSC-KFGEH----SGCQCQALTEYSRACASREIMLDWRSQHLCPKQCIQPKVYSECGPACVKTCDADGLQPTCHETCIDGCHCPEGTVQTDNRCLPVNQCPC-QHNG---ITYVTGTTIRVGCNTCKC-RGGSWTCSKHR-------CPGKPHVT 377          
BLAST of Hemocytin vs. Ensembl Nematostella
Match: EDO33061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST99])

HSP 1 Score: 126.331 bits (316), Expect = 2.106e-31
Identity = 83/276 (30.07%), Postives = 132/276 (47.83%), Query Frame = 2
Query: 3173 VGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENE-NYPKDRVKG-RISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWK----------SRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELC 3964
            +G C S+GD HY+TFDG+ F+F   C Y +V +DC +G    +L +E     N+     KS+  +  + V+ L RG+  KV   E   P  R+   +I  ++ +  L+  T   II  WD    IE+ +  +Y+   CGLCGNF+   ++DF  K G Y  +   F  SW            R   P   +    C+ +      A K C  +K+ +F++C  VV    YY+ C+S+ C C       C C +L  +  AC++ G++ +W   + C
Sbjct:   54 MGICTSYGDPHYQTFDGRMFNFHGNCRYRLV-ADCRQGNFSVRLRSERHH--NQAVGEAKSLVVHIGSTVIHLQRGLVVKVDRKEVQLPYQRLPSLQIDRKNFMITLLSETGVKII--WDGESYIEVHVSHRYRGNTCGLCGNFNGVPSDDFMMKNGRYARSDREFGKSWSLGGHRRRPCLQRAPSPPIAEPISKCRRSALHHWRARKRCWPIKS-QFSNCHPVVKPHKYYKACISEVCKCLVK---RCECESLVTYARACRRMGVNVNWGRKKAC 320          

HSP 2 Score: 117.087 bits (292), Expect = 3.157e-28
Identity = 78/282 (27.66%), Postives = 127/282 (45.04%), Query Frame = 2
Query: 1778 GTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSY---------LGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLC 2596
            G C   GDPHY TFD R     G+C Y +VA      GN  +++  +  H     +A   KSL +  G    ST I L     + V++   +LP Q    L++  +      + + S  G++I+W  ++ IE+ +   Y+    GLCGN+NG   DD    +G    +D E   SW+    +    L           +  C +S  +   A++ C  +  + F++CH  V P+ + + C  ++C C       C CES+ +Y RAC + G+ + W     C
Sbjct:   55 GICTSYGDPHYQTFDGRMFNFHGNCRYRLVAD--CRQGNFSVRLRSERHHNQAVGEA---KSLVVHIG----STVIHLQRGLVVKVDRKEVQLPYQRLPSLQIDRKNF---MITLLSETGVKIIWDGESYIEVHVSHRYRGNTCGLCGNFNGVPSDDFMMKNGRYARSDREFGKSWSLGGHRRRPCLQRAPSPPIAEPISKCRRSALHHWRARKRCWPIKSQ-FSNCHPVVKPHKYYKACISEVCKC---LVKRCECESLVTYARACRRMGVNVNWGRKKAC 320          
BLAST of Hemocytin vs. Ensembl Nematostella
Match: EDO28502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6A3])

HSP 1 Score: 68.5514 bits (166), Expect = 1.459e-13
Identity = 44/118 (37.29%), Postives = 63/118 (53.39%), Query Frame = 2
Query:  251 IKRYKRKCCNGWTGTDCQFPICQQLCKNGGRCIEPDRCQCDPKF-SGADCSFRIADEKPCIQGCIRGKC-KNGDCLCDSGYEGERCDRAFCQYGC-GTGICVEPNVCQCPENFRGRNC 595
            I +   KC   + G  C+FP+C+  C NGGRC++P+ C CD +F +G  C   +    PC+ G   G+C +   C C SGY G+ C++A C+  C   G C+ P  C C   F G  C
Sbjct:   12 IAKNTCKCSQWFVGEQCEFPVCRSTCLNGGRCVKPNVCLCDSRFWTGVRCQLPVC-MFPCLHG---GRCVRPNQCSCQSGYYGKMCEKAICKDSCFNGGRCIRPGTCACAFGFTGPRC 125          

HSP 2 Score: 49.6766 bits (117), Expect = 6.267e-7
Identity = 38/98 (38.78%), Postives = 48/98 (48.98%), Query Frame = 2
Query:  314 CQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGCIRGKC-KNGDCLCDSG-YEGERCDRAFCQYGC-GTGICVEPNVCQCPENFRGRNCE 598
            C   C+NGG CI  + C+C   F G  C F +     C+ G   G+C K   CLCDS  + G RC    C + C   G CV PN C C   + G+ CE
Sbjct:    1 CSPGCRNGGLCIAKNTCKCSQWFVGEQCEFPVCRST-CLNG---GRCVKPNVCLCDSRFWTGVRCQLPVCMFPCLHGGRCVRPNQCSCQSGYYGKMCE 94          
BLAST of Hemocytin vs. Ensembl Medaka
Match: vwf (von Willebrand factor [Source:NCBI gene;Acc:101162365])

HSP 1 Score: 469.929 bits (1208), Expect = 3.885e-135
Identity = 341/1243 (27.43%), Postives = 529/1243 (42.56%), Query Frame = 2
Query:  677 CSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLIN-WRSQL-CAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWAT-AECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLT--QTNCSTE--CIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNV------------------TFCPPGKEWKECG------HCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPP-------------EKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCS--CPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTEN-----CLICVCNENNFKC 4252
            CS+ G  +V TFDG+  E P   S +L  DC  R  +    F++        F+     L +        FL              +      +G +          +  D   N+ +          CGLCG F  N+  + E+    G   E+  +F   W            +     C          ++       G  L    ++P   +  +C++E CHC     N     +  C +    +  C  +G L++ W  +  C P+ CP   +YSEC  SCS  C  L   E CK  C  GC CP  +  +G  CV   +C C     +    +  G +  +DC  C C + G + C    GC G C++ G  H+ +FD +     G C Y +         N    + ++N  C  + DA CT+S++L     +N T ++L     + VN +  + P+       L IQ     +V +   + +R+ W  + ++ + L   +  Q  GLCGNYNGN  DD    SG + T       +W    +C+ST        CA + +  +FA+E C  ++ + F+ CH+ V+P+PF + C +D+C CG  EK  C C ++A+Y  +C   G+ + WRS+ LC+ +C  G  Y  C  +C  +C SL+  +  C  E  C +GC C     Y +   QCV    C C H+   Y       +  + C C NG   C+ ++  ++                    CPP     ECG       C +TC+N D  C+   C  GC CP   +   + C+   +CPC  +++ Y     I T   +C + C C   KW C Q + C G C+S G+ HY TFDG  F F   C YV+V   C    G F+++ EN  CG  G  C K++  +Y+  ++ +  G   +V   +  P+      I      + L+      I L WD+G  + + +   Y+ +VCGLCGNFD N+NNDF S     E +   F +SWK   +C     +P  C  N  +    ++ C  M    F +C   VD E Y + C+   CSC   GDC C C  ++A+  AC + GI  SWRSN+LCP+ C               +  + TC   CP  C      +     C+  CVE C   CP   +  E + +CV  ++C   + N  +  +  ++   +     C IC C  N+  C
Sbjct:   27 CSLFGRYHVHTFDGVLYEFPGDCSYLLAGDCSHRSFTLLGDFHNGKRTGVTLFLGDAFELHLSVDG----FLSQREKRLTLPYASHAVFAGSELGFYKLWSEEFGFTVTIDNAANIALTLSKHHANRTCGLCGNF--NAVTADEYTAQEGLLTEDSYDFANSWAVKGADQSCRRVSNPSKSCNSTKGTEAILSSCSVLKTSGVFLHCAHLVPPEAFLLLCQAEACHC-----NQRDVEDCYCPILLEYARTCHAHGILLHGWLEESKCYPK-CPIGMQYSECTKSCSTTCHSLNIQEVCKDECMDGCTCPAGKVLDGNRCVEVSECSCTHMGRH----FPPGSTVSQDCNTCVC-RHGSWECTN-EGCPGECLVVGQSHFKSFDNKFFTFTGDCQYLLAKD----CVNNEFSVIIENVQCADNQDAVCTRSVTLSLPSLENMT-VKLKHGGVVSVNNMDIQTPMHYG---HLHIQRAVQSSVRLVFSDDLRLDWDGQGRVLLKLTARWTGQTCGLCGNYNGNQGDDFMSDSGLVETKPQAFGQAWKINGDCESTHKYDP-DPCAINPKRVRFAEEACAVIMSDVFSPCHILVNPSPFQRFCRYDVCACGDGEK--CLCSALAAYAASCSAKGVLVNWRSALLCELECSGGQVYEACGTVCDRTCLSLSGAEAGCEGEKVCEEGCFCPVGK-YLSPSGQCVTADLCPCLHDGQLYQPNDVYADHTSICYCENGSMRCSSSEVPSLLSDLFYDEDLGSTRERRSAHCPPPLVRTECGSGKKGLECARTCQNLDLPCVSLSCIPGCLCPPDTVRHRRDCIAPEQCPCYHNNRPYAAGQTITT---DC-NTCVCENRKWRCTQ-KLCDGVCRSVGEGHYITFDGLKFSFPGLCQYVLVQDMCLGEEGSFRVLVENEACGIVGRRCAKAVTVFYQGGLIVMQHG---EVTMKKPVPQSSQVEIIRSGQFYTLLL---GKHISLSWDRGTRLLVHISAAYRGRVCGLCGNFDGNVNNDFMSSNNQLEVDSSHFGNSWKVIPSCADVTQIPLPCSDNIMKLVTVEQSCRLMSGPLFKECNTQVDAEPYVEMCVEAACSCPSVGDCACFCDVVAAYAQACSERGISISWRSNDLCPMSCEELNPKISGVGEELCQWRYNTCGPACPITC-----QHPEPLQCSFTCVEACHAYCPPGQLLDEVAMRCVNPSQCQMCVHNGQRISHGNKVILNHDNPALCKICHCENNSLSC 1223          

HSP 2 Score: 79.337 bits (194), Expect = 4.605e-14
Identity = 98/421 (23.28%), Postives = 154/421 (36.58%), Query Frame = 2
Query: 1772 CSGTCVISGDPHYTTFDKRHIYV--EGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWH-QKTQIEITLP-EFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSC---------FSLTQTN--CSTECIDGCQCKSNMVYD-------TAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTN-GVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFC 2965
            C   C+ S   H   FD   + +  EG C YT++           +K+         S +  C K++ +  G       + L      ++++    LP +      + +       + ++S  G  + +  Q  +  IT        Q  GLCG       +  +  +G  TTN       W  A            VC         A   CQ L  E F  CH  +    F+ +CE   C     E D  ACE +++Y R C + G+ + WRS  LC  KCP+ MEY  C+  C   C         +S+ ++N  C     +GC C    V          A  QCV+      +H  ++ P     +  C  C C +    +CT   C++V       +  ECG C+   E +   C
Sbjct: 1964 CPCMCMGSSTNHVVRFDSLALRLDGEGLCSYTLLTVNSDSGEGSEVKLHTGPCQETTSYNQICMKAMEVTHGPHK----LILRDDMRAMIDREELALPWRFYG---MELMRYGGVMLQLKSNQGYMLTFTPQSNEFTITFQGSTNSAQTAGLCGACGEEKVNILSLRNGSSTTNQPAFISDWTAAGEDGVCLPKRQSVCLSG------AAMGCQALHSEVFLPCHAFIPVQIFLTKCEEQAC----EESD--ACEVISAYARLCRQRGVCVDWRSPHLCPLKCPSSMEYDACRTGCVEDCDSIQALPSDWSVARSNESCMDTPTEGCFCAGGTVLHHGRCVSPEACGQCVDQHGHTYTHMQSWVPD----ENPCLICMCLDQQRINCTARPCNDV-------KAPECGACEILRERKGSMC 2354          

HSP 3 Score: 65.855 bits (159), Expect = 5.471e-10
Identity = 87/385 (22.60%), Postives = 141/385 (36.62%), Query Frame = 2
Query:  674 LCSIMGGSYVTTFDGISIENPLRGSNILVID-CLSRKPSYRIFFNS------SYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPA-------------NKEYSECGSSCSQNC---EDLITDENCKSFCTAGCFCPKDRFWN--GTYCVPKPQCP-CIR-----KNGNSMVVYHQGMSFKRDCEICEC 1732
            +C  +G  +  TFDG+    P     +LV D CL  + S+R+   +         C     V     L++    E      +  SS          ++    G F  +     + + +D    + +      +  VCGLCG FDGN  ++++F + N +   + + F   WK    + P+    T   L    N   + T    C+ + G    +C T +   PY  +C    C C + G     C  +A       +  C+  G  I+WRS    P  C                  Y+ CG +C   C   E L     C   C A  +CP  +  +     CV   QC  C+       +GN +++ H   +    C+IC C
Sbjct:  857 VCRSVGEGHYITFDGLKFSFPGLCQYVLVQDMCLGEEGSFRVLVENEACGIVGRRCAKAVTVFYQGGLIVMQHGEVTMKKPVPQSS---------QVEIIRSGQFYTLLLGKHISLSWDRGTRLLVHISAAYRGRVCGLCGNFDGN--VNNDFMSSNNQLEVDSSHFGNSWK----VIPSCADVTQIPLPCSDNIMKLVTVEQSCRLMSGPLFKECNTQVDAEPYVEMCVEAACSCPSVGDCACFCDVVAA-----YAQACSERGISISWRSNDLCPMSCEELNPKISGVGEELCQWRYNTCGPACPITCQHPEPLQCSFTCVEACHA--YCPPGQLLDEVAMRCVNPSQCQMCVHNGQRISHGNKVILNHDNPAL---CKICHC 1216          

HSP 4 Score: 65.4698 bits (158), Expect = 5.901e-10
Identity = 103/463 (22.25%), Postives = 166/463 (35.85%), Query Frame = 2
Query: 2954 DGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFD--GKYFDFVSKCSYVM--VDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQN------------QVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKC-----FKSNLNNTVL-ENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTEN---CLICVC-NENNFKCRPDP 4264
            + + L+ GC S    P G +      V  HK  C   DK           P      C+C+   W C     C+GS  +    H   FD      D    CSY +  V+SD G+G           E  +    C K++   +    + L   +R  +        DR +  + +R    +L+ Y    + L  ++G  +     PQ               Q  GLCG   +   N    + G+   N  AF+  W +     A +D   + K      + A   C  + +  F  C   +  +++  KC     +C+    CE     +SA+   C++ G+   WRS  LCP+ CP    +  C   C + C       S+ +     E+C     EGC C    +   G  +CV    C   +      Y   + +  +   CLIC+C ++    C   P
Sbjct: 1909 ESWLLDDGCHSLLCHPSGAVT-----VQSHKVSC---DKLEPPACRNNMAPVKVQDTCSCH---WECPC--MCMGSSTN----HVVRFDSLALRLDGEGLCSYTLLTVNSDSGEGSEVKLHTGPCQETTSYNQICMKAMEVTHGPHKLILRDDMRAMI--------DREELALPWRFYGMELMRYGGVMLQLKSNQGYMLTFT--PQSNEFTITFQGSTNSAQTAGLCGACGEEKVNILSLRNGSSTTNQPAFISDWTA-----AGEDGVCLPKRQSVCLSGAAMGCQALHSEVFLPCHAFIPVQIFLTKCEEQ--ACEESDACE----VISAYARLCRQRGVCVDWRSPHLCPLKCPSSMEYDACRTGCVEDCDSIQALPSDWSVARSNESCMDTPTEGCFCAGGTVLHHG--RCVSPEACGQCVDQHGHTYTHMQSWVPDENPCLICMCLDQQRINCTARP 2331          

HSP 5 Score: 53.9138 bits (128), Expect = 2.325e-6
Identity = 63/270 (23.33%), Postives = 98/270 (36.30%), Query Frame = 2
Query:  989 ELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRD-LCTGLNKDLVTTANNM-CQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDL----------ITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQC-PCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNC 1756
            E  I + G  N    A L      CG CG    N          NG S  N   F+  W              G D +C    + +  +   M CQ +       C   +PV  + + C  + C   +A + IS  A +           C   G  ++WRS    P +CP++ EY  C + C ++C+ +           ++E+C    T GCFC      +   CV    C  C+ ++G++       +  +  C IC C      NC
Sbjct: 2091 EFTITFQGSTNSAQTAGL------CGACGEEKVNI-----LSLRNGSSTTNQPAFISDWT-----------AAGEDGVCLPKRQSVCLSGAAMGCQALHSEVFLPCHAFIPVQIFLTKCEEQACEESDACEVISAYARL-----------CRQRGVCVDWRSPHLCPLKCPSSMEYDACRTGCVEDCDSIQALPSDWSVARSNESCMDTPTEGCFCAGGTVLHHGRCVSPEACGQCVDQHGHTYTHMQSWVPDENPCLICMCLDQQRINC 2327          
BLAST of Hemocytin vs. Ensembl Medaka
Match: scospondin (SCO-spondin [Source:NCBI gene;Acc:101172449])

HSP 1 Score: 410.223 bits (1053), Expect = 1.044e-115
Identity = 329/1261 (26.09%), Postives = 523/1261 (41.48%), Query Frame = 2
Query:  806 SSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISS-----IQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTI-LPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCED------LITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIE-ITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQ----TNCSTE-----CIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCP------PGKEWKECGHCDQTCENQDGFCLEKGCK---SGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENE-NYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAA--KDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENC-AKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCR------PDPKCITS----TTSYCIGSKLT-------------------KCENGVC---ARICNGIPEC--SDGSDE 4381
            S++NC  ++F     S ++       T  GLS  +T    + I+      I    +GDF  ++    + + +D    V++        +  GLCG ++ N   +S            +TE + + +     D +     G       +  L   A ++C  +     + C   +    Y   C    C      ++   C  +A       + +C     +I WR+     R CP  + +S+C SSC  +C          T   C+  C  GC CP   F +   C+    CPC  +     + Y  G S ++ C  C C + G + C   R C+G C + G    TTFDK                                            K  SLQ GD     F+  +    + VN +   LP+  +D   L +   +   +L++++ G  +LWH       I L      +V GLCG    +  DD T   G++  + +  A  + +  C +    +    C+   +   +A+  C  +    F  CH  V+  P+ + C  ++C C    + +C C  + +Y + C + G+ + WR+ + C  +C  G  + EC   C  SCF         + S E     C+ GCQC + +V D  + QCV +S C C  ++  Y  G+  +  CN C C +G ++CT+  C +V  CP      P      C   D   + Q     +  C+   SGC CP G       CV   +CPC  + + Y     I    T   + C C + +W C +   C G C + GD HY TFDG+ + F+  C YV+      +  G F +  EN+ CG+ G +CTKS+ F   + ++ L+RG    V       PK      ++   +   + + +   + L WD G+ + + L    + QV GLCGNFD++  NDF +  G+ E+    F +SWK   +CP    +D+ D C + H R  WA K C  +    F+ C   V  + YY  C+ DTC CD GGDCECLCTA++++   C + G+   WRS ELCP+ C     ++ C   C + C   ++       C   +CVEGC CP   I     + C+   +C C+   S   + PG   T+ C  C C E  ++C         P C+ +     T  CI S+                      C NG C   + +C+G P+C  +DGSDE
Sbjct:  124 STWNC--EEFPGLHNSSLMPIEKCCSTLWGLSWKNTWGLVHKITVLFPLWISVHWLGDFVFVESGLGVRLKFDLINTVYLTVTAEHLAATRGLCGVYNNNPEEAS------------LTETVSWLQQ----DCSDAAELGHSCDIVEDLTLRRQAESVCHQLLENPFTHCHFRVDPAAYIDTCLYLYCSLPTRERDGGACDTLA-----TYARECAQQHIIIMWRTPSLCGRVCPRGQVFSDCVSSCPPSCASPHPPGPAATMAQCREECVGGCECPPGLFLHQGTCLKAEDCPCFHRR----LTYQPGDSIQQRCNTCVC-RSGQWQCTGER-CAGQCTLVGALQVTTFDK--------------------------------------------KKYSLQGGD-----FLFQLLKCTVTVNGVRQTLPVVSSD---LAVHRASSSFILVQTF-GALVLWHLDGPFALIHLQPGLAHKVHGLCGTLTWSQHDDFTTPEGDVEMSVSAFAEKFISQPC-TLPKAAPSDPCSTYTQRISYAERVCSVIHNPVFQKCHDVVEKEPYFRLCLSEVCACA--LQRSCHCTVLTAYAQHCAQEGVQVHWRNQTFCPVQCSGGQVFRECGRTCGFSCFDWQHGWLCNDSSGEIGQRVCVPGCQCPTGLVQD-HLGQCVPVSLCPCVQDDKIYSPGTILQNNCNTCVCKHGAFNCTQEHCKSVQQCPGSLVYSPRSCMLTCSSLDHQGQQQSSSVTKPSCREPLSGCVCPQGTFFHGDRCVLPDECPCHHNGQVYYTNETI----TKDCNTCVCQKRRWHCTR-LVCDGVCVATGDPHYVTFDGRRYSFLGDCQYVLAT----ETSGLFSITAENVPCGSTGVTCTKSVTFSLGSTIIHLLRGKAVTVNGMPVTLPKSYSGSGLTLEKVGLFVSLSSRLGVTLMWDGGMRVYVHLAAHLRGQVGGLCGNFDEDTENDFTTHQGSVESTAEVFGNSWKVSPSCPDVENQDLQDPCLNPH-RVTWAKKRCAVLTQDLFSVCHTEVPFQHYYDWCVFDTCGCDSGGDCECLCTAIASYAEECNRRGVYVRWRSQELCPLQCEKGMIYEPCGPACSQSC--PSVQQHSYSRCEVLSCVEGCFCPAGTIHH--GDGCILPLDCPCEWEGS--MFPPGTSITQRCQNCSCVEGLWQCEGVACPASSPPCLEAEFACATGRCIPSQWLCDNEDDCGDGSDEICPSTCSCANGKCLASSHVCDGRPDCGFADGSDE 1282          

HSP 2 Score: 91.2781 bits (225), Expect = 9.400e-18
Identity = 104/421 (24.70%), Postives = 166/421 (39.43%), Query Frame = 2
Query:  542 CVEPNVCQCPENFRGRNC-ETFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDF-VNCDTSLMIETASESVTFLGLSNSSTNSNRNYI------SSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTE-FMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITD--ENCKSF-CTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKI 1765
            CV P+ C C  N +     ET  ++ NT   +      T+     +C   G  +  TFDG           +L  +      +  +F  ++ N P     V C  S+     S  +  L     + N     +      S +  + +G F  +     + +++DG   V++     ++  V GLCG FD ++   ++F    G S+E+  E F   WK   P  P+      +D C  LN   VT A   C  +     S C T +P   Y   C  + C C + G    +C  IA       + +C   G  + WRSQ   P +C     Y  CG +CSQ+C  +       C+   C  GCFCP     +G  C+    CPC  +      ++  G S  + C+ C C + G++ C  +
Sbjct:  810 CVLPDECPCHHNGQVYYTNETITKDCNTCVCQKRRWHCTRLVCDGVCVATGDPHYVTFDGRRYSFLGDCQYVLATE------TSGLFSITAENVPCGSTGVTCTKSVTFSLGSTIIHLLRGKAVTVNGMPVTLPKSYSGSGLTLEKVGLFVSLSSRLGVTLMWDGGMRVYVHLAAHLRGQVGGLCGNFDEDT--ENDFTTHQG-SVESTAEVFGNSWKV-SPSCPDVENQDLQDPC--LNPHRVTWAKKRCAVLTQDLFSVCHTEVPFQHYYDWCVFDTCGCDSGGDCECLCTAIA-----SYAEECNRRGVYVRWRSQELCPLQCEKGMIYEPCGPACSQSCPSVQQHSYSRCEVLSCVEGCFCPAGTIHHGDGCILPLDCPCEWEGS----MFPPGTSITQRCQNCSCVE-GLWQCEGV 1208          

HSP 3 Score: 53.5286 bits (127), Expect = 2.830e-6
Identity = 32/98 (32.65%), Postives = 46/98 (46.94%), Query Frame = 2
Query: 1463 SQLCAPRECPANKEYSECGSSCSQNCEDLITDENCK--SFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVF 1750
            ++ C  + CPA++E+  C S C Q C DL     C+  + C  GC CPK +      CV   QC C+   G    ++  G   + DC  C CS G + 
Sbjct: 3398 TKPCEGKRCPASQEFDPCASQCPQRCSDLQQGLQCQGDTECQPGCRCPKGQLQQDGLCVEVWQCDCVDSAGQ---IWAAGSWHQVDCNNCSCSDGKLL 3492          
BLAST of Hemocytin vs. Ensembl Medaka
Match: otog (otogelin [Source:NCBI gene;Acc:101158818])

HSP 1 Score: 364.385 bits (934), Expect = 2.180e-101
Identity = 305/1151 (26.50%), Postives = 474/1151 (41.18%), Query Frame = 2
Query:  617 NTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIF-FNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQH----KNIGDFNQIKGIGELEILYDGKR-NVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRE---CPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWH-QKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSY-LGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSS-SLCDPKCPNGMEYMECKNLCSVSCFSLTQTN-CSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKN-DCSNVTF------CPPGKEWKECGHCDQTCENQDGFCLEKGCKS---------------GCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELC 3964
            + + L+   V+N  ++    C   G     TFDG+    P R S  L+ D      S+ +F  ++   C +  +  C  S+ I    E    L  SN +    R  +    H    + I  +  +       + ++G+  +V+I          CGLCG F  N+ +  +     G    +V  F   W   DP   NT    G    +      V+      ++V       C++L   P+QS      CH       +S    +A        Y+           S    PR    CPA  +Y EC S C   C    T  + +  C  GC+CP    +    CV    CPC        V Y  G   + +C  C C  GGV+NC     C G C ++GD  + +FD R      SC Y +V ++  ++G     + +QN  C    D  C +S+SL   D D  T + L     + +     R+ L   D +   IQE++   + + +  G+++ +   + ++ +   E ++D   GLCG +NGN +DD    SG + +       SW  +   S+      +  C    +   +A   C  L  + F +CH  + P PF QQC  + C CG      C C ++A Y R C K  + + +RS    C   CP  MEY  C + C   C SL     C  EC +GC C     Y+   + CV+ SQC CS   A Y  G    +           WS T    CS  +F      CP G+ ++ C   D       G   E+ C+S               GC CP G L     C     CPCLW  K Y     +    ++   +C C +G + C   + C   C ++GD HY+TFDG  FD+V  C   +V S        F +  EN++C + G  C K +       ++ L   +      N +   DR +    ++  +  ++ + + DI + WD   ++ + + P +Q ++ GLCGNFD    N+ ++           F +SW +   C  + D+   C  N  R+ +A   C  + +  F  C  VVD   +Y+ CL+DTC+C RGGDCEC C++++A+   C   G+   WRS  LC
Sbjct:  141 HATGLRCQTVVNLGFEREMTCRTWGQYNFETFDGLYYYFPGRCSYTLLKD---SHISFFVFKVHNDPECSSAPY-TCQRSVSIFLPWEGEIRLHASNVTFKGRRLQLPHHLHHLQLEQISQYVLVTQQQGFTLAWEGRTGSVYIKLSPDFVGGTCGLCGNF--NAEVQDDMTTSYGLLTHDVEMFGNSWMEMDPHQ-NTCPPVGSSFPSPYRPFPVSV--QRVEEV-------CSMLLSPPFQS------CH-----DFVSPLPYMASYYWKKDYYRIFFGTCFFCDASLFLPPRSVPPCPAGLQYRECISCCPATCSLERTCIDSRLACLDGCYCPDGLIFQDGGCVEASDCPCEHHG----VFYPAGQMLQEECNNCTC-VGGVWNCTD-HSCPGECSVTGDMFFQSFDGRIFTFPASCQYVLVKSR--LSGK--FTVTIQNAPCGPDLDGACIQSVSLVV-DEDPRTEMTLSHMGEVFMAGQ-YRISLPYYDDV-FHIQELSSMFLQVRTAFGLQLQYSWAEFRLYLQAEERWKDDTVGLCGTFNGNIQDDFLSPSGMIESTPQLFGNSWKVSSACSSSLSVSPIDPCDSHQQAVSYASSMCDVLNQDLFAACHDYLSPAPFHQQCRANTCRCG----TPCLCSTLAHYARHCRKFSVIVDFRSHIPDCAVSCPATMEYSSCVSSCQRRCSSLAALQRCGEECEEGCACPQGSFYNHRTHTCVHRSQCPCSLFGADYEPGDLPAQLS---------WSLTGFLKCSGFSFFLPERLCPAGQLYQNCSDGDDAFLPGRGVACERTCESHLLNIPCSSHDSCVSGCVCPHGLLKHGDECFEPAACPCLWKGKEYFPGDRV----SSPCYQCACQDGTFQCA-FRPCPSMCTAYGDRHYRTFDGLLFDYVGACKVYLVKSSAD---AVFSVTAENVDCFDTGVICKKYLLINVGASLLSLDDHMG---KPNPSSVIDRNQRLFIWQAGLFTVVHFPEEDITVLWDHKTTVHVQVGPHWQGRLSGLCGNFDLKTVNEMRTPENMDSPTPQEFGNSWTA-TECVNSPDIRHPCSLNPLREPYAKHQCAVLLSEVFQTCHPVVDVSWFYENCLADTCACSRGGDCECFCSSVAAYAQRCCHEGVPVDWRSPSLC 1226          

HSP 2 Score: 167.162 bits (422), Expect = 9.828e-41
Identity = 122/455 (26.81%), Postives = 210/455 (46.15%), Query Frame = 2
Query: 2882 NVTFCPPGKEWKECGHCDQTCENQDGFCLEK--GCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECG-NKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIE---------IALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVP--DMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSN-ELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEI 4201
            +V  CP G +++EC  C     + +  C++    C  GC+CPDG +  +  CV    CPC      Y    ++     NC    TC  G W C  +  C G C   GD  +++FDG+ F F + C YV+V S   +  G F +  +N  CG +   +C +S+       V +  R         E +   + +  + + D V  +   +   + +    GL ++         +    ++++   GLCG F+ N+ +DF S +G  E+    F +SWK    C ++  V   D C S+ +  ++A  MC  +    FA C   +    ++Q+C ++TC C       CLC+ L+ +   C+K+ +   +RS+   C V CP    + +C++ C ++C  S+L    L+ C + C EGC+CP        ++ CV  ++C C L  +D  Y PG++
Sbjct:  409 SVPPCPAGLQYRECISCCPATCSLERTCIDSRLACLDGCYCPDGLIFQDGGCVEASDCPCEHHGVFYPAGQMLQEECNNC----TCVGGVWNCT-DHSCPGECSVTGDMFFQSFDGRIFTFPASCQYVLVKS---RLSGKFTVTIQNAPCGPDLDGACIQSVSLV----VDEDPRTEMTLSHMGEVFMAGQYRISLPYYDDVFHIQELSSMFLQVRTAFGLQLQYSWAEFRLYLQAEERWKDDTVGLCGTFNGNIQDDFLSPSGMIESTPQLFGNSWKVSSACSSSLSVSPIDPCDSHQQAVSYASSMCDVLNQDLFAACHDYLSPAPFHQQCRANTCRCGT----PCLCSTLAHYARHCRKFSVIVDFRSHIPDCAVSCPATMEYSSCVSSCQRRC--SSL--AALQRCGEECEEGCACPQGSFYNHRTHTCVHRSQCPCSLFGAD--YEPGDL 841          

HSP 3 Score: 86.2705 bits (212), Expect = 3.406e-16
Identity = 86/373 (23.06%), Postives = 147/373 (39.41%), Query Frame = 2
Query: 3179 SCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTEN-IECGNKGTSCTK--SIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSD-IILYWD-KGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSW----KSRVNC-PAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVD-----TELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKC 4252
            +C++WG  +++TFDG Y+ F  +CSY ++       I FF     N  EC +   +C +  SIF  +  +    IR     V       +          + +SQ ++ T      L W+ +  S+ I L P +    CGLCGNF+  + +D  +  G   +++  F +SW      +  C P     P   +         +++C  + +  F  C   V         Y++K                       F+  C  +  D S          CP    ++ CI+ CP  C   +L  T +++    C++GC CP   I  +G   CV+ ++C C+  +    Y  G++  E C  C C    + C
Sbjct:  160 TCRTWGQYNFETFDGLYYYFPGRCSYTLLKD---SHISFFVFKVHNDPECSSAPYTCQRSVSIFLPWEGE----IRLHASNVTFKGRRLQLPHHLHHLQLEQISQYVLVTQQQGFTLAWEGRTGSVYIKLSPDFVGGTCGLCGNFNAEVQDDMTTSYGLLTHDVEMFGNSWMEMDPHQNTCPPVGSSFPSPYRPFPVSVQRVEEVCSMLLSPPFQSCHDFVSPLPYMASYYWKK------------------DYYRIFFGTC--FFCDASLFLPPRSVPPCPAGLQYRECISCCPATC---SLERTCIDS-RLACLDGCYCPDGLIFQDGG--CVEASDCPCE--HHGVFYPAGQMLQEECNNCTCVGGVWNC 497          

HSP 4 Score: 56.9954 bits (136), Expect = 2.430e-7
Identity = 73/354 (20.62%), Postives = 136/354 (38.42%), Query Frame = 2
Query: 3182 CKSWGDAHYKTFDGKYFDFVSKCSYVMV---DSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGR-ISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFK----SKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGT----MKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPT-EYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIF 4204
            C  + D +  TFDG          Y++    +      +      +E++   N    C  S+   +++  V LI  ++ ++  N  Y K R K       D  +  +I + + + L W     + + +    +    GLCG  D +  +D      S  G  E+  L F+DSW+       +     + +S       +   C T    ++N  F  C   V    + +  + D+   +        C AL+A+ ++C K+ I   WR    CP +C     ++ C+  C  +   ++  +   E C+    EGC CP    +  + S  C+   +C C       + N GE++
Sbjct: 2119 CSMFPDLNVITFDGNSVAIYKAALYIVTQLPNETVTVMVQECPADSESLLLWNFTNLCLVSLNITHQSNHV-LINRLQRRLYVNTRYAKARFKKYGFEIYDTGNMYLIRSPAGLKLQWYHSTGM-MVIETDSKVPTMGLCGVCDGDPTDDLTLPNGSVLGAGEDPAL-FIDSWQ------VSNTTSYISQSRRRDLNCSTSDCSTCLSMLENATFTACHAFVPPSTFCEVWVRDSEYVNNQ------CVALAAYVASCHKFNICIEWRRPNYCPFICAATLRYQACLPACTSQSCPNHDFDADPEQCS-GLTEGCVCPEGTLLHRQYSALCIPPEKCACTDSAGVPRAN-GEVW 2455          

HSP 5 Score: 52.373 bits (124), Expect = 7.126e-6
Identity = 89/396 (22.47%), Postives = 156/396 (39.39%), Query Frame = 2
Query: 1772 CSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTK---NILVNKIPNRLPLQIN------DPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAV---SWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP-FNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLC-SVSC----FSLTQTNCSTECIDGCQC-KSNMVYDTAVNQCVNISQCQCSHENAYYP--SGSTRKEKCNDC---NCTNGVWSCTKNDCSNV 2887
            C   C +  D +  TFD   + +  +  Y +V   P    N+ + + VQ   C   ++       SL   +  N   + L  T    ++L+N++  RL +               I +   +  LI S  G+++ W+  T + +   +  +    GLCG  +G+  DD T  +G +     + A+   SW  +   S +S S      +           C  +L    F +CH  V P+ F +    D      +E  N  C ++A+Y  +C K  + ++WR  + C   C   + Y  C   C S SC    F      CS    +GC C +  +++      C+   +C C+ ++A  P  +G   K   + C    C N      ++DCS +
Sbjct: 2115 CPCRCSMFPDLNVITFDGNSVAIYKAALY-IVTQLP----NETVTVMVQE--CPADSE-------SLLLWNFTNLCLVSLNITHQSNHVLINRLQRRLYVNTRYAKARFKKYGFEIYDTG-NMYLIRSPAGLKLQWYHSTGMMVIETD-SKVPTMGLCGVCDGDPTDDLTLPNGSVLGAGEDPALFIDSWQVSNTTSYISQSR----RRDLNCSTSDCSTCLSMLENATFTACHAFVPPSTFCEVWVRD------SEYVNNQCVALAAYVASCHKFNICIEWRRPNYCPFICAATLRYQACLPACTSQSCPNHDFDADPEQCS-GLTEGCVCPEGTLLHRQYSALCIPPEKCACT-DSAGVPRANGEVWKASRDGCCMYRCDNDTILPVQDDCSRL 2482          
BLAST of Hemocytin vs. Ensembl Medaka
Match: zanl (zonadhesin [Source:NCBI gene;Acc:101162078])

HSP 1 Score: 302.753 bits (774), Expect = 3.862e-82
Identity = 328/1293 (25.37%), Postives = 508/1293 (39.29%), Query Frame = 2
Query:  659 YKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDC-LSRKPSYRIFFNSS--YNCPTKDFVNCDTSL--MIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHC-LNAGQNISVCANIACSMGSFKSYQCTLNGKLIN-----------WRSQ-LCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQ-GMSFK-RDCEI-CECSKGGVF----NCAKIRGCS------------GTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLG--VCAKSYEYEKFAKEFCQRL--LYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTL-KWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQT-NCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENA-YYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECG-HCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKW-------GCEQEQKC------------VGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGT-SCTKSIFFYYRNQVVQLIRGVRPKV-MENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTM--KNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYS-WRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPG-EIFTENCLICVCNENNFKCRPDPKCITSTTSYCIGSKLTKCENG 4327
            Y     C   G  + TTFD          S ++   C  +  P + +  ++   YN PT  ++        M++ +      + ++ ++ N   N    +     G    +     + + YDG   + I   +  +  +CGLCG ++GNS    +F+  +G    +  EF   W N DP             C       +       Q+++ G    C IL            +CH  +N       C    C +   K   C      +N           WR++  C   +CP+N  Y  C   C   C       +C   C+ GC C      +   CV    C C   NG     Y Q G  F   DC++ C C    V     +C  +  C               C++SGDPHY TFDK+     G+C YT+  T      +    +  +N     S  +Y  K        T N   + L+ +K  LVN      P   ++P  L    ++   V++++  G+R+ W      +I++P  Y DQ+ GLCG+Y+GN+ +D TK  G    N N+   SW T E +   S        C    E E    + C ++     PF  C   VDP PF Q C +D+C   G  + +  C+ + +Y  AC   G T+  WR+   C   CP    Y  C + C  +C  +  +  C   C++GC+C    +   + ++CV +  C C   +  Y+P                               CPP  E+ ECG  C  TC+     C    C SGCFC  G++     CVP  KC CL  D +Y     +  G   C   C C  G +        C+  ++C              +C + GD HY TFD   +DF+  CSYVM        + FF++  +N    N  T S  K++  Y     + +++G   +V   N N P +     +S         +     + + +D    ++I +  +YQ+++CGLCG+++ N  +DF+   G   N+   F  SW +             C+     Q   +  CG +  KN  FA C   V+   Y+Q CL D C  +  G    LC A+ A+ + C+  G+D   WR+   C + CPP   ++ C + C   C      +    +C   C EGC C   Y+ + G  KCVK   C CK  N  + Y PG E + E+C          KCR D   +T   S C      K ++G
Sbjct: 1409 YPKTSTCIASGDPHYTTFDKRKYNFMGNCSYVMSGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPVNPTPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSK--DDFQKPDGTMTNDANEFGHSW-NTDP-------------CNKQPNATIPGCEPGEQELYEG---YCGIL----LDKNSPFAVCHGKVNPNNYFQDCLFDLCELEGAKPILCEAIEAYVNECQDRGVDIGPWRNETFCL--KCPSNSHYEPCADPCQDTCSG--KPSSCGGACSEGCVCDPGYVLSAGKCVKSDSCGCKHTNGQ---YYEQPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSIQDCIVSGDPHYNTFDKKFYSFMGTCTYTLART--CRNDSPWFSVEGKNEERGASGVSYLKKLYV-----TVNDITVTLMKSKRTLVNGKRVAFP---HNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVPS-YHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVIKPDKCGKIEDPSGPF-ECIGVVDPEPFFQSCVYDMCQFNG--ELHVLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCPANSSYSLCVSSCPETCLGVIGSPGCEDVCVEGCECDPGFIL--SDDKCVPLKDCGCVDTSGTYHPP------------------------------CPPNAEYIECGPACIPTCQEPSTNC-SGSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLG-DGCSKLCRC-AGNYTLECTDNSCDPSEECREVNGIPSCYPKTSTCIASGDPHYTTFDKHRYDFMGNCSYVMSGICNTTSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAP-EVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPG--EQELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCELE--GAKPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPPNSHYEPCADPCQDTC------SGKPSSCGGACSEGCVCDPGYVLSAG--KCVKRESCGCKHTNG-QYYEPGEEFYVEDC--------KLKCRCDSPFVTCVASDCPPMHECKLQDG 2596          

HSP 2 Score: 174.096 bits (440), Expect = 8.385e-43
Identity = 146/497 (29.38%), Postives = 214/497 (43.06%), Query Frame = 2
Query: 1481 RECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRD--CEICECSKGGVFNCAK--------------IRGC---SGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTL-KWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYY--PSGSTRKEKCN-DCNCTNGVWSCTKNDCSNVTFC 2896
            + CP N EY ECG +C   C++  T  NC   C +GCFC     + G  CVP  +C C+ ++GN    Y  G     D   ++C C       C                + GC   + TC+ SGDPHYTTFDK      G+C Y M     + T     ++   N +   S      K++ +      +   I ++    + VN     LPL    P     Q   H TV +    G+ + +     ++I + + YQD++ GLCG+YNGNS+DD  K  G +T + NE   SW T  C    + +  G      E     + +C  LL +  PF  CH  V+PN + Q C  D+C   G +     CE++ +Y   C   G+ +  WR+ + C  KCP    Y  C + C  +C S   ++C   C +GC C    V   +  +CV    C C H N  Y  P      E C   C C +   +C  +DC  +  C
Sbjct:  320 KPCPPNAEYIECGPACIPTCQEPST--NCSGSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGN---YYEPGEVVLGDGCSKLCRCVGNYTLECTDNSCDPSEECREVNGVPGCYPKTSTCIASGDPHYTTFDKHRYDFMGNCSYLMSGIC-NATSLPFFEVHADNENRYNSPTISYLKAVHVYV----HMVKISILKGGVVQVNGTNVNLPLNPA-PEVSVFQSGKHYTVSMTF--GVTVRYDGNHFMDIKVIK-YQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGEQE---LYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCELEGAKP--ILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPPNSHYEPCADPCQDTC-SGKPSSCGGACSEGCVCDPGYVL--SAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHEC 793          

HSP 3 Score: 171.785 bits (434), Expect = 3.884e-42
Identity = 145/493 (29.41%), Postives = 214/493 (43.41%), Query Frame = 2
Query: 1496 NKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRD--CEICECSKGGVFNCAK--------------IRGC---SGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTL-KWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYY---PSGSTRKEKCN-DCNCTNGVWSCTKNDCSNVTFC 2896
            N EY ECG +C   C++  T  NC   C +GCFC     + G  CVP  +C C+ ++GN    Y  G     D   ++C C+      C                I GC   + TC+ SGDPHYTTFDKR     G+C Y M     + T     ++   N +   S      K++ +      +   I ++    + VN     LP+    P     Q   H TV +    G+ + +     ++I + + YQD++ GLCG+YNGNS+DD  K  G +T + NE   SW T  C    + +  G      E     + +C  LL +  PF  CH  V+PN + Q C  D+C   G +     CE++ +Y   C   G+ +  WR+ + C  KCP+   Y  C + C  +C S   ++C   C +GC C    V   +  +CV    C C H N  Y   P      E C   C C +   +C  +DC  +  C
Sbjct: 1305 NAEYIECGPACIPTCQEPST--NCSGSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGN---YYEPGEVVLGDGCSKLCRCAGNYTLECTDNSCDPSEECREVNGIPGCYPKTSTCIASGDPHYTTFDKRKYNFMGNCSYVMSGIC-NATSLPFFEVHADNENRYNSPTISYLKAVHVYV----HMVKISILKGGVVQVNGTNVNLPVNPT-PEVSVFQSGKHYTVSMTF--GVTVRYDGNHFMDIKVIK-YQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGEQE---LYEGYCGILLDKNSPFAVCHGKVNPNNYFQDCLFDLCELEGAKP--ILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPSNSHYEPCADPCQDTC-SGKPSSCGGACSEGCVCDPGYVL--SAGKCVKSDSCGCKHTNGQYYEQPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHEC 1774          

HSP 4 Score: 169.859 bits (429), Expect = 1.328e-41
Identity = 188/750 (25.07%), Postives = 301/750 (40.13%), Query Frame = 2
Query:  647 INTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDC-LSRKPSYRIFFNSS--YNCPTKDFVNCDTSL--MIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC--TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLIN-WRSQ-LCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFK-RDCEI-CECSKGGVF----NCAKIRGC------------SGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLG--VCAKSYEYEKFAKEFCQRL--LYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTL-KWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQT-NCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYY 2797
            I + Y     C   G  + TTFD    +     S ++   C  +  P + +  ++   YN PT  ++        M++ +      + ++ ++ N   N    +     G    +     + + YDG   + I   +  +  +CGLCG ++GNS    +F+  +G    +  EF   W N DP +     T     C    ++L      +  D   G  + C   + P   +Q  C  +LC    A         I C        +C   G  I  WR++  C   +CP N  Y  C   C   C       +C   C+ GC C      +   CV +  C C   NG     Y  G  F   DC++ C C    V     +C  +  C            S  C++SGDPHY TFDK++    G+C YT+  T      +    +  +N     S  +Y  K        T N   + L+ +K  LVN      P   ++P  L    ++   V++++  G+R+ W      +I++P  Y DQ+ GLCG+Y+GN+ +D TK  G    N N+   SW T E +   S        C    E E    + C ++  L  PF  C   VDP PF Q C +D+C   G  + +  C+ + +Y  AC   G T+  WR+   C   CP    Y  C + C  +C  +  +  C   C++GC+C    +   + ++CV++  C C   +  Y
Sbjct: 2223 IPSCYPKTSTCIASGDPHYTTFDKHRYDFMGNCSYVMSGICNTTSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSK--DDFQKPDGTMTNDANEFGHSW-NTDPCNKQPNATIPG--CEPGEQELYEGYCGILLDK-NGPFAVCHGKVNPNNYFQD-CLFDLCELEGA-------KPILCEAIEAYVNECQDRGVDIGPWRNETFCL--KCPPNSHYEPCADPCQDTCSG--KPSSCGGACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQ---YYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSSQDCIVSGDPHYNTFDKKYYSFMGTCTYTLART--CRNDSPWFSVEGKNEERGASGVSYLKKLYV-----TVNDITVTLMKSKRTLVNGKRVAFP---HNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVPS-YHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDLSGPF-ECIGVVDPEPFFQSCVYDMCQFNG--ELHVLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCPANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPGFIL--SDDKCVSLKDCGCVDTSGTY 2933          

HSP 5 Score: 165.236 bits (417), Expect = 4.023e-40
Identity = 133/492 (27.03%), Postives = 214/492 (43.50%), Query Frame = 2
Query: 2822 KCNDCNCTNGVWSCTKNDCSNVTFC---PPGKEWKECGH-CDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYL-----------------NQSVIYTGPTNC--LSKCTCNEGKWGC-EQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCP--AAKDVPDM-CKSNHERQAWADKMCGTMKNVKFA-DCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGID-YSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTE 4210
            +C D     G W        N TFC   PP   ++ C   C  TC  +   C    C  GC C  GY+LS   CV +  C C  ++  Y                  +   +    ++C  + +C   +G+ GC    Q C+ S    GD HY TFD KY+ F+  C+Y +  + C     +F +  +N E G  G S  K ++    +  V L++  R  V              +S       +I+ T   + + WD     +I++P  Y +Q+CGLCG++D N  NDF    G    N+  F +SW++  +    +    PD+ C    E +      CG ++++    +C  VVD E ++Q C+ D C  +  G+   LC  L A+  AC+  G   + WR+ + C + CP   ++  C++ CP+ C    L       C   CVEGC C   +I ++  +KCV   +C C   ++   Y+P ++  E
Sbjct: 2475 ECQDRGVDIGPWR-------NETFCLKCPPNSHYEPCADPCQDTCSGKPSSC-GGACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSSQDCIVS----GDPHYNTFDKKYYSFMGTCTYTLART-CRNDSPWFSVEGKNEERGASGVSYLKKLYVTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDLSGPFECIGVVDPEPFFQSCVYDMCQFN--GELHVLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCPANSSYSLCVSSCPETC----LGVVGSPGCEDVCVEGCECDPGFILSD--DKCVSLKDCGCV--DTSGTYHPFQVDDE 2941          

HSP 6 Score: 164.851 bits (416), Expect = 4.451e-40
Identity = 187/752 (24.87%), Postives = 301/752 (40.03%), Query Frame = 2
Query:  659 YKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDC-LSRKPSYRIFFNSS--YNCPTKDFVNCDTSL--MIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC--TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLIN-WRSQ-LCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFK-RDCEI-CECSKGGVF----NCAKIRGCS------------GTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLG--VCAKSYEYEKFAKEFCQRL--LYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTL-KWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQT-NCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENA-YYPSGST 2812
            Y     C   G  + TTFD    +     S ++   C  +  P + +  ++   YN PT  ++        M++ +      + ++ ++ N   N    +     G    +     + + YDG   + I   +  +  +CGLCG ++GNS    +F+  +G    +  EF   W N DP +     T     C    ++L      +  D   G  + C   + P   +Q  C  +LC    A         I C        +C   G  I  WR++  C   +CP N  Y  C   C   C       +C   C+ GC C      +   CV +  C C   NG     Y  G  F   DC++ C C    V     +C  +  C               C++SGDPHY TFDK +    G+C YT+  T      +    +  +N     S  +Y  K        T N+  + L+ ++  LVN      P   ++P  L    ++   V++++  G+R+ W      +I++P  Y DQ+ GLCG+Y+GN+ +D TK  G    N N+   SW T E +   S        C    E E    + C ++     PF  C   VDP PF Q C +D+C   G  + +  C+ + +Y  AC   G+T+  WR+   C   CP    Y  C + C  +C  +  +  C   C++GC+C    +   + ++CV +  C C   +  Y+P  ST
Sbjct:  429 YPKTSTCIASGDPHYTTFDKHRYDFMGNCSYLMSGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSK--DDFQKPDGTMTNDANEFGHSW-NTDPCNKQPNATIPG--CEPGEQELYEGYCGILLDK-NGPFAVCHGKVNPNNYFQD-CLFDLCELEGA-------KPILCEAIEAYVNECQDRGVDIGPWRNETFCL--KCPPNSHYEPCADPCQDTCSG--KPSSCGGACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQ---YYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKMQDGKLGCYPSFQDCIVSGDPHYNTFDKNYYTFMGTCTYTLART--CRNDSPWFSVEGKNEERGVSGVSYLKKLYV-----TVNNITVTLMKSRTTLVNGKRVAFP---HNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVPS-YHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDPSGPF-ECIGVVDPEPFFQSCVYDMCQFNG--ELHVLCDQLQAYTDACQSAGVTVHHWRAPDFC-LDCPANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPGFIL--SDDKCVPLKDCGCVDTSGTYHPRPST 1141          

HSP 7 Score: 162.925 bits (411), Expect = 1.727e-39
Identity = 143/504 (28.37%), Postives = 215/504 (42.66%), Query Frame = 2
Query: 2894 CPPGKEWKECG-HCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKW-------GCEQEQKC------------VGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGT-SCTKSIFFYYRNQVVQLIRGVRPKV-MENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTM--KNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYS-WRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPG-EIFTENCLICVCNENNFKCRPDPKCITSTTSYCIGSKLTKCENG 4327
            CPP  E+ ECG  C  TC+     C    C SGCFC  G++     CVP  KC CL  D +Y     +  G   C   C C  G +        C+  ++C              +C + GD HY TFD   +DF+  CSY+M        + FF++  +N    N  T S  K++  Y     + +++G   +V   N N P +     +S         +     + + +D    ++I +  +YQ+++CGLCG+++ N  +DF+   G   N+   F  SW +             C+     Q   +  CG +  KN  FA C   V+   Y+Q CL D C  +  G    LC A+ A+ + C+  G+D   WR+   C + CPP   ++ C + C   C      +    +C   C EGC C   Y+ + G  KCVK   C CK  N  + Y PG E + E+C          KCR D   +T   S C      K ++G
Sbjct:  322 CPPNAEYIECGPACIPTCQEPSTNC-SGSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLG-DGCSKLCRC-VGNYTLECTDNSCDPSEECREVNGVPGCYPKTSTCIASGDPHYTTFDKHRYDFMGNCSYLMSGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAP-EVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPG--EQELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCELE--GAKPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPPNSHYEPCADPCQDTC------SGKPSSCGGACSEGCVCDPGYVLSAG--KCVKRESCGCKHTNG-QYYEPGEEFYVEDC--------KLKCRCDSPFVTCVASDCPPMHECKMQDG 798          

HSP 8 Score: 161.384 bits (407), Expect = 4.947e-39
Identity = 133/487 (27.31%), Postives = 213/487 (43.74%), Query Frame = 2
Query: 2822 KCNDCNCTNGVWSCTKNDCSNVTFC---PPGKEWKECGH-CDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYL-----------------NQSVIYTGPTNC--LSKCTCNEGKWGCEQE-QKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQ-LIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCP--AAKDVPDM-CKSNHERQAWADKMCGTMKNVKFA-DCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGID-YSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNP 4192
            +C D     G W        N TFC   PP   ++ C   C  TC  +   C    C  GC C  GY+LS   CV +  C C  ++  Y                  +   +    ++C  + +C   +GK GC    Q C+ S    GD HY TFD  Y+ F+  C+Y +  + C     +F +  +N E G  G S  K ++    N  V L++  R  ++  +          +    L  Q +I+ T   + + WD     +I++P  Y +Q+CGLCG++D N  NDF    G    N+  F +SW++  +    +    PD+ C    E +      CG +++     +C  VVD E ++Q C+ D C  +  G+   LC  L A+  AC+  G+  + WR+ + C + CP   ++  C++ CP+ C    L       C   CVEGC C   +I ++  +KCV   +C C   ++   Y+P
Sbjct:  677 ECQDRGVDIGPWR-------NETFCLKCPPNSHYEPCADPCQDTCSGKPSSC-GGACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKMQDGKLGCYPSFQDCIVS----GDPHYNTFDKNYYTFMGTCTYTLART-CRNDSPWFSVEGKNEERGVSGVSYLKKLYVTVNNITVTLMKS-RTTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDPSGPFECIGVVDPEPFFQSCVYDMCQFN--GELHVLCDQLQAYTDACQSAGVTVHHWRAPDFC-LDCPANSSYSLCVSSCPETC----LGVVGSPGCEDVCVEGCECDPGFILSD--DKCVPLKDCGCV--DTSGTYHP 1137          

HSP 9 Score: 159.073 bits (401), Expect = 2.998e-38
Identity = 144/571 (25.22%), Postives = 239/571 (41.86%), Query Frame = 2
Query:  959 GDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDV--FGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRS-QLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCE-ICECSKGGVFNCAK---------------IRGCS---GTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQ-FGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP--FNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLC 2596
            G +  ++    L + +DG  +  I  P +    +CGLCG +DGN+   ++F   +G    NV +F   W+  +  D  +  TT  DL      +   T  + C  +    G      ++   P+   C  ++C   N   ++ +C  +     + +S   T++    +WR+   C   +CPAN  YS C SSC + C  ++    C+  C  GC C      +   CV    C C+  +G               CE  CEC  GG   C                 +  CS   G C +SGDPHYTTFDKR  +  G+C YT+     S +      +  QN H   +      +++ +  +G T     +     +++ VN      P+     +++     +   V++E+  G+R+ +      ++TLP  Y   + G+C N+N N  DD  K       N NEL  SWA  + +   +      C +  E E      C  ++ +P  F  CH  V P P+ + C +D+C  GG  +    C+++ SY   C   G+ + WR+S+ C
Sbjct: 2704 GQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAG--NDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTT-PDLDCDPELEAEVTKPDKCGKIEDLSGPFECIGVVDPEPFFQSCVYDMCQ-FNGELHV-LCDQLQAYTDACQSAGATVH----HWRAPDFCL--DCPANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPGFILSDDKCVSLKDCGCVDTSGTYHPFQVDDEWLLEGCEQSCECLSGGQIQCHNTSCNPVTEVCQLQDGLYECSPLNGICSVSGDPHYTTFDKRTHHYMGACSYTLTKLCNSSSDLPHFTVDTQNEHRGSNTKVSYVRAVVINVYGMT-----VVFGKGRSVQVNGTVVVPPVSSISGVKIYF---SGKFVVLEASFGLRVRFDGNHHADVTLPSSYSGLLCGMC-NFNDNPTDDNLKPDNTPAANSNELGDSWAVPDPRPCTNGGGQEECDEKVEEEAQKPTSCG-MITDPNIFKPCHAVVPPEPYFENCVYDMCATGG--QTVALCQALESYADICAAAGVNIPWRNSTFC 3250          

HSP 10 Score: 153.68 bits (387), Expect = 1.110e-36
Identity = 138/499 (27.66%), Postives = 211/499 (42.28%), Query Frame = 2
Query: 2909 EWKECG-HCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKW-------GCEQEQKC------------VGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGT-SCTKSIFFYYRNQVVQLIRGVRPKV-MENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTM--KNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYS-WRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPG-EIFTENCLICVCNENNFKCRPDPKCITSTTSYCIGSKLTKCENG 4327
            E+ ECG  C  TC+     C    C SGCFC  G++     CVP  KC CL  D +Y     +  G   C   C C  G +        C+  ++C              +C + GD HY TFD + ++F+  CSYVM        + FF++  +N    N  T S  K++  Y     + +++G   +V   N N P +     +S         +     + + +D    ++I +  +YQ+++CGLCG+++ N  +DF+   G   N+   F  SW +             C+     Q   +  CG +  KN  FA C   V+   Y+Q CL D C  +  G    LC A+ A+ + C+  G+D   WR+   C + CP    ++ C + C   C      +    +C   C EGC C   Y+ + G  KCVK + C CK  N      PG E + E+C          KCR D   +T   S C      K ++G
Sbjct: 1307 EYIECGPACIPTCQEPSTNC-SGSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLG-DGCSKLCRC-AGNYTLECTDNSCDPSEECREVNGIPGCYPKTSTCIASGDPHYTTFDKRKYNFMGNCSYVMSGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPVNPTP-EVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKV-IKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPG--EQELYEGYCGILLDKNSPFAVCHGKVNPNNYFQDCLFDLCELE--GAKPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPSNSHYEPCADPCQDTC------SGKPSSCGGACSEGCVCDPGYVLSAG--KCVKSDSCGCKHTNGQYYEQPGEEFYVEDC--------KLKCRCDSPFVTCVASDCPPMHECKLQDG 1779          

HSP 11 Score: 147.132 bits (370), Expect = 1.156e-34
Identity = 162/642 (25.23%), Postives = 263/642 (40.97%), Query Frame = 2
Query:  932 ISSIQHKNI--GDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWK---NPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWR-SQLCAPRECPANKEYSECGSSCSQNCEDL--ITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCT--KSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLR-LTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGV--CAKSY--EYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTL-KWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQ-TNC-STECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYP 2800
            I +I  K I  G ++ +     L++ +DG  ++ I  P      +CG+CG ++ +S+   +    + +  ++V E    WK   + DP  P+       + CT   ++         Q +       C +++    +   C  ++C     G   ++C N+        +  C   G  I WR S  C P  CP N  YS+C + C   C DL  I      + C  GC C      +   CV   +C C+  +G     YH    F R                        C +SGDPHY TFD    + +G   YT V T+       +  + V+  +  +  +   +    + +     D    ++ +  K +LVN      PL    P+R LTI   +    L   + G+ + +  K++  + LP  Y + V+GLCGNY+G + ++  K  G +  + NE   SW  +    T   S      C++S   +Y    K         PF++CH ++ P  + Q C  D+C   G+E+  CA  S  +Y   C + G+ L  WR    C P CP    Y  C + C  SC  L   + C +T C++GCQC +  V       CV   +C C+  + YYP
Sbjct: 3296 IDTIGAKVITSGSYSLLDTNFGLQVKFDGVHHLEITVPGEYFNKLCGMCGNYNHDST--DDNLKPDKQPAKDVIELGNSWKSEGDSDPCQPDNRPDVHPN-CTAEEEEQFKAQCE--QVILSSSFRPCHSVVSPDAFLGNCIYDMCE--YNGMQATLCDNVEA-----YAQACQSAGVTITWRNSTFCLP--CPPNSHYSDCTAPCPPTCSDLFPIFCHLPPTACVEGCECNAGYVLSDGKCVSLDKCGCVGSDGE----YHD---FDR------------------------CTVSGDPHYRTFDGFTHHYQGP--YTYVLTQDHNLQGSLKPLMVRGKNLRRGGNKRVSFLDEMYVNVYGVD----VRFLQKKTVLVNGERVTPPLS---PVRGLTITMNSKQMQLTTDF-GLTVRFDGKSR-GVILPRTYSNSVRGLCGNYDGITRNEYMKPDGTVVRDLNEFGDSWRVSRDTETDPDSGFETSDCSQSELDDYTSVTKCGALSDPEGPFSACHAALPPQIY-QDCVFDLCAEDGSEELRCA--SYEAYATICQEAGVKLGSWRQQLGCLP-CPANSTYTACMSPCPSSCADLAAPSECDATACVEGCQCAAGFVMSEGA--CVPYPECGCTFLDRYYP 3875          

HSP 12 Score: 120.168 bits (300), Expect = 1.855e-26
Identity = 131/478 (27.41%), Postives = 202/478 (42.26%), Query Frame = 2
Query: 2882 NVTFC---PPGKEWKEC-GHCDQTCENQ-DGFCL--EKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMV-DSDCGKGIGFFKLVTENIE-CGNKGTSCTKSIFFYYRNQVVQLIRGVRPKV-MENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWK----SRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVK--FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDY-SWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIF-TENC-LICVCNENNFKCRP 4258
            N TFC   PP   + +C   C  TC +    FC      C  GC C  GY+LS+  CV   KC C+ SD  Y +             +CT +                   GD HY+TFDG    +    +YV+  D +    +    +  +N+   GNK  S    ++       V+ ++     V  E    P   V+G ++      Q+ + TD  + + +D G S  + LP  Y N V GLCGN+D    N++    G    ++  F DSW+    +  +  +  +  D  +S  +      K CG + + +  F+ C   +  ++ YQ C+ D C+ D  G  E  C +  A+ + C++ G+   SWR    C + CP   T+  C++ CP  C      +   E  A  CVEGC C   ++ +EG+  CV   EC C     D+ Y   E F TE+C   CV       C+P
Sbjct: 3467 NSTFCLPCPPNSHYSDCTAPCPPTCSDLFPIFCHLPPTACVEGCECNAGYVLSDGKCVSLDKCGCVGSDGEYHD-----------FDRCTVS-------------------GDPHYRTFDGFTHHYQGPYTYVLTQDHNLQGSLKPLMVRGKNLRRGGNKRVSFLDEMYVNVYGVDVRFLQKKTVLVNGERVTPPLSPVRG-LTITMNSKQMQLTTDFGLTVRFD-GKSRGVILPRTYSNSVRGLCGNYDGITRNEYMKPDGTVVRDLNEFGDSWRVSRDTETDPDSGFETSDCSQSELDDYTSVTK-CGALSDPEGPFSACHAALPPQI-YQDCVFDLCAED--GSEELRCASYEAYATICQEAGVKLGSWRQQLGC-LPCPANSTYTACMSPCPSSCADLAAPS---ECDATACVEGCQCAAGFVMSEGA--CVPYPECGCTF--LDRYYPLNENFVTEDCSQSCVSTSIGAVCQP 3900          

HSP 13 Score: 110.923 bits (276), Expect = 1.254e-23
Identity = 77/268 (28.73%), Postives = 128/268 (47.76%), Query Frame = 2
Query: 2015 TTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATA----ECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNC---STECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYY 2797
            + K  L+N    R PL I+      I   ++   L+++  G+++ +     +EIT+P  Y +++ G+CGNYN +S DD  K   +   +  EL  SW +      C+          C    E E+F  +  Q +L   F  CH  V P+ F+  C +D+C   G +     C+++ +Y +AC   G+T+ WR+S+ C P CP    Y +C   C  +C  L    C    T C++GC+C  N  Y  +  +CV++ +C C   +  Y
Sbjct: 3279 SVKVFLLNGRRVRTPLTIDTIGAKVITSGSYS--LLDTNFGLQVKFDGVHHLEITVPGEYFNKLCGMCGNYNHDSTDDNLKPDKQPAKDVIELGNSWKSEGDSDPCQPDNRPDVHPNCTAE-EEEQFKAQCEQVILSSSFRPCHSVVSPDAFLGNCIYDMCEYNGMQAT--LCDNVEAYAQACQSAGVTITWRNSTFCLP-CPPNSHYSDCTAPCPPTCSDLFPIFCHLPPTACVEGCEC--NAGYVLSDGKCVSLDKCGCVGSDGEY 3538          

HSP 14 Score: 97.4413 bits (241), Expect = 1.402e-19
Identity = 80/303 (26.40%), Postives = 133/303 (43.89%), Query Frame = 2
Query: 3296 FKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAK-----DVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYN 4189
            F++V +N E G    S  +S+  +  N      R VR  +  +    K    G  S  D        T+  + + +D    +EI +P +Y N++CG+CGN++ +  +D          +++   +SWKS  +    +     DV   C +  E Q  A +    + +  F  C  VV  + +   C+ D   C+  G    LC  + A+  AC+  G+  +WR++  C + CPP   +  C   CP  C  S+L           CVEGC C   Y+ ++G  KCV  ++C C    SD +Y+
Sbjct: 3260 FRVVAKNEERGQPEASYVRSVKVFLLNG-----RRVRTPLTIDTIGAKVITSGSYSLLD--------TNFGLQVKFDGVHHLEITVPGEYFNKLCGMCGNYNHDSTDDNLKPDKQPAKDVIELGNSWKSEGDSDPCQPDNRPDVHPNCTAEEEEQFKA-QCEQVILSSSFRPCHSVVSPDAFLGNCIYDM--CEYNGMQATLCDNVEAYAQACQSAGVTITWRNSTFC-LPCPPNSHYSDCTAPCPPTC--SDLFPIFCHLPPTACVEGCECNAGYVLSDG--KCVSLDKCGCV--GSDGEYH 3539          

HSP 15 Score: 81.2629 bits (199), Expect = 1.010e-14
Identity = 84/367 (22.89%), Postives = 135/367 (36.78%), Query Frame = 2
Query: 2969 EKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSY--------------------LNQSVIYTGPTNC---LSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDS-DCGKGIGFFKLVTENIECG-NKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQ---------AWADKMCGTMKNVK-FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELC 3964
            E  C  GC C  G++LS+  CV    C C+ +  +Y                    L+   I    T+C      C   +G + C       G C   GD HY TFD +   ++  CSY +    +    +  F + T+N   G N   S  +++        V   +G   +V      P       +        +++     + + +D     ++ LP  Y   +CG+C NF+ N  +D          N     DSW       A  D P  C +   ++         A     CG + +   F  C  VV  E Y++ C+ D C+   GG    LC AL ++   C   G++  WR++  C
Sbjct: 2898 EDVCVEGCECDPGFILSDDKCVSLKDCGCVDTSGTYHPFQVDDEWLLEGCEQSCECLSGGQIQCHNTSCNPVTEVCQLQDGLYECSPLN---GICSVSGDPHYTTFDKRTHHYMGACSYTLTKLCNSSSDLPHFTVDTQNEHRGSNTKVSYVRAVVINVYGMTVVFGKGRSVQVNGTVVVPPVSSISGVKIYFSGKFVVLEASFGLRVRFDGNHHADVTLPSSYSGLLCGMC-NFNDNPTDDNLKPDNTPAANSNELGDSW-------AVPD-PRPCTNGGGQEECDEKVEEEAQKPTSCGMITDPNIFKPCHAVVPPEPYFENCVYDMCA--TGGQTVALCQALESYADICAAAGVNIPWRNSTFC 3250          
BLAST of Hemocytin vs. Ensembl Medaka
Match: FCGBP (Fc fragment of IgG binding protein [Source:NCBI gene;Acc:101155957])

HSP 1 Score: 283.878 bits (725), Expect = 2.080e-76
Identity = 288/1160 (24.83%), Postives = 452/1160 (38.97%), Query Frame = 2
Query:  992 LEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPD---------------PIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDC---EICECSKGGVFNCAK--------------IRGCS----GTCVISGDPHYTTFDKRHIYVEGSCFYTMVAT-KPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATA----ECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDPKCPNGMEYMECKNLCSVSCFSLT-QTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQC-SHENAYYPSGSTRKEKCN---DCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGH----CDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCG--KGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENE---NYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKS-------------RVNCPAAKDVPDMCKSNHERQAWADK-MCGTMK---NVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDY-SWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIF--TENC-LICVCN 4234
            L++ ++     F+  P     +VCGLCG ++GN  +  +    NG +    T+F   W+  +                I     Y    DLC G+ +D      +    V      +  +  V  Y+   +  LC  + A    S C  +  ++ S+++             S  CA + CP +  Y  C S+C  +CE L     C++ C  GC C +    +G  CVP  QC C+  +    + Y     F  +    E C+C++ G   C K              I+ C     G C  SGDPHYT+FD +    +G+C Y +  +     T  +   + V+N    +           L   +    T I       +LVN + N +PL +ND      QE  +   LI +  G+ + +     + +T+P  Y+D+V GLCGN+NG+ +DD       L  + N    SW  A     C++    +    C  +++       +C  L     PF  CH  +DP  +   C  D+C   G+ K    C+S+A+Y   C   G+ +  WR+ S C  KCP    Y  C   C+ SC  L+    C   C +GC C +  +YD     CV  ++C C      Y P   T +E C+    CN   G+  C +  C   T C   K  KEC +     D  C  Q+   +E G                 C+PK+   C W                                          +WGD HY TFDG  FDF   C Y+ +   CG   G+  F +   N   GN   S  + +  +  +  + + +    +V  N    N P       +S     S  ++ T   +I+ +D    + I LP  Y + VCGLCGNF+ +  ++ ++ +G    +++ +  SW++               NCP   D         ER+ +  +  CG +    N  F  C   +D + +   C+ D C     GD   LC AL+++   C+  GI    WR    CP+ C     ++ C + C   C       T    C+  CVE C C   Y+ + G   C+    C C      + Y PG+ F   E C  +CVC+
Sbjct:  542 LKVSFNWHSAAFVTLPSNYMGAVCGLCGNYNGN--MQDDLTPKNGNTPVKPTDFGTSWRVAEIPGCIEGCQGVCPSCDITQKVQYEK-EDLC-GIIRDTKGPFRDCHAKVDPAGFFEDCVYDVCMYEGR-KDVLCQAVTA--YTSACQGVGVNVYSWRT-------------SNFCAVK-CPIHSHYDICASACPASCEGLAPPPGCRAHCEEGCSCDEGYILSGDQCVPFSQCGCLYND----LYYRINEVFYPNGQCEEECKCTQDGEVTCKKFKCGPNEKCKIENGIQKCHPVGKGVCRASGDPHYTSFDGQKFDFQGTCTYVLSKSCGVEDTHLEAFSVQVENVQWDRMKGKKKVSVTRLVAVEVFGFTLIMKSKMFGVLVNGVLNNIPLNLNDGEVQVYQEGTN--YLIATNFGLLVTYDLVYHVTVTVPGNYRDKVCGLCGNFNGDRKDDFQMPDQILAKDINVFGKSWKVAIPNVVCENGCQGNECADCDPAHKDVFSKPAYCGILTAPKGPFAVCHSKLDPQSYFDDCVFDVCASNGDGK--VLCDSVAAYAYNCHMAGVNVNDWRTPSFCPMKCPANSHYEVCAETCTYSCPGLSDMVQCPEACTEGCVCDAGFLYDG--QTCVKETECGCYDRGKTYKPGEVTYEEDCSLACSCNPATGL-ICEEYSCPEDTQCMIKKGVKECYNKDPCKDANCRVQETCRVEGG--------------EAVCIPKYTSTC-W------------------------------------------AWGDPHYHTFDGFDFDFQGTCKYI-ISKTCGNLNGLVPFSITERNDNRGNAAVSFVREVDVFIYDYNITIRKNQVGQVTVNGELLNLPFQLGDNEVSVFQSGSSAVVETKFGLIVSYDWNWHLVIKLPSSYYSSVCGLCGNFNGDTGDELQNPSGKAVASVIEWGKSWQTPDQDKGHPCWDTCEKNCPTCDD--------DERELYKTQAFCGGLAAKTNSVFKICNSKLDPQAFMNNCVYDMCL--NKGDKRMLCQALTSYNKQCRDEGIIIKDWRKEFNCPMNCQRFSHYEHCASPCQPSCPFPEQKQT----CSGACVEACVCDEGYVLSAGV--CIPAKTCGCSY--QGRYYTPGQQFWADEACSRLCVCD 1593          

HSP 2 Score: 212.616 bits (540), Expect = 1.268e-54
Identity = 181/682 (26.54%), Postives = 277/682 (40.62%), Query Frame = 2
Query:  974 IKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLN--KDLVTTANNMCQDVFG--GDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLIN-WRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRD---CEICECSKGGVFNCAK--------------IRGC----SGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVC---------AKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDPKCPNGMEYMECKNLCSVSCFS-LTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNC---TNGVWSCTKNDCSNVTFC 2896
            I+    + I YD    V +  P     ++CGLCG ++G +    +    NG++  +  +  + W+      P          C   +  +  V  A+  C  +    G   +C   +    Y   C  ++C     G + SVC  +   + +     C   G  I+ WR+Q   P ECPAN  Y+ C S C   C  + +   C   C+  C C +    +G  CVP   C C   NG     Y +G  F  +    E C C + G  +C K              ++GC     G CV SGDPHYT+FD +    +G+C Y +                         ND   T     Q      +  + +  +  + VN     LPL + D  RLT+    H+T +   + G+++L+     +E+ +P  YQ ++ GLCGNYN    D+     G+ T N NE   SW        L     G C         A +  YEK       +    PF +CH  +DP  ++  C  D+C  GG+++    C S+ +Y  AC   G+ ++ WRSSS C   CP    Y  C + C  +C S + Q  CS  C +GC+C +  V+D A  QCV +  C C H+  Y        +K     C    +G+  C +  CS+   C
Sbjct: 1733 IETAAGITITYDWWSTVRVTVPSNYHGAMCGLCGNYNGKAL--DDMTMQNGKTTPDEAKLGESWQVASV--PGCSSACQGPWCQACSDSQKKVYQASQFCGIIADETGPFRECHKFVDPAAYVEDCVYDVCQ--FHGHHGSVCKAVEVYLSA-----CQSQGIPIHPWRTQAFCPMECPANSHYNLCASGCPTTCASINSLTTCHMHCSEACECDQGHLMSGDTCVPVRDCGC-SYNGQ---YYQKGDVFYPEDTCMEKCICGENGAVSCQKEKCRRGETCKLVNGVKGCHPEEEGKCVASGDPHYTSFDGQRFDFQGTCVYVLAKV-------------------CDDNDNQLTPFTVTQGNAKYGNGKVSVTKSVTVTVNNEELNLPLSL-DKGRLTVTREGHNTFVRTDF-GLKVLYDTVYYVEVIVPSTYQGKMCGLCGNYNKKDRDEFRLPGGKGTKNVNEFGKSWVV-----DLPEHICGGCEEDCPVCEKANAVLYEKLDSCGIMKAPDGPFQACHSKIDPAAYVSDCVFDVCAAGGSKE--ILCNSVQAYVLACQNAGVQIQPWRSSSFCPASCPPNSHYEVCADTCRGTCASFIQQLTCSESCFEGCECDAGFVFDGA--QCVPLENCGCVHDGRYLTVNQVVVDKDCQSRCVCEASGLVKCQRLSCSSTEVC 2369          

HSP 3 Score: 207.608 bits (527), Expect = 4.234e-53
Identity = 189/679 (27.84%), Postives = 289/679 (42.56%), Query Frame = 2
Query:  992 LEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPI-DPNTYYTTGRDLCTG---------LNKDLVTTANNMCQDVFGGDLSQC-TILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLI-NWRSQL-CAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDC-EICECSKGGVFNCAKIRGCS-------------------GTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVC-----AKSYEYEKFAKEFCQ--RLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTL-KWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLT-QTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAY-------YPSGSTRKEKCNDCNCT-NGVWSCTKNDC 2878
            L + YD   N+ +  P T     CGLCG F+GN     +F   +G        F   WK P  + DP       R+ C G         LNK     +  +      G    C  I+    Y   C+ +LC     G+ +       C+     +  C   G  I +WR    C+PR CPAN +Y  CGS+C   C D      C+  C   C C +    +G+ CVP  +C C        +   Q     ++C ++C+C  G      + +GC                     TC  +GDPHY TFD +    +G+C Y + A     T     ++ VQN H  ++  +Y TK + ++            V + NIL +++ N LP+ + +  ++++ +     V+   + G+++ ++  +   +TLP  Y   V GLCGNYNGN +DD T  +G       +   SW  AE    +     GVC      +  +YEK  ++ C   R    PF  CH  VDP  F + C +D+C+  G  + +  C+++ +Y  AC   G+ +  WR+S+ C  KCP    Y  C + C  SC  L     C   C +GC C     Y  + +QCV  SQC C + + Y       YP+G   +E    C CT +G  +C K  C
Sbjct:  160 LMVRYDWTHNLVVTLPDTYSGKTCGLCGNFNGNPK--DDFTTPSGTQASGAVAFGSSWKVPGLVADPQC-----RNDCVGGCGSCTESQLNKWDSDLSCGIITRKENGPFKNCHAIIDPKAYLENCKYDLC----MGKGLR---QFLCNALETYAEACQAAGVQIGDWRGLAKCSPR-CPANSKYELCGSACPATCSDPDAPSKCQRPCVETCTCKEGFVLSGSECVPATKCGCTYD--GRYIPAGQTFWADQNCKQLCKCVAGTRQVACQDKGCGVGQQCKVVDGIRKCQALSYSTCKATGDPHYVTFDNKKYDFQGTCVYQLAALCSKDTELTPFEVLVQNEHRGRNVVSY-TKLVQIK------------VYSLNILNDQLVN-LPVSLVEG-KVSVYKSGWFAVVTTDF-GLKVSFNWHSAAFVTLPSNYMGAVCGLCGNYNGNMQDDLTPKNGNTPVKPTDFGTSWRVAEIPGCIE-GCQGVCPSCDITQKVQYEK--EDLCGIIRDTKGPFRDCHAKVDPAGFFEDCVYDVCMYEG--RKDVLCQAVTAYTSACQGVGVNVYSWRTSNFCAVKCPIHSHYDICASACPASCEGLAPPPGCRAHCEEGCSCDEG--YILSGDQCVPFSQCGCLYNDLYYRINEVFYPNGQCEEE----CKCTQDGEVTCKKFKC 794          

HSP 4 Score: 206.068 bits (523), Expect = 1.037e-52
Identity = 180/673 (26.75%), Postives = 284/673 (42.20%), Query Frame = 2
Query:  992 LEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCT---------ILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLI-NWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRD---CEICEC-SKGGVFNCAKI--------------RGCS----GTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQ-FGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAE---CKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE--PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDPKCPNGMEYMECKNLCSVSCFSL-TQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGST--RKEKCND-CNC-TNGVWSCTKNDC 2878
            L + YD   ++ I  P +   SVCGLCG F+G++    E +N +G+++ +V E+ K W+ PD    +  + T    C   + D            F G L+  T          L    + + C  ++C  LN G    +C     ++ S+   QC   G +I +WR +   P  C     Y  C S C  +C      + C   C   C C +    +   C+P   C C  +       Y  G  F  D     +C C +  G+  C +               R C      TC  SGDPHY TFD R    +G+C Y +        G     + V+N +   S     TK+++   +G T     + +       +N     LPL+ ND L + +   +    +IE+  GI I +   + + +T+P  Y   + GLCGNYNG + DD T  +G+ T ++ +L  SW  A    C S     +   C+ S +    A +FC  +  E  PF  CH  VDP  +++ C +D+C   G+      C+++  Y  AC   G+ +  WR+ + C  +CP    Y  C + C  +C S+ + T C   C + C+C    +   + + CV +  C CS+   YY  G     ++ C + C C  NG  SC K  C
Sbjct: 1349 LIVSYDWNWHLVIKLPSSYYSSVCGLCGNFNGDTG--DELQNPSGKAVASVIEWGKSWQTPDQDKGHPCWDTCEKNCPTCDDDERELYKTQ---AFCGGLAAKTNSVFKICNSKLDPQAFMNNCVYDMC--LNKGDKRMLCQ----ALTSYNK-QCRDEGIIIKDWRKEFNCPMNCQRFSHYEHCASPCQPSCPFPEQKQTCSGACVEACVCDEGYVLSAGVCIPAKTCGCSYQG----RYYTPGQQFWADEACSRLCVCDTTLGMVTCREASCSVNEKCIIQDGERVCQPISYATCTASGDPHYHTFDGRRFNFQGTCVYQLAGLCSQHPGLVPFNVTVENEN-RGSKAVSFTKTVTFSIYGST-----LTISKENPYKLNGQLAALPLKSNDELAVFL---SGSQAVIETAAGITITYDWWSTVRVTVPSNYHGAMCGLCGNYNGKALDDMTMQNGKTTPDEAKLGESWQVASVPGCSSACQGPWCQACSDSQKKVYQASQFCGIIADETGPFRECHKFVDPAAYVEDCVYDVCQFHGHHGS--VCKAVEVYLSACQSQGIPIHPWRTQAFCPMECPANSHYNLCASGCPTTCASINSLTTCHMHCSEACECDQGHL--MSGDTCVPVRDCGCSYNGQYYQKGDVFYPEDTCMEKCICGENGAVSCQKEKC 1992          

HSP 5 Score: 170.244 bits (430), Expect = 9.095e-42
Identity = 145/511 (28.38%), Postives = 228/511 (44.62%), Query Frame = 2
Query: 2894 CPPGKEWKECGH-CDQTCENQDGFCLEKGCKS----GCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEG------KWGCEQEQKCV-------------GSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCG---KGIGFFKLVTENIEC----GNKGTSCTKSI---FFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRV------NCPAAKDVPDMCKSNHERQAWADKMCGTMKNVK--FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYS-WRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEI-FTENC-LICVCNE------NNFKCRPDPKCI 4273
            CP    +  C   C  +CE   G     GC++    GC C +GY+LS   CVP  +C CL++D  Y    V Y     C  +C C +       K+ C   +KC              G C++ GD HY +FDG+ FDF   C+YV+  S CG     +  F +  EN++     G K  S T+ +    F +   +   + GV    + N N P +   G +      +  +I T+  +++ +D    + + +P  Y+++VCGLCGNF+ +  +DF+        +I  F  SWK  +      N     +  D C   H+        CG +   K  FA C   +D + Y+  C+ D C+ +  GD + LC +++A+   C   G++ + WR+   CP+ CP    ++ C   C   C    L++ V   C + C EGC C   ++       CVKE EC C   +  K Y PGE+ + E+C L C CN         + C  D +C+
Sbjct:  701 CPIHSHYDICASACPASCE---GLAPPPGCRAHCEEGCSCDEGYILSGDQCVPFSQCGCLYNDLYYRINEVFYPN-GQCEEECKCTQDGEVTCKKFKCGPNEKCKIENGIQKCHPVGKGVCRASGDPHYTSFDGQKFDFQGTCTYVLSKS-CGVEDTHLEAFSVQVENVQWDRMKGKKKVSVTRLVAVEVFGFTLIMKSKMFGVLVNGVLN-NIPLNLNDGEVQVYQEGTNYLIATNFGLLVTYDLVYHVTVTVPGNYRDKVCGLCGNFNGDRKDDFQMPDQILAKDINVFGKSWKVAIPNVVCENGCQGNECAD-CDPAHKDVFSKPAYCGILTAPKGPFAVCHSKLDPQSYFDDCVFDVCASN--GDGKVLCDSVAAYAYNCHMAGVNVNDWRTPSFCPMKCPANSHYEVCAETCTYSC--PGLSDMV--QCPEACTEGCVCDAGFL--YDGQTCVKETECGCY--DRGKTYKPGEVTYEEDCSLACSCNPATGLICEEYSCPEDTQCM 1194          

HSP 6 Score: 166.777 bits (421), Expect = 1.050e-40
Identity = 179/706 (25.35%), Postives = 282/706 (39.94%), Query Frame = 2
Query:  992 LEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTIL--PVIPYQSICRSELCH-----------CLNAGQNISVCANIACSMGSFKSYQCTLNGKLIN-WRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQG-MSFKRDCEI-CECS--------------------KGGVFNCAKIRGC------------------------SGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAE------CKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP---FNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLK-WRSSSLCDPKCPNGMEYMECKNLCSVSC-FSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGST--RKEKCND---CNCTNGVWSCTKNDCS 2881
            L + YD   +V +  P   +  VCGLCG F+G+     +F+  +    +++  F K WK      PN     G   C G   +     +   +DVF    + C IL  P  P+ ++C S+L             C + G    +C ++A       +Y C + G  +N WR+    P +CPAN  Y  C  +C+ +C  L     C   CT GC C     ++G  CV + +C C  +       Y  G ++++ DC + C C+                    K GV  C     C                        + TC   GDPHY TFD      +G+C Y +  T  ++ G     I  +N +     +A  +    +     D +  I+      + VN     LP Q+ D      Q  +  + ++E+  G+ + +     + I LP  Y   V GLCGN+NG++ D+    SG+   +  E   SW T +      C  T   +         E  K  + FC  L  +    F  C+  +DP  F+  C +D+CL  G+++    C+++ SY + C   G+ +K WR    C   C     Y  C + C  SC F   +  CS  C++ C C    V    V  C+    C CS++  YY  G      E C+    C+ T G+ +C +  CS
Sbjct:  934 LLVTYDLVYHVTVTVPGNYRDKVCGLCGNFNGDRK--DDFQMPDQILAKDINVFGKSWK---VAIPNVVCENG---CQG---NECADCDPAHKDVFS-KPAYCGILTAPKGPF-AVCHSKLDPQSYFDDCVFDVCASNGDGKVLCDSVAA-----YAYNCHMAGVNVNDWRTPSFCPMKCPANSHYEVCAETCTYSCPGLSDMVQCPEACTEGCVCDAGFLYDGQTCVKETECGCYDRGK----TYKPGEVTYEEDCSLACSCNPATGLICEEYSCPEDTQCMIKKGVKECYNKDPCKDANCRVQETCRVEGGEAVCIPKYTSTCWAWGDPHYHTFDGFDFDFQGTCKYIISKTCGNLNGLVPFSITERNDN---RGNAAVSFVREVDVFIYDYNITIRKNQVGQVTVNGELLNLPFQLGDNEVSVFQ--SGSSAVVETKFGLIVSYDWNWHLVIKLPSSYYSSVCGLCGNFNGDTGDELQNPSGKAVASVIEWGKSWQTPDQDKGHPCWDTCEKNCPTCDDDERELYK-TQAFCGGLAAKTNSVFKICNSKLDPQAFMNNCVYDMCLNKGDKR--MLCQALTSYNKQCRDEGIIIKDWRKEFNCPMNCQRFSHYEHCASPCQPSCPFPEQKQTCSGACVEACVCDEGYVLSAGV--CIPAKTCGCSYQGRYYTPGQQFWADEACSRLCVCDTTLGMVTCREASCS 1607          

HSP 7 Score: 166.007 bits (419), Expect = 1.684e-40
Identity = 143/501 (28.54%), Postives = 221/501 (44.11%), Query Frame = 2
Query: 2894 CPPGKEWKECGH-CDQTCENQDGFCL-EKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKW-------GCEQEQKC-------------VGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGF--FKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENE--NYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCP----AAKDVPDMCKSNHERQAWADKMCGTMKNVK--FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGID-YSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLI---CVCNENN------FKCRPDPKC 4270
            CP   +++ CG  C  TC + D     ++ C   C C +G++LS   CVP  KC C + D  Y+     +    NC   C C  G         GC   Q+C               +CK+ GD HY TFD K +DF   C Y +  + C K      F+++ +N   G    S TK         +VQ I+     ++ ++  N P   V+G++S        ++ TD  + + ++   +  + LP  Y   VCGLCGN++ N+ +D   K GN       F  SW+     P      + V   C    + Q   + +CG +++ K  F DC   VD   +++ C+ D C  +  G  + LC A++A+ SAC+  G++ YSWR++  C V CP    +  C + CP  C            C  +C EGCSC   YI +   ++CV  ++C C    +D  Y   E+F  N      C C ++       FKC P+ KC
Sbjct:  323 CPANSKYELCGSACPATCSDPDAPSKCQRPCVETCTCKEGFVLSGSECVPATKCGCTY-DGRYIPAGQTFWADQNCKQLCKCVAGTRQVACQDKGCGVGQQCKVVDGIRKCQALSYSTCKATGDPHYVTFDNKKYDFQGTCVYQLA-ALCSKDTELTPFEVLVQNEHRGRNVVSYTK---------LVQ-IKVYSLNILNDQLVNLPVSLVEGKVSVYKSGWFAVVTTDFGLKVSFNWHSAAFVTLPSNYMGAVCGLCGNYNGNMQDDLTPKNGNTPVKPTDFGTSWRV-AEIPGCIEGCQGVCPSCDITQKVQYEKEDLCGIIRDTKGPFRDCHAKVDPAGFFEDCVYDVCMYE--GRKDVLCQAVTAYTSACQGVGVNVYSWRTSNFCAVKCPIHSHYDICASACPASC----EGLAPPPGCRAHCEEGCSCDEGYILS--GDQCVPFSQCGCLY--NDLYYRINEVFYPNGQCEEECKCTQDGEVTCKKFKCGPNEKC 800          

HSP 8 Score: 163.696 bits (413), Expect = 9.176e-40
Identity = 132/458 (28.82%), Postives = 193/458 (42.14%), Query Frame = 2
Query: 2894 CPPGKEWKECGH-CDQTCENQDGFCL-EKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNE---------------------GKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVD--SDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPA------AKDVPDMCKSNHERQAWADKMCGTMK--NVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYS-WRSNELCPVMCPPEKTFKTCINDCPKKC--FKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFC 4159
            CP    +  C   C  TC + +        C   C C  G+L+S  TCVP   C C ++ + Y    V Y   T C+ KC C E                     G  GC  E++  G C + GD HY +FDG+ FDF   C YV+     D    +  F +   N + GN   S TKS+     N              E  N P    KGR++         + TD  + + +D    +E+ +P  YQ ++CGLCGN+++   ++F+   G    N+  F  SW   V+ P        +D P   K+N       D  CG MK  +  F  C   +D   Y   C+ D C+   GG  E LC ++ A+  AC+  G+    WRS+  CP  CPP   ++ C + C   C  F   L       C+++C EGC C   ++  +G+ +CV    C C
Sbjct: 1899 CPANSHYNLCASGCPTTCASINSLTTCHMHCSEACECDQGHLMSGDTCVPVRDCGCSYNGQYYQKGDVFYPEDT-CMEKCICGENGAVSCQKEKCRRGETCKLVNGVKGCHPEEE--GKCVASGDPHYTSFDGQRFDFQGTCVYVLAKVCDDNDNQLTPFTVTQGNAKYGNGKVSVTKSVTVTVNN--------------EELNLPLSLDKGRLTVTREGHNTFVRTDFGLKVLYDTVYYVEVIVPSTYQGKMCGLCGNYNKKDRDEFRLPGGKGTKNVNEFGKSW--VVDLPEHICGGCEEDCPVCEKANAVLYEKLDS-CGIMKAPDGPFQACHSKIDPAAYVSDCVFDVCA--AGGSKEILCNSVQAYVLACQNAGVQIQPWRSSSFCPASCPPNSHYEVCADTCRGTCASFIQQL------TCSESCFEGCECDAGFV-FDGA-QCVPLENCGC 2326          

HSP 9 Score: 151.369 bits (381), Expect = 6.105e-36
Identity = 127/517 (24.56%), Postives = 207/517 (40.04%), Query Frame = 2
Query: 2927 HCDQTCENQDGFCLEK-----GCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPT--------NCLSKCTCNEGKWGCEQEQKCV-------------GSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGF--FKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWK--SRVNCPAAKDVP--DMCKSNHERQAWADKMCGTMKNVK--FADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGID-YSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIF--TENCL-ICVCNENNFKCRPDPKCITSTTSYCIGSKLTKCENGVCARICNGIPEC 4363
            HC   C+    F  +K      C   C C +GY+LS   C+P   C C +  + Y      +              L   TC E    C   +KC+              +C + GD HY TFDG+ F+F   C Y +    C +  G   F +  EN   G+K  S TK++ F      + + +    K+         +    ++     SQ +I T + I + +D   ++ + +P  Y   +CGLCGN++    +D   + G    +     +SW+  S   C +A   P    C  + ++   A + CG + +    F +C K VD   Y + C+ D C     G    +C A+  + SAC+  GI  + WR+   CP+ CP    +  C + CP  C   N     L  C  +C E C C   ++ +   + CV   +C C    + + Y  G++F   + C+  C+C EN                  +  +  KC  G   ++ NG+  C
Sbjct: 1520 HCASPCQPSCPFPEQKQTCSGACVEACVCDEGYVLSAGVCIPAKTCGCSYQGRYYTPGQQFWADEACSRLCVCDTTLGMVTCREAS--CSVNEKCIIQDGERVCQPISYATCTASGDPHYHTFDGRRFNFQGTCVYQLAGL-CSQHPGLVPFNVTVENENRGSKAVSFTKTVTFSIYGSTLTISKENPYKLNGQLAALPLKSNDELAVFLSGSQAVIETAAGITITYDWWSTVRVTVPSNYHGAMCGLCGNYNGKALDDMTMQNGKTTPDEAKLGESWQVASVPGCSSACQGPWCQACSDSQKKVYQASQFCGIIADETGPFRECHKFVDPAAYVEDCVYDVCQFH--GHHGSVCKAVEVYLSACQSQGIPIHPWRTQAFCPMECPANSHYNLCASGCPTTCASIN----SLTTCHMHCSEACECDQGHLMS--GDTCVPVRDCGCSY--NGQYYQKGDVFYPEDTCMEKCICGENG----------------AVSCQKEKCRRGETCKLVNGVKGC 2007          

HSP 10 Score: 139.043 bits (349), Expect = 2.936e-32
Identity = 98/377 (25.99%), Postives = 172/377 (45.62%), Query Frame = 2
Query: 1718 EICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSW------ATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYE----PFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTL-KWRSSSLCDPKCPNGMEYMECKNLCSVSCFSL-TQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGST 2812
            E+CE   G      + +   GTC   GDPHY TFD +     G+C Y +       +     ++  QN +      +Y    +++Q  DT  +       T  + V+     LP+ +N+      Q  +  +V+IE+  G+ + +     + +TLP+ Y  +  GLCGN+NGN +DD T  SG   +       SW      A  +C++   +   G C +S +  K+  +    ++      PF +CH  +DP  +++ C++D+C+  G       C ++ +Y  AC   G+ +  WR  + C P+CP   +Y  C + C  +C      + C   C++ C CK   V   +  +CV  ++C C+++  Y P+G T
Sbjct:   27 EVCEMKNGSPLCVPQSK--MGTCWAMGDPHYRTFDGQRFDFMGTCTYVIAKNCGEDSRLTAFEVHAQNENRGSHRVSY-VGLVTVQVYDTTITAVRS--ETGRVRVDNSLWSLPIILNNGKLKIFQ--SGRSVVIEADFGLMVRYDWTHNLVVTLPDTYSGKTCGLCGNFNGNPKDDFTTPSGTQASGAVAFGSSWKVPGLVADPQCRNDC-VGGCGSCTES-QLNKWDSDLSCGIITRKENGPFKNCHAIIDPKAYLENCKYDLCM--GKGLRQFLCNALETYAEACQAAGVQIGDWRGLAKCSPRCPANSKYELCGSACPATCSDPDAPSKCQRPCVETCTCKEGFVLSGS--ECVPATKCGCTYDGRYIPAGQT 390          

HSP 11 Score: 132.109 bits (331), Expect = 3.637e-30
Identity = 100/363 (27.55%), Postives = 168/363 (46.28%), Query Frame = 2
Query: 3164 QKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKG--IGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENY---PKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWK--SRVNCPAAK-DVPDMCKSNHERQ--AW-ADKMCGTM---KNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYS-WRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNP-GEIF 4204
            Q  +G+C + GD HY+TFDG+ FDF+  C+YV+   +CG+   +  F++  +N   G+   S    +     +  +  +R    +V  + +    P     G++        ++I  D  +++ +D   ++ + LP  Y  + CGLCGNF+ N  +DF + +G   +  +AF  SWK    V  P  + D    C S  E Q   W +D  CG +   +N  F +C  ++D + Y + C  D C     G  + LC AL  +  AC+  G+    WR    C   CP    ++ C + CP  C   +  +     C + CVE C+C   ++ +   ++CV   +C C     D +Y P G+ F
Sbjct:   41 QSKMGTCWAMGDPHYRTFDGQRFDFMGTCTYVIA-KNCGEDSRLTAFEVHAQNENRGSHRVSYVGLVTVQVYDTTITAVRSETGRVRVDNSLWSLPIILNNGKLKIFQSGRSVVIEADFGLMVRYDWTHNLVVTLPDTYSGKTCGLCGNFNGNPKDDFTTPSGTQASGAVAFGSSWKVPGLVADPQCRNDCVGGCGSCTESQLNKWDSDLSCGIITRKENGPFKNCHAIIDPKAYLENCKYDLCM--GKGLRQFLCNALETYAEACQAAGVQIGDWRGLAKCSPRCPANSKYELCGSACPATCSDPDAPS----KCQRPCVETCTCKEGFVLS--GSECVPATKCGCTY---DGRYIPAGQTF 391          

HSP 12 Score: 122.865 bits (307), Expect = 2.305e-27
Identity = 118/475 (24.84%), Postives = 189/475 (39.79%), Query Frame = 2
Query:  992 LEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKD--LVTTANNMCQDVFGGDLSQCTIL--PVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCT-----------LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEI-CECSKGGVFNCAK--------------IRGC---SGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAE 2317
            L++LYD    V +  P T +  +CGLCG +  N     EF+   G+  +NV EF K W    P            +C G  +D  +   AN     V    L  C I+  P  P+Q+ C S++    +    +S C    C+ G  K   C               ++  WRS    P  CP N  Y  C  +C   C   I    C   C  GC C     ++G  CVP   C C+  +G  + V    +   +DC+  C C   G+  C +              +R C      C IS     ++FD     VE       VA+    T     ++ V    C K + A+   ++ + F    N   + + +   I VN      P  + + L +   +V   +V+I+  + +R+ +    ++ +T+      +V G CGNYN  SEDD   + G++TT+ + +  SW+  +
Sbjct: 2112 LKVLYDTVYYVEVIVPSTYQGKMCGLCGNY--NKKDRDEFRLPGGKGTKNVNEFGKSWVVDLP----------EHICGGCEEDCPVCEKANA----VLYEKLDSCGIMKAPDGPFQA-CHSKI----DPAAYVSDCVFDVCAAGGSKEILCNSVQAYVLACQNAGVQIQPWRSSSFCPASCPPNSHYEVCADTCRGTCASFIQQLTCSESCFEGCECDAGFVFDGAQCVPLENCGCVH-DGRYLTVNQ--VVVDKDCQSRCVCEASGLVKCQRLSCSSTEVCDVRGGVRSCHIKQAHCTISHAGQLSSFDGMTAAVEAQ-GAVEVASLCDETSENWFRVVVDVRVCHKKS-AFAPATVHVFF----NEATVTVNSQHGIWVNGKKVSPPNNLTNQLSV---QVLDRSVVIQRKSAVRVTYSVSQEVTVTVDNSLASKVCGACGNYNSESEDDLKTADGKVTTDMSVVIGSWSAED 2553          

HSP 13 Score: 61.2326 bits (147), Expect = 1.388e-8
Identity = 62/288 (21.53%), Postives = 110/288 (38.19%), Query Frame = 2
Query: 2894 CPPGKEWKECGH-CDQTCEN--QDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYL--NQSVIYTGPTNCLSKCTCNEG------KWGCEQEQKC------------VGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGK-GIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSR 3685
            CPP   ++ C   C  TC +  Q   C E  C  GC C  G++     CVP   C C+  D  YL  NQ V+     +C S+C C         +  C   + C               C         +FDG      ++   V V S C +    +F++V +   C  K      ++  ++    V +       V   +  P + +  ++S + L   ++I   S + + +     + + +     ++VCG CGN++    +D K+  G    ++   + SW + 
Sbjct: 2271 CPPNSHYEVCADTCRGTCASFIQQLTCSES-CFEGCECDAGFVFDGAQCVPLENCGCV-HDGRYLTVNQVVV---DKDCQSRCVCEASGLVKCQRLSCSSTEVCDVRGGVRSCHIKQAHCTISHAGQLSSFDGMTAAVEAQ-GAVEVASLCDETSENWFRVVVDVRVCHKKSAFAPATVHVFFNEATVTVNSQHGIWVNGKKVSPPNNLTNQLSVQVLDRSVVIQRKSAVRVTYSVSQEVTVTVDNSLASKVCGACGNYNSESEDDLKTADGKVTTDMSVVIGSWSAE 2552          
BLAST of Hemocytin vs. Planmine SMEST
Match: SMESG000025547.1 (SMESG000025547.1)

HSP 1 Score: 3546.52 bits (9195), Expect = 0.000e+0
Identity = 1744/1744 (100.00%), Postives = 1744/1744 (100.00%), Query Frame = 2
Query:   71 MKLVQIFIWLVLSLSIQILAEDNNRFCGESFVREPFQACDDAKESLKDNDQLVTVGEQCQIKRYKRKCCNGWTGTDCQFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGCIRGKCKNGDCLCDSGYEGERCDRAFCQYGCGTGICVEPNVCQCPENFRGRNCETFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPKCITSTTSYCIGSKLTKCENGVCARICNGIPECSDGSDEANCXXXXXXXXXXXXXQPHCIYEGRIMQIGEVIKLESCLSVTCTDRRIVETRQNCDKTCQPNYVLKLYPDKCCECQLIXXXXXXXXXXXXXFEKCEKRPAKLTSDSTSVKILNVRGGTEADVANTFTRNADSWIVRNSNASFTLSLPPQAGTELIIVGFQMDITKPFKVVVSFGNEVNKVELNPYTVIGQGKAGKLFQTISKDGESFPFVKFTIESQNNEELEIRNFVLWICYKXXXXXXXXXXXXXXXXXXXXXXEVCSKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNKNEVSFV 5302
            MKLVQIFIWLVLSLSIQILAEDNNRFCGESFVREPFQACDDAKESLKDNDQLVTVGEQCQIKRYKRKCCNGWTGTDCQFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGCIRGKCKNGDCLCDSGYEGERCDRAFCQYGCGTGICVEPNVCQCPENFRGRNCETFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPKCITSTTSYCIGSKLTKCENGVCARICNGIPECSDGSDEANCTSTQTKTLPTTTTQPHCIYEGRIMQIGEVIKLESCLSVTCTDRRIVETRQNCDKTCQPNYVLKLYPDKCCECQLITSTTWTVSHTTTVFEKCEKRPAKLTSDSTSVKILNVRGGTEADVANTFTRNADSWIVRNSNASFTLSLPPQAGTELIIVGFQMDITKPFKVVVSFGNEVNKVELNPYTVIGQGKAGKLFQTISKDGESFPFVKFTIESQNNEELEIRNFVLWICYKIGTTIITPPVTTPTTSTTITTPEVCSKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNKNEVSFV
Sbjct:    1 MKLVQIFIWLVLSLSIQILAEDNNRFCGESFVREPFQACDDAKESLKDNDQLVTVGEQCQIKRYKRKCCNGWTGTDCQFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGCIRGKCKNGDCLCDSGYEGERCDRAFCQYGCGTGICVEPNVCQCPENFRGRNCETFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPDPKCITSTTSYCIGSKLTKCENGVCARICNGIPECSDGSDEANCTSTQTKTLPTTTTQPHCIYEGRIMQIGEVIKLESCLSVTCTDRRIVETRQNCDKTCQPNYVLKLYPDKCCECQLITSTTWTVSHTTTVFEKCEKRPAKLTSDSTSVKILNVRGGTEADVANTFTRNADSWIVRNSNASFTLSLPPQAGTELIIVGFQMDITKPFKVVVSFGNEVNKVELNPYTVIGQGKAGKLFQTISKDGESFPFVKFTIESQNNEELEIRNFVLWICYKIGTTIITPPVTTPTTSTTITTPEVCSKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNKNEVSFV 1744          

HSP 2 Score: 145.206 bits (365), Expect = 3.487e-34
Identity = 96/222 (43.24%), Postives = 132/222 (59.46%), Query Frame = 2
Query: 4658 EKCEKRPAKLT-SDSTSVKILNVRGGTEADVANTFTRNADSWIVRNSNASFTLSLPPQAGTELIIVGFQMDITKPFKVVVSFGNEVNKVELNPYTVIGQGKAGKLFQTISKDGESFPFVKFTIESQNNEELEIRNFVLWICYKXXXX------XXXXXXXXXXXXXXXXXXEVCSKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNKNEVSFV 5302
            E C K    LT ++   V+I NV  G   DV    T   + W   N+  SF + L P++ T++ IV  ++++     V ++FG + +++  + Y   G  K    F    K+GE F ++K +I +     L ++N ++ +CY+  +T        +    T +   TITTPEVC+KEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNKNEVSFV
Sbjct: 2028 EVCAKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKE-WNSNNNEISFVIKLTPKSNTKVNIVNLEINVNINSIVTITFGKKSDEIVESQYKSRGSEKFEFNFDQTDKNGEQFEYMKVSIRTNVGYTLTVKNLIVKVCYESVSTSSFPTPTTSQNTFTLSPKPTITTPEVCAKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNKNEVSFV 2248          

HSP 3 Score: 144.821 bits (364), Expect = 3.957e-34
Identity = 94/219 (42.92%), Postives = 131/219 (59.82%), Query Frame = 2
Query: 4658 EKCEKRPAKLT-SDSTSVKILNVRGGTEADVANTFTRNADSWIVRNSNASFTLSLPPQAGTELIIVGFQMDITKPFKVVVSFGNEVNKVELNPYTVIGQGKAGKLFQTISKDGESFPFVKFTIESQNNEELEIRNFVLWICYKXXXXXXXXXXXXXXXXX---XXXXXEVCSKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNKNEVSFV 5302
            E C K    LT ++   V+I NV  G   DV    T   + W    +  SF + L P++ TE+ IV  ++++     V V+FG +  ++    Y   G       F    K+GE F +VK ++ + + + L ++N ++ +CY+  TT      ++  +++    ITTPEVC+KEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNKNE+SFV
Sbjct: 2198 EVCAKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKE-WNSNKNEVSFVIKLTPKSNTEVNIVNLEINVNTNSIVTVTFGKKSEEIIEQEYKKTGTETIKFYFNKTDKNGEQFEYVKVSVITTDGKPLTVKNLLVKVCYESVTTTTQVTTSSTASTSTKPVITTPEVCAKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNKNEISFV 2415          

HSP 4 Score: 144.821 bits (364), Expect = 3.957e-34
Identity = 94/219 (42.92%), Postives = 132/219 (60.27%), Query Frame = 2
Query: 4658 EKCEKRPAKLT-SDSTSVKILNVRGGTEADVANTFTRNADSWIVRNSNASFTLSLPPQAGTELIIVGFQMDITKPFKVVVSFGNEVNKVELNPYTVIGQGKAGKLFQTISKDGESFPFVKFTIESQNNEELEIRNFVLWICYKXXXXXXXXXXXXXXXXXXX---XXXEVCSKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNKNEVSFV 5302
            E C K    LT ++   V+I NV  G   DV    T +   W   N+  SF + L P++ TE+ IV  ++++     V V+FG +  ++    Y   G       F    K+GE F +VK ++ + + + L ++N ++ +CY+  TT      ++  +++T    TTPEVC+KEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEK+WNSNKNE+SFV
Sbjct: 2532 EVCAKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILT-SEKKWNSNNNEISFVIKLTPKSNTEVNIVNLEINVNTNSIVTVTFGKKSEEIIQPEYKKTGTDTIKFYFNKTDKNGEQFEYVKVSVITTDGKPLTVKNLIVKVCYESVTTTTQVTTSSTASTSTKPIITTPEVCAKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKKWNSNKNEISFV 2749          

HSP 5 Score: 144.436 bits (363), Expect = 5.404e-34
Identity = 94/219 (42.92%), Postives = 131/219 (59.82%), Query Frame = 2
Query: 4658 EKCEKRPAKLT-SDSTSVKILNVRGGTEADVANTFTRNADSWIVRNSNASFTLSLPPQAGTELIIVGFQMDITKPFKVVVSFGNEVNKVELNPYTVIGQGKAGKLFQTISKDGESFPFVKFTIESQNNEELEIRNFVLWICYKXXXXXXXXXXXXXXXXXXX---XXXEVCSKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNKNEVSFV 5302
            E C K    LT ++   V+I NV  G   DV    T   + W   N+  SF + L P++ TE+ IV  ++++     V V+FG +  ++    Y   G       F    K+GE F +VK ++ + + + L ++N ++ +CY+  TT      ++  +++T    TTPEVC+KEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSN NE+SFV
Sbjct: 1861 EVCAKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKE-WNSNNNEISFVIKLTPKSNTEVNIVNLEINVNTNSIVTVTFGKKSEEIIEPVYKTTGTETIKFYFNKTDKNGEQFEYVKVSVITTDGKPLTVKNLLVKVCYESVTTTTQVTTSSTASTSTKPIITTPEVCAKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNNNEISFV 2078          

HSP 6 Score: 142.51 bits (358), Expect = 2.045e-33
Identity = 93/219 (42.47%), Postives = 130/219 (59.36%), Query Frame = 2
Query: 4658 EKCEKRPAKLT-SDSTSVKILNVRGGTEADVANTFTRNADSWIVRNSNASFTLSLPPQAGTELIIVGFQMDITKPFKVVVSFGNEVNKVELNPYTVIGQGKAGKLFQTISKDGESFPFVKFTIESQNNEELEIRNFVLWICYKXXXXXXXXXXXXXXXXX---XXXXXEVCSKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNKNEVSFV 5302
            E C K    LT ++   V+I NV  G   DV    T   + W    +  SF + L P++ TE+ IV  ++++     V V+FG +  ++    Y   G       F    K+GE F +VK ++ + + + L ++N ++ +CY+  TT      ++  +++    ITTPEVC+KEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSN NE+SFV
Sbjct: 1694 EVCSKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKE-WNSNKNEVSFVIKLTPKSNTEVNIVNLEINVNTNSIVTVTFGKKSEEIIQPEYKKTGTETIKFYFNKTDKNGEQFEYVKVSVITTDGKPLTVKNLLVKVCYESVTTTTQVTTSSTASTSTKPVITTPEVCAKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNNNEISFV 1911          

HSP 7 Score: 140.198 bits (352), Expect = 9.390e-33
Identity = 92/219 (42.01%), Postives = 130/219 (59.36%), Query Frame = 2
Query: 4658 EKCEKRPAKLT-SDSTSVKILNVRGGTEADVANTFTRNADSWIVRNSNASFTLSLPPQAGTELIIVGFQMDITKPFKVVVSFGNEVNKVELNPYTVIGQGKAGKLFQTISKDGESFPFVKFTIESQNNEELEIRNFVLWICYKXXXXXXXXXXXXXXXXXXX---XXXEVCSKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKEWNSNKNEVSFV 5302
            E C K    LT ++   V+I NV  G   DV    T   + W    +  SF + L P++ TE+ IV  ++++     V V+FG +  ++    Y   G       F    K+GE F +VK ++ + + + L ++N ++ +CY+  TT      ++  +++T    TTPEVC+KEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEK+WNSN NE+SFV
Sbjct: 2365 EVCAKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKE-WNSNKNEISFVIKLTPKSNTEVNIVNLEINVNTNSIVTVTFGKKSEEIIQPEYKKTGTETIKFYFNKTDKNGEQFEYVKVSVITTDGKPLTVKNLLVKVCYESVTTTTQVTTSSTASTSTKPIITTPEVCAKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTSEKKWNSNNNEISFV 2582          

HSP 8 Score: 114.005 bits (284), Expect = 8.767e-25
Identity = 81/208 (38.94%), Postives = 117/208 (56.25%), Query Frame = 2
Query: 4658 EKCEKRPAKLT-SDSTSVKILNVRGGTEADVANTFTRNADSWIVRNSNASFTLSLPPQAGTELIIVGFQMDITKPFKVVVSFGNEVNKVELNPYTVIGQGKAGKLFQTISKDGESFPFVKFTIESQNNEELEIRNFVLWICYKXXXXXX------XXXXXXXXXXXXXXXXEVCSKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTS 5260
            E C K    LT ++   V+I NV  G   DV    T +   W    +  SF + L P++ T++ IV  ++++     V ++FG + +++  + Y   G  K    F    K+GE F ++K +I +     L ++N ++ +CY+  +T        +    T +   TITTPEVC+KEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTS
Sbjct: 2699 EVCAKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILT-SEKKWNSNKNEISFVIKLTPKSNTKVNIVNLEINVNINSIVTITFGKKSDEIVESQYKSRGSEKFEFNFDQTDKNGEQFEYMKVSIRTNVGYTLTVKNLIVKVCYESVSTSSFPTPTTSQTTFTLSPKPTITTPEVCAKEVVTLTKNEKMKVEIQNVTNGNVTDVEKILTS 2905          
BLAST of Hemocytin vs. Planmine SMEST
Match: SMESG000041532.1 (SMESG000041532.1)

HSP 1 Score: 822.772 bits (2124), Expect = 0.000e+0
Identity = 456/1293 (35.27%), Postives = 683/1293 (52.82%), Query Frame = 2
Query:  482 GYEGERCDRAFCQYGCGTGICVEPNVCQCPENFR-GRNCETFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGI-SIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLM------IET---ASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYW--------KNPDPIDPNTYYTTGRDLCTGLNKDLVTTAN-NMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQL-CAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPC-IRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAEC--KSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCG---GNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLP------NSDKKYNPGEIFTENCLICVCNENNFKCRPD 4261
            G+ G++C+   C+ GCG G C+EPN+C C E  R G+ CE F  E  + +       N +  D   C+ + G    TFD + +++    G+ +LV DC+SR P+Y+I      +C  K   +C+ ++       IE    +S+ V    +S S   S   +    Q  + G +  +KGI +L I Y+ K ++F+FAP+TMKK VCGLCG +DGN     E  + +   IE   +F+K W          PDP                +N DL   A       +FG             ++ IC +E C   N   +  +  +IA        +  + +  + +WR +L C    CP    +S+CG++C+  C     D +C   CT GC+C KD FW    C    +CPC  R +   +  Y  G   K+ C+ C C   G++ C     CS  C+I+GDPH+ TFD +HI+VEG C Y  V  K   +    L I V+N  C  S D  C K + + FG+  N T I++ +   +++N     +P +IN  + +++ +V  D + IE+ +   +     ++IE+ L   Y  +V GLCGN+NG+ EDD     G    +D+ELA  +   +      L  SYLG+C  S E+ K A E C +     F  C   V  + F+ QC+HD+C CG        NC C + ++Y R C   G+  +WR+   C   CP  M Y EC + CS +C    + NC  +CIDGCQC  +MV +     CV +  C+C +    Y +   RK++CN C C NG+W+CT  DCS+ ++CP GK WK+CG C +TC + +  C    C+ GC+C  G +  N  C+PK +CPC W ++S+   +VI  GP  C   CTC  GKW C + + C G CK+WG++HY +FDGK+FDF   CSYV+++  C K  G FK+V EN+ECG+KGTSCTKSI FYY++ ++ LIRG  P +  N  +      G  S  D VS ++I T  ++ + WD+ LS+++ L P+Y+N VCGLCGNFD N++ND +++AG  + ++ AF DSWK + +CP  +   + C  N  R++WA K C  +K+  F  C   V  +LYY KC+ D+C+CDRG DC C+CTA+S +   C +Y I   WR+ E CP+MCPP++ +K C   CP+ C  +       ++C  +C+EGC C         +N  +K++EC  + P       S K+Y  G    +NC  C C  N F+C  +
Sbjct:   38 GWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQ------NIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEF----QISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDP------------AIQMVNCDLNEMATCAKVVSIFGSK-----------FEEICYAEFCQMKNQKNSCELMRDIA--------FLSSPDNIVSDWRYKLDCEEPNCPNKMIWSDCGNNCNNRCGFNNDDVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPK-RDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITK-ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGT-------KSCISDCMEGCYC--------KNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 1272          
BLAST of Hemocytin vs. Planmine SMEST
Match: SMESG000041532.1 (SMESG000041532.1)

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 456/1293 (35.27%), Postives = 683/1293 (52.82%), Query Frame = 2
Query:  482 GYEGERCDRAFCQYGCGTGICVEPNVCQCPENFR-GRNCETFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGI-SIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLM------IET---ASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYW--------KNPDPIDPNTYYTTGRDLCTGLNKDLVTTAN-NMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQL-CAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPC-IRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAEC--KSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCG---GNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLP------NSDKKYNPGEIFTENCLICVCNENNFKCRPD 4261
            G+ G++C+   C+ GCG G C+EPN+C C E  R G+ CE F  E  + +       N +  D   C+ + G    TFD + +++    G+ +LV DC+SR P+Y+I      +C  K   +C+ ++       IE    +S+ V    +S S   S   +    Q  + G +  +KGI +L I Y+ K ++F+FAP+TMKK VCGLCG +DGN     E  + +   IE   +F+K W          PDP                +N DL   A       +FG             ++ IC +E C   N   +  +  +IA        +  + +  + +WR +L C    CP    +S+CG++C+  C     D +C   CT GC+C KD FW    C    +CPC  R +   +  Y  G   K+ C+ C C   G++ C     CS  C+I+GDPH+ TFD +HI+VEG C Y  V  K   +    L I V+N  C  S D  C K + + FG+  N T I++ +   +++N     +P +IN  + +++ +V  D + IE+ +   +     ++IE+ L   Y  +V GLCGN+NG+ EDD     G    +D+ELA  +   +      L  SYLG+C  S E+ K A E C +     F  C   V  + F+ QC+HD+C CG        NC C + ++Y R C   G+  +WR+   C   CP  M Y EC + CS +C    + NC  +CIDGCQC  +MV +     CV +  C+C +    Y +   RK++CN C C NG+W+CT  DCS+ ++CP GK WK+CG C +TC + +  C    C+ GC+C  G +  N  C+PK +CPC W ++S+   +VI  GP  C   CTC  GKW C + + C G CK+WG++HY +FDGK+FDF   CSYV+++  C K  G FK+V EN+ECG+KGTSCTKSI FYY++ ++ LIRG  P +  N  +      G  S  D VS ++I T  ++ + WD+ LS+++ L P+Y+N VCGLCGNFD N++ND +++AG  + ++ AF DSWK + +CP  +   + C  N  R++WA K C  +K+  F  C   V  +LYY KC+ D+C+CDRG DC C+CTA+S +   C +Y I   WR+ E CP+MCPP++ +K C   CP+ C  +       ++C  +C+EGC C         +N  +K++EC  + P       S K+Y  G    +NC  C C  N F+C  +
Sbjct:   38 GWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQ------NIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEF----QISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDP------------AIQMVNCDLNEMATCAKVVSIFGSK-----------FEEICYAEFCQMKNQKNSCELMRDIA--------FLSSPDNIVSDWRYKLDCEEPNCPNKMIWSDCGNNCNNRCGFNNDDVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPK-RDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITK-ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGT-------KSCISDCMEGCYC--------KNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 1272          
BLAST of Hemocytin vs. Planmine SMEST
Match: SMESG000041532.1 (SMESG000041532.1)

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 456/1293 (35.27%), Postives = 683/1293 (52.82%), Query Frame = 2
Query:  482 GYEGERCDRAFCQYGCGTGICVEPNVCQCPENFR-GRNCETFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGI-SIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLM------IET---ASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYW--------KNPDPIDPNTYYTTGRDLCTGLNKDLVTTAN-NMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQL-CAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPC-IRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAEC--KSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCG---GNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLP------NSDKKYNPGEIFTENCLICVCNENNFKCRPD 4261
            G+ G++C+   C+ GCG G C+EPN+C C E  R G+ CE F  E  + +       N +  D   C+ + G    TFD + +++    G+ +LV DC+SR P+Y+I      +C  K   +C+ ++       IE    +S+ V    +S S   S   +    Q  + G +  +KGI +L I Y+ K ++F+FAP+TMKK VCGLCG +DGN     E  + +   IE   +F+K W          PDP                +N DL   A       +FG             ++ IC +E C   N   +  +  +IA        +  + +  + +WR +L C    CP    +S+CG++C+  C     D +C   CT GC+C KD FW    C    +CPC  R +   +  Y  G   K+ C+ C C   G++ C     CS  C+I+GDPH+ TFD +HI+VEG C Y  V  K   +    L I V+N  C  S D  C K + + FG+  N T I++ +   +++N     +P +IN  + +++ +V  D + IE+ +   +     ++IE+ L   Y  +V GLCGN+NG+ EDD     G    +D+ELA  +   +      L  SYLG+C  S E+ K A E C +     F  C   V  + F+ QC+HD+C CG        NC C + ++Y R C   G+  +WR+   C   CP  M Y EC + CS +C    + NC  +CIDGCQC  +MV +     CV +  C+C +    Y +   RK++CN C C NG+W+CT  DCS+ ++CP GK WK+CG C +TC + +  C    C+ GC+C  G +  N  C+PK +CPC W ++S+   +VI  GP  C   CTC  GKW C + + C G CK+WG++HY +FDGK+FDF   CSYV+++  C K  G FK+V EN+ECG+KGTSCTKSI FYY++ ++ LIRG  P +  N  +      G  S  D VS ++I T  ++ + WD+ LS+++ L P+Y+N VCGLCGNFD N++ND +++AG  + ++ AF DSWK + +CP  +   + C  N  R++WA K C  +K+  F  C   V  +LYY KC+ D+C+CDRG DC C+CTA+S +   C +Y I   WR+ E CP+MCPP++ +K C   CP+ C  +       ++C  +C+EGC C         +N  +K++EC  + P       S K+Y  G    +NC  C C  N F+C  +
Sbjct:   38 GWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQ------NIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEF----QISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDP------------AIQMVNCDLNEMATCAKVVSIFGSK-----------FEEICYAEFCQMKNQKNSCELMRDIA--------FLSSPDNIVSDWRYKLDCEEPNCPNKMIWSDCGNNCNNRCGFNNDDVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPK-RDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITK-ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGT-------KSCISDCMEGCYC--------KNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 1272          
BLAST of Hemocytin vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 367.081 bits (941), Expect = 3.396e-102
Identity = 404/1463 (27.61%), Postives = 610/1463 (41.70%), Query Frame = 2
Query:  326 CKNGGRCIEPDRCQCDPKFSGADCS----FRIADEKPCIQGCIRG----KCKNGDCLCDSGYEGERCDRAFCQYGCGTGICVEPNVCQCPENFRGRNCETFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLSNSSTNSNRNYISSIQHKNIGDFNQIKGI-----------------GELEILYDGKRNVFIFAPLTM-KKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKN---PDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDV---FGG--DLSQCTILPVIPYQSICRSELC---HCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDEN--CKSFCTAGCFCPKDRFWNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFD-KRHIYVEGSCFYTMVATKPSITGNQ----VLKIWVQNTHCM---KSNDAYCT----------------KSLSLQFGDTDNSTFI--QLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRLLYEP-FNSCHMS--VDPNPFIQQCEHDICLCGGNEKDNCA-CESMASYGRACMKNGLTLKWRSSS----LCDPKC-PNGMEYMECKNLCSVSCFSL---TQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQC----SHENAYYPSGSTRKEKCNDCNCTNGVWSC-TKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCP-DGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGC--EQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDS--DCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPK-DRVKGRISF-RDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVN-CP---------AAKDVPDMCKSNHERQAWADKMCGTMKNVK--FADCQKVV--DTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCA-KNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEIFTENCLICVCNENNFKCRPD-PKCITSTTSYCIGSKLTKCENGVC---ARICNGIPECSDGSDEANC 4390
            C NGG C+ P++C+C   ++G  C       I  + P    C +       K  D L  +    E C      +G  +G CV      C  NF G N                DV N   +++  C   G  Y  TFD        R S IL         ++ I  N  Y   T D   C   ++IE     V   G     T  + N ++ +   N      I G                  G +++ +D   N+FI    ++    V GLCG  D N S  ++F N      +NV  F   +K    PD    NT  T   D       D +  AN  C  +   F G  DL          Y S+C   +C      N   +I   +++ C+  S  S  C+  G  I WRS      +CP NK +S+C S C   C +L    +  C++     C C       G  C+    CPC+         +  G   + DC  C C+   +++C + + C  TC I G   + TFD  +  + +  C Y  VA +PS+        V  I   NT  M   + N AY                  K+ S Q GD+  + FI  +  TTK          LP  I D   + ++++ +    ++  +  ++ +     I I + +  ++ + GLCG ++GNSE+D T+    +  +   +A S+ T  C +T             +      + C  +L  P F+ C  S  VD   +   C  +      + KD  + C ++ +   AC + G+  +   +S     C P C   G  +  C   C  +C  L   T + C  +C  GC+C  N  Y T   QCV+ S+C C      ++   P+G+     C  C C NG  +C TK++C+N   CP  + + +      +C N D         + C CP D     + TCV    CPC++ ++ Y    VI    T   +K  C+   W    E+   C   C ++GD HYKT DG+ F F   C Y ++D+  D    I    +   NI CG    +C K +      Q   L RG    +     +PK D V  +++F   LVS  I      + + WD+   + + L P +Q  V GLCGN+D +L N++      YE+ I  F +S+ +  + CP         A     DMC +N +R++WA++MCG MK+    FA C + +  D   YY  CL D C C+RGGDCECLCT+L+ F + C   GI   WR+  LCP+MC   K +  C + CP+ C    + +    +C+  +CVEGCSCP   I+  G  +CV    C C   N     N   I  ENC  C C +  F C  D   CIT+    C  S+  +C++G C   ++IC+ + +CS+  DE NC
Sbjct:  153 CYNGGICMSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCV-----SCKANFAGGN----------------DVNN---ENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSI--NIVYENCTSD-TGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPS--NDFSNF-----DNVASFGNSFKGFGCPDI--ANTLSTCKPD-------DQIL-ANQQCSKIRLKFPGCADLVNSDT-----YFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQE----HPPGTVRQFDCNTCTCNSS-LWHCTE-KICPSTCGIMGT-QFDTFDGAKFAFNDVGCQY--VAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTK----------LPFTIPDK-NIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNT--------PQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRRE----QSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNY-YKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTN-PVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVI----TIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTI---PLFPKYDIVIEQLTFFTQLVSDSI-----GLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAI-QFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTC--DTIGSNAPSHCSTTHCVEGCSCPNGMIDLNG--ECVPPTTCPC-FYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITT----CTPSQF-RCDDGKCIESSKICDKVTDCSNSEDEKNC 1509          

HSP 2 Score: 132.109 bits (331), Expect = 3.629e-30
Identity = 141/552 (25.54%), Postives = 230/552 (41.67%), Query Frame = 2
Query: 1436 LNGKLINWRSQLCAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRF--WNGTYCVPKPQCPCIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQV--LKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSE----------DDATKSSGELTTNDN----ELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQRL--LYEPFNSC--HMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSL---TQTNCST-ECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRK-EKCNDCNCTNGVWSCTKN-------------------------DCSNVTFCPPGKEWKECGHCD 2935
            +NG+L       C    CP N+ Y +  S C+ +C +  T  +  S   + C CP D     +GT CV    CPCI  N       +  ++ K    IC      + +  +   C   C+  GDPHY T D +    +GSC YT++ T P  + N +  + I V N  C  S  A C K             F+Q++      +    N   + +     + I+++   T L+    G+R+LW + T++ + L   +Q  VQGLCGNY+G+ +          +DA + +     N +    E++     A  K         +C  + + + +A++ C  +      F SC   M  D N +   C +D C C       C C S+A++   C   G+ +KWR+ +LC   C  G  Y  C + C  +C ++     ++CST  C++GC C + M+      +CV  + C C +    Y +G+  K E C  C C    ++CT++                          C  VT C   ++ K C  CD
Sbjct:  991 INGRLNCKTKDNCTNPVCPKNQVYMDSVSGCN-SCTNYDTCTDTSSIANS-CGCPNDTVSKIDGT-CVQPSDCPCIYMNRE--YAPNDVITIKCAKYICSNRMWNLLS-EETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDT-PGDSSNNIPPITISVANIACGFS-LATCAK-------------FVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQ------DMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNG--ECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCD 1513          
The following BLAST results are available for this feature:
BLAST of Hemocytin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MUC23.453e-13728.69mucin 2, oligomeric mucus/gel-forming [Source:HGNC... [more]
MUC23.469e-13528.64mucin 2, oligomeric mucus/gel-forming [Source:HGNC... [more]
MUC28.695e-13528.64mucin 2, oligomeric mucus/gel-forming [Source:NCBI... [more]
MUC28.695e-13528.64mucin 2, oligomeric mucus/gel-forming [Source:NCBI... [more]
MUC5AC1.002e-13028.74mucin 5AC, oligomeric mucus/gel-forming [Source:HG... [more]
back to top
BLAST of Hemocytin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T01D3.15.096e-1638.18pep chromosome:WBcel235:V:13689892:13703330:1 gene... [more]
T01D3.61.934e-1223.19pep chromosome:WBcel235:V:13716824:13720402:1 gene... [more]
T01D3.61.311e-1123.01pep chromosome:WBcel235:V:13716849:13720402:1 gene... [more]
apx-11.067e-1035.11Anterior pharynx in excess protein 1 [Source:UniP... [more]
ten-11.051e-935.04Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
back to top
BLAST of Hemocytin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hml4.529e-12427.35gene:FBgn0029167 transcript:FBtr0075753[more]
Hml5.316e-12427.35gene:FBgn0029167 transcript:FBtr0333020[more]
cv-22.378e-2224.46gene:FBgn0000395 transcript:FBtr0071610[more]
Ten-a3.142e-1436.28gene:FBgn0267001 transcript:FBtr0308221[more]
Ten-a3.142e-1436.28gene:FBgn0267001 transcript:FBtr0299860[more]
back to top
BLAST of Hemocytin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vwf3.363e-14528.96von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-07... [more]
vwf6.820e-14529.19von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-07... [more]
scospondin4.114e-13028.47subcommissural organ spondin [Source:ZFIN;Acc:ZDB-... [more]
muc5.21.783e-12029.40mucin 5.2 [Source:ZFIN;Acc:ZDB-GENE-121108-1][more]
muc5.31.003e-11828.87mucin 5.3 [Source:ZFIN;Acc:ZDB-GENE-040426-1562][more]
back to top
BLAST of Hemocytin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000006505.11.227e-14328.34SCO-spondin [Source:NCBI gene;Acc:100497129][more]
ndufs89.543e-13327.91NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
igsf102.511e-13131.77immunoglobulin superfamily member 10 [Source:Xenba... [more]
ndufs88.191e-13127.60NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
ndufs81.282e-13027.91NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
back to top
BLAST of Hemocytin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sspo5.159e-12927.12SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Sspo5.547e-12927.12SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Muc5ac2.941e-12829.90mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
Muc5ac5.329e-12629.65mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
Muc5ac5.329e-12629.65mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
back to top
BLAST of Hemocytin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q02817|MUC2_HUMAN8.480e-13528.72Mucin-2 OS=Homo sapiens OX=9606 GN=MUC2 PE=1 SV=2[more]
sp|Q62635|MUC2_RAT2.538e-13428.73Mucin-2 (Fragment) OS=Rattus norvegicus OX=10116 G... [more]
sp|P98088|MUC5A_HUMAN4.812e-13028.74Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 S... [more]
sp|Q80Z19|MUC2_MOUSE1.544e-12928.16Mucin-2 (Fragments) OS=Mus musculus OX=10090 GN=Mu... [more]
sp|Q2PC93|SSPO_CHICK1.398e-12829.74SCO-spondin OS=Gallus gallus OX=9031 GN=SSPO PE=2 ... [more]
back to top
BLAST of Hemocytin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DLR60.000e+033.86Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GUZ70.000e+034.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G0U90.000e+034.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GY380.000e+034.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0L8GSF53.276e-3635.18Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of Hemocytin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vwf3.751e-14028.73von Willebrand factor [Source:NCBI gene;Acc:103041... [more]
scospondin1.828e-13328.32subcommissural organ spondin [Source:ZFIN;Acc:ZDB-... [more]
ENSAMXT00000041370.13.706e-12629.35pep primary_assembly:Astyanax_mexicanus-2.0:5:1809... [more]
ENSAMXT00000055757.11.244e-12029.24pep primary_assembly:Astyanax_mexicanus-2.0:5:1810... [more]
ENSAMXT00000051667.11.808e-12029.55pep primary_assembly:Astyanax_mexicanus-2.0:5:1810... [more]
back to top
BLAST of Hemocytin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010519.12.470e-11427.67pep scaffold:Pmarinus_7.0:GL477612:23664:47127:1 g... [more]
ENSPMAT00000008773.14.865e-11227.92pep scaffold:Pmarinus_7.0:GL476328:703641:749596:1... [more]
ENSPMAT00000008652.19.545e-10332.97pep scaffold:Pmarinus_7.0:GL477625:577100:586386:1... [more]
ENSPMAT00000008716.15.664e-9825.93pep scaffold:Pmarinus_7.0:GL476328:595486:663084:-... [more]
tecta2.696e-7725.83tectorin alpha [Source:ZFIN;Acc:ZDB-GENE-110411-12... [more]
back to top
BLAST of Hemocytin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hemocytin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO441995.852e-9827.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418771.610e-5834.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418763.380e-5231.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330612.106e-3130.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO285021.459e-1337.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hemocytin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vwf3.885e-13527.43von Willebrand factor [Source:NCBI gene;Acc:101162... [more]
scospondin1.044e-11526.09SCO-spondin [Source:NCBI gene;Acc:101172449][more]
otog2.180e-10126.50otogelin [Source:NCBI gene;Acc:101158818][more]
zanl3.862e-8225.37zonadhesin [Source:NCBI gene;Acc:101162078][more]
FCGBP2.080e-7624.83Fc fragment of IgG binding protein [Source:NCBI ge... [more]
back to top
BLAST of Hemocytin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025547.13.487e-34100.00SMESG000025547.1[more]
SMESG000041532.10.000e+035.27SMESG000041532.1[more]
SMESG000041532.10.000e+035.27SMESG000041532.1[more]
SMESG000041532.10.000e+035.27SMESG000041532.1[more]
SMESG000042718.13.396e-10227.61SMESG000042718.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006765 ID=SMED30006765|Name=Hemocytin|organism=Schmidtea mediterranea sexual|type=transcript|length=5302bp
TTTAAATTCGATTGAATATATCAGAAATAAAATTCATATTAATAATCAAA
GAATATATTTTCATTCACACATGAAGCTCGTACAGATCTTCATTTGGCTT
GTTTTGTCTCTCAGCATTCAAATTCTTGCTGAAGATAACAACCGATTTTG
TGGCGAGTCCTTCGTTAGGGAACCGTTTCAAGCTTGTGACGATGCTAAAG
AATCTCTTAAAGACAATGATCAACTTGTAACAGTAGGTGAACAATGTCAA
ATTAAACGATACAAACGTAAATGCTGCAACGGTTGGACAGGAACCGATTG
TCAATTTCCAATATGCCAGCAACTTTGTAAAAATGGCGGGAGATGTATAG
AGCCAGATAGATGCCAGTGTGATCCTAAGTTTTCTGGCGCTGATTGCTCA
TTCAGAATTGCTGACGAGAAACCATGCATTCAAGGCTGCATTAGAGGAAA
GTGTAAAAACGGCGACTGCCTTTGTGATTCAGGTTATGAAGGTGAACGAT
GCGACCGAGCATTTTGTCAATATGGTTGCGGAACTGGAATATGCGTCGAA
CCGAATGTCTGTCAGTGTCCTGAGAATTTTCGAGGCAGAAATTGCGAAAC
TTTTTTCAGGGAACCCAACACGTCTAATCTTAAAATATCAGATGTGATAA
ACACCAAATACAAAGACTATCAATTATGTTCGATTATGGGTGGAAGCTAC
GTTACGACATTCGATGGAATCTCAATAGAAAATCCACTGAGAGGTTCAAA
TATTCTCGTCATTGACTGCTTAAGTCGAAAGCCGAGTTATCGAATTTTCT
TCAACAGTAGTTATAATTGTCCGACCAAAGATTTTGTAAATTGTGACACT
TCATTGATGATTGAAACCGCATCCGAATCAGTCACTTTCCTGGGATTATC
AAATTCTTCTACCAATTCTAACAGGAATTATATCAGTTCAATTCAACATA
AAAATATTGGAGATTTCAATCAAATTAAAGGAATCGGAGAGCTGGAGATT
TTGTATGATGGAAAAAGAAACGTTTTCATTTTTGCACCATTAACAATGAA
GAAAAGCGTTTGTGGTCTTTGTGGATACTTTGATGGAAACAGTTCACTTA
GTTCGGAATTTAAAAACATTAACGGAGAATCCATTGAAAATGTGACAGAA
TTCATGAAATACTGGAAAAACCCCGATCCGATTGATCCCAATACATATTA
CACCACTGGCCGTGATTTATGTACTGGATTGAATAAAGATTTAGTGACAA
CAGCTAATAACATGTGCCAAGATGTATTTGGTGGGGACCTATCTCAATGT
ACCATTCTACCAGTTATTCCCTACCAATCGATATGCCGCAGTGAATTATG
CCATTGCTTGAACGCCGGACAGAATATCAGTGTTTGTGCCAACATCGCAT
GCAGCATGGGCAGCTTTAAATCGTACCAGTGCACGTTGAATGGGAAATTG
ATCAACTGGAGAAGTCAACTCTGTGCTCCTCGCGAATGCCCGGCAAATAA
AGAATATTCAGAATGTGGAAGCAGTTGCTCACAGAACTGTGAAGATCTAA
TTACCGATGAAAATTGCAAATCATTCTGTACTGCCGGATGCTTTTGTCCG
AAAGATCGATTCTGGAACGGAACCTATTGTGTACCGAAACCCCAGTGTCC
ATGTATCAGAAAGAATGGTAACAGTATGGTCGTCTATCACCAAGGAATGT
CGTTCAAGAGAGATTGTGAAATATGTGAATGCTCGAAAGGTGGAGTATTT
AACTGCGCTAAAATCCGTGGCTGTAGTGGAACATGCGTTATCAGTGGAGA
TCCCCATTATACAACATTCGATAAACGTCATATCTATGTTGAGGGAAGCT
GCTTCTACACAATGGTAGCTACCAAGCCATCCATTACTGGGAATCAAGTA
TTGAAAATATGGGTTCAAAATACTCATTGCATGAAATCGAATGATGCTTA
CTGCACCAAATCGCTATCATTACAATTTGGAGACACCGACAACAGTACCT
TTATACAATTGGTAACGACCAAAAATATTCTCGTCAACAAAATCCCGAAT
AGATTACCGCTGCAAATTAATGATCCATTACGACTCACAATCCAGGAAGT
TGCACACGACACCGTCCTCATCGAATCATATAATGGAATCCGCATTTTAT
GGCACCAAAAAACACAAATAGAAATCACACTTCCGGAATTTTATCAGGAC
CAAGTTCAAGGTCTTTGTGGAAATTACAACGGAAATTCTGAAGACGATGC
GACAAAATCCAGCGGAGAATTAACAACCAATGACAATGAGTTAGCAGTGT
CATGGGCAACAGCGGAATGCAAAAGCACCTTATCATTAAGTTATTTGGGA
GTATGTGCCAAGAGTTATGAATACGAAAAATTTGCGAAAGAATTCTGCCA
GAGACTATTATATGAACCCTTCAATTCATGTCACATGTCAGTTGATCCTA
ATCCATTCATTCAACAATGTGAACACGATATTTGCCTATGTGGCGGAAAC
GAGAAGGATAACTGTGCCTGTGAATCTATGGCATCGTATGGAAGAGCTTG
CATGAAAAATGGCTTAACTCTCAAATGGAGATCTAGTTCTTTATGCGATC
CGAAATGCCCCAATGGAATGGAATACATGGAGTGCAAAAACCTCTGTTCC
GTTAGTTGTTTCTCTCTAACACAAACCAACTGCTCTACAGAATGCATCGA
TGGATGTCAATGCAAAAGCAATATGGTATATGACACCGCGGTAAACCAAT
GCGTCAACATTTCACAATGCCAATGCTCACACGAGAACGCATATTATCCA
TCTGGAAGCACCCGAAAAGAGAAGTGTAACGACTGCAACTGTACCAACGG
AGTGTGGTCATGTACAAAGAACGATTGCTCAAATGTGACATTTTGTCCAC
CTGGAAAGGAATGGAAAGAATGTGGCCATTGTGATCAAACATGTGAAAAT
CAAGATGGATTCTGTCTGGAAAAAGGTTGTAAATCTGGTTGTTTCTGCCC
AGATGGTTACTTACTTAGCAACAAAACTTGTGTCCCGAAACATAAATGCC
CATGTTTGTGGTCGGACAAAAGTTATCTAAATCAATCTGTCATTTACACT
GGCCCCACAAATTGTTTATCTAAATGCACATGCAATGAAGGCAAATGGGG
ATGTGAACAAGAACAAAAATGCGTCGGTAGTTGCAAATCTTGGGGTGATG
CTCACTATAAAACATTTGATGGGAAATATTTCGATTTTGTTTCTAAATGC
TCCTACGTAATGGTCGACAGTGATTGTGGAAAAGGAATTGGATTTTTCAA
ATTGGTGACTGAAAATATTGAATGTGGTAACAAAGGAACTTCTTGCACGA
AATCGATATTTTTCTATTACCGGAACCAAGTGGTTCAACTGATTAGAGGA
GTAAGACCGAAAGTGATGGAGAATGAGAACTATCCGAAAGATAGAGTAAA
GGGACGAATATCATTCAGAGATCTAGTCAGCCAATTGATTATTTACACTG
ACAGCGATATTATTCTTTATTGGGATAAAGGGCTGTCAATAGAGATTGCT
TTACCACCACAATATCAGAATCAAGTTTGTGGATTGTGTGGAAATTTCGA
TCAAAACCTCAATAATGATTTCAAGTCCAAAGCCGGCAACTATGAGAATA
ATATTTTAGCTTTCGTTGACAGTTGGAAATCAAGAGTAAACTGTCCGGCT
GCTAAAGACGTTCCAGACATGTGTAAATCTAATCACGAACGTCAAGCATG
GGCAGATAAAATGTGTGGAACGATGAAAAATGTAAAGTTTGCCGACTGTC
AGAAAGTTGTCGATACAGAATTGTATTATCAAAAATGTTTGTCAGACACT
TGTTCTTGTGATCGAGGAGGAGACTGTGAATGTTTGTGCACCGCGTTATC
GGCTTTTTATTCCGCCTGTAAGAAATATGGAATCGATTACTCTTGGAGAT
CAAATGAACTTTGTCCTGTCATGTGTCCACCTGAAAAGACATTCAAGACA
TGCATCAATGATTGCCCGAAAAAGTGCTTCAAGTCCAATCTGAACAACAC
TGTTCTCGAAAATTGTGCAAAGAATTGCGTGGAAGGTTGCTCGTGTCCTA
CAGAATATATCGAGGCAGAAGGATCCAATAAATGCGTTAAAGAAAACGAA
TGCTTCTGTAAGTTACCAAACAGCGATAAAAAGTACAATCCAGGAGAAAT
ATTCACGGAAAATTGTCTCATCTGTGTTTGCAACGAGAACAACTTTAAAT
GTCGACCCGATCCGAAATGCATAACCTCTACGACTTCTTATTGCATTGGC
AGCAAATTAACGAAATGTGAAAATGGCGTTTGCGCTCGAATCTGTAATGG
AATCCCGGAATGCAGTGACGGCAGTGATGAAGCAAACTGTACGTCAACAC
AAACGAAGACTCTACCGACAACGACAACTCAACCGCATTGTATTTATGAA
GGGCGAATAATGCAAATTGGTGAAGTGATTAAGCTTGAATCCTGTCTGTC
TGTCACCTGTACAGATAGACGAATTGTTGAGACCAGACAAAATTGCGATA
AGACCTGTCAACCAAATTACGTGTTGAAGCTTTACCCGGATAAATGCTGT
GAATGTCAGTTGATAACATCGACAACTTGGACAGTATCTCACACGACGAC
AGTTTTTGAAAAGTGTGAAAAGAGGCCAGCAAAATTGACATCTGACAGTA
CTTCAGTGAAAATTTTAAACGTTCGAGGTGGAACTGAGGCTGACGTTGCA
AATACTTTTACTAGAAATGCCGATAGTTGGATAGTGAGAAATTCAAATGC
AAGTTTTACTTTAAGCCTTCCACCTCAAGCTGGAACTGAATTGATCATTG
TTGGTTTCCAGATGGATATCACTAAACCATTTAAAGTCGTCGTTAGTTTT
GGAAACGAAGTAAACAAAGTCGAATTAAACCCCTACACTGTAATTGGGCA
AGGAAAAGCAGGAAAATTATTCCAAACCATTAGCAAAGATGGAGAAAGTT
TTCCATTTGTAAAATTTACAATAGAAAGTCAAAATAACGAAGAATTAGAA
ATCCGTAACTTTGTTCTTTGGATCTGTTATAAGATTGGTACTACAATCAT
AACACCACCAGTAACTACACCTACAACTTCAACCACAATAACAACACCAG
AGGTTTGTTCAAAAGAAGTTGTAACTTTGACAAAGAACGAAAAAATGAAA
GTAGAAATACAAAATGTGACAAACGGAAATGTGACAGATGTGGAAAAGAT
ACTGACAAGTGAAAAAGAATGGAACTCGAACAAGAACGAAGTCAGCTTTG
TA
back to top

protein sequence of SMED30006765-orf-1

>SMED30006765-orf-1 ID=SMED30006765-orf-1|Name=SMED30006765-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1767bp
LNSIEYIRNKIHINNQRIYFHSHMKLVQIFIWLVLSLSIQILAEDNNRFC
GESFVREPFQACDDAKESLKDNDQLVTVGEQCQIKRYKRKCCNGWTGTDC
QFPICQQLCKNGGRCIEPDRCQCDPKFSGADCSFRIADEKPCIQGCIRGK
CKNGDCLCDSGYEGERCDRAFCQYGCGTGICVEPNVCQCPENFRGRNCET
FFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGISIENPLRGSN
ILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSLMIETASESVTFLGLS
NSSTNSNRNYISSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMK
KSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYWKNPDPIDPNTYY
TTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELC
HCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQLCAPRECPANK
EYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCP
CIRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGD
PHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAY
CTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEV
AHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDA
TKSSGELTTNDNELAVSWATAECKSTLSLSYLGVCAKSYEYEKFAKEFCQ
RLLYEPFNSCHMSVDPNPFIQQCEHDICLCGGNEKDNCACESMASYGRAC
MKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECID
GCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNG
VWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCP
DGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWG
CEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFK
LVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVK
GRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFD
QNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAW
ADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALS
AFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNT
VLENCAKNCVEGCSCPTEYIEAEGSNKCVKENECFCKLPNSDKKYNPGEI
FTENCLICVCNENNFKCRPDPKCITSTTSYCIGSKLTKCENGVCARICNG
IPECSDGSDEANCTSTQTKTLPTTTTQPHCIYEGRIMQIGEVIKLESCLS
VTCTDRRIVETRQNCDKTCQPNYVLKLYPDKCCECQLITSTTWTVSHTTT
VFEKCEKRPAKLTSDSTSVKILNVRGGTEADVANTFTRNADSWIVRNSNA
SFTLSLPPQAGTELIIVGFQMDITKPFKVVVSFGNEVNKVELNPYTVIGQ
GKAGKLFQTISKDGESFPFVKFTIESQNNEELEIRNFVLWICYKIGTTII
TPPVTTPTTSTTITTPEVCSKEVVTLTKNEKMKVEIQNVTNGNVTDVEKI
LTSEKEWNSNKNEVSFV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008061chitin binding
GO:0005515protein binding
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR036084Ser_inhib-like_sf
IPR002172LDrepeatLR_classA_rpt
IPR001846VWF_type-D
IPR000742EGF-like_dom
IPR014853Unchr_dom_Cys-rich
IPR002919TIL_dom
IPR013032EGF-like_CS
IPR019774Aromatic-AA_hydroxylase_C
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0007155cell adhesion
GO:0007399nervous system development
GO:0030154cell differentiation
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001846von Willebrand factor, type D domainSMARTSM00216VWD_2coord: 215..375
e-value: 0.0083
score: 15.0
coord: 584..755
e-value: 4.8E-22
score: 89.2
coord: 1050..1212
e-value: 4.4E-33
score: 125.9
IPR001846von Willebrand factor, type D domainPFAMPF00094VWDcoord: 226..364
e-value: 5.3E-8
score: 33.3
coord: 1061..1212
e-value: 7.9E-26
score: 91.2
coord: 595..755
e-value: 1.2E-25
score: 90.7
IPR001846von Willebrand factor, type D domainPROSITEPS51233VWFDcoord: 1060..1269
score: 34.581
IPR001846von Willebrand factor, type D domainPROSITEPS51233VWFDcoord: 594..813
score: 36.17
IPR001846von Willebrand factor, type D domainPROSITEPS51233VWFDcoord: 225..436
score: 21.337
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 1430..1465
e-value: 0.0084
score: 22.8
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 1409..1464
score: 9.975
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 1438..1463
e-value: 0.00500496
score: 34.1046
IPR000742EGF-like domainSMARTSM00181egf_5coord: 973..1011
e-value: 29.0
score: 10.7
coord: 171..199
e-value: 13.0
score: 14.5
coord: 141..168
e-value: 23.0
score: 11.8
coord: 104..133
e-value: 0.24
score: 20.5
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 163..199
score: 7.886
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 101..133
score: 12.858
IPR014853Uncharacterised domain, cysteine-richSMARTSM00832c8_acoord: 1248..1322
e-value: 2.3E-23
score: 93.6
coord: 792..866
e-value: 5.9E-22
score: 88.9
IPR014853Uncharacterised domain, cysteine-richPFAMPF08742C8coord: 799..865
e-value: 3.9E-17
score: 62.4
coord: 1254..1321
e-value: 7.5E-14
score: 51.9
IPR002919Trypsin Inhibitor-like, cysteine rich domainPFAMPF01826TILcoord: 869..923
e-value: 6.0E-8
score: 32.8
coord: 496..549
e-value: 1.0E-9
score: 38.5
coord: 1325..1384
e-value: 3.7E-7
score: 30.3
coord: 965..1016
e-value: 1.6E-8
score: 34.6
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 135..201
e-value: 1.2E-11
score: 46.4
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 71..133
e-value: 3.7E-11
score: 45.1
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 481..591
e-value: 5.5E-15
score: 57.6
coord: 961..1057
e-value: 3.1E-15
score: 58.3
coord: 1313..1423
e-value: 9.9E-13
score: 50.3
coord: 857..960
e-value: 7.7E-17
score: 63.5
NoneNo IPR availablePANTHERPTHR11339EXTRACELLULAR MATRIX GLYCOPROTEIN RELATEDcoord: 436..993
coord: 62..405
coord: 965..1741
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 187..198
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 121..132
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 494..549
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 963..1018
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 868..923
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 1320..1386