Phosphatidylinositol 3-kinase regulatory subunit alpha

Overview
NamePhosphatidylinositol 3-kinase regulatory subunit alpha
Smed IDSMED30006764
Length (bp)3287
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (SMED30006764) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidylinositol 3-kinase regulatory subunit alpha (SMED30006764) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidylinositol 3-kinase regulatory subunit alpha (SMED30006764) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidylinositol 3-kinase regulatory subunit alpha (SMED30006764) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006764

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30006764SMESG000078199.1 PL08004B1D03ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30006764SMESG000078199.1 dd_Smed_v4_4794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30006764SMESG000078199.1 dd_Smed_v4_4794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006764SMESG000078199.1 dd_Smed_v4_4794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30006764SMESG000078199.1 dd_Smed_v4_4794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006764SMESG000078199.1 dd_Smed_v6_4794_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006764SMESG000078199.1 dd_Smed_v4_4794_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Human
Match: PIK3R1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:HGNC Symbol;Acc:HGNC:8979])

HSP 1 Score: 188.734 bits (478), Expect = 3.781e-49
Identity = 161/594 (27.10%), Postives = 274/594 (46.13%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSIL---DSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQ--EWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFS--LENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P P+I   +Y  +I S+  + +      Q+   L    S+P     TL+YL++HF  + ++ +K  L ++  S IFS  L          F+A  S +   +  + E            L+S    +   + ++         +A   +NN+++ Q  EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK +       +++ +  N E + + LH   +   E + + D+  E Y    +E+          +E  KI +   Q Q   +K   +      + +    + H+ D   +L  ++++ +   + + E  +K   E  E+ +++   +PDL +L + + Q +     + V  +  +  L N +N +    ++E DE+   +D   + + S+N                       R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  194 PNPVIPAAVYSEMI-SLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLF--------RFSAASSDNTENLIKVIEI-----------LISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQ------DQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYD---KLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN-ENTEDQYSLVEDDEDLPHHDEKTWNVGSSN-----------------------RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 718          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Human
Match: PIK3R1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:HGNC Symbol;Acc:HGNC:8979])

HSP 1 Score: 188.734 bits (478), Expect = 3.781e-49
Identity = 161/594 (27.10%), Postives = 274/594 (46.13%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSIL---DSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQ--EWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFS--LENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P P+I   +Y  +I S+  + +      Q+   L    S+P     TL+YL++HF  + ++ +K  L ++  S IFS  L          F+A  S +   +  + E            L+S    +   + ++         +A   +NN+++ Q  EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK +       +++ +  N E + + LH   +   E + + D+  E Y    +E+          +E  KI +   Q Q   +K   +      + +    + H+ D   +L  ++++ +   + + E  +K   E  E+ +++   +PDL +L + + Q +     + V  +  +  L N +N +    ++E DE+   +D   + + S+N                       R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  194 PNPVIPAAVYSEMI-SLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLF--------RFSAASSDNTENLIKVIEI-----------LISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQ------DQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYD---KLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN-ENTEDQYSLVEDDEDLPHHDEKTWNVGSSN-----------------------RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 718          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Human
Match: PIK3R1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:HGNC Symbol;Acc:HGNC:8979])

HSP 1 Score: 176.022 bits (445), Expect = 5.238e-47
Identity = 132/451 (29.27%), Postives = 219/451 (48.56%), Query Frame = 3
Query: 1833 IALEEINNDINSQ--EWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFS--LENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            +A   +NN+++ Q  EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK + +      ++ +  N E + + LH   +   E + + D+  E Y    +E+          +E  KI +   Q Q   +K   +      + +    + H+ D   +L  ++++ +   + + E  +K   E  E+ +++   +PDL +L + + Q +     + V  +  +  L N +N +    ++E DE+   +D   + + S+N                       R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:   17 VANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQD------QVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYD---KLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN-ENTEDQYSLVEDDEDLPHHDEKTWNVGSSN-----------------------RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 418          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Human
Match: PIK3R1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:HGNC Symbol;Acc:HGNC:8979])

HSP 1 Score: 175.637 bits (444), Expect = 1.321e-46
Identity = 131/450 (29.11%), Postives = 217/450 (48.22%), Query Frame = 3
Query: 1833 IALEEINNDINSQ--EWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFS--LENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            +A   +NN+++ Q  EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK + +     + +     E + + LH   +   E + + D+  E Y    +E+          +E  KI +   Q Q   +K   +      + +    + H+ D   +L  ++++ +   + + E  +K   E  E+ +++   +PDL +L + + Q +     + V  +  +  L N +N +    ++E DE+   +D   + + S+N                       R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:   47 VANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNI-----EAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYD---KLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN-ENTEDQYSLVEDDEDLPHHDEKTWNVGSSN-----------------------RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 448          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Human
Match: PIK3R3 (phosphoinositide-3-kinase regulatory subunit 3 [Source:HGNC Symbol;Acc:HGNC:8981])

HSP 1 Score: 167.933 bits (424), Expect = 6.290e-44
Identity = 127/441 (28.80%), Postives = 211/441 (47.85%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLE-NVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPVKC 3146
            +   EWYWG+ S+EEVND +  + DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y    L++YN +L++ L YP S+ +       ++L +  N + + + L    S   E + + D+  E Y    +E+          +E  KI +     Q   +K   +      + +  + +  + D L+    +++D  ++  E + + + L  ++ E+ +K+   +PDL +L +++ Q +     + V  +  ++   + N DA      ++E+E+   Y                      +  WF+E+I R ++E+LL  +  G FLIR S + G YA  V  +G V+HC I+     YGF +    + SL++LV  +   SL  HN SL   LAYPV  
Sbjct:   60 LQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLR----------------KGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQ------DQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDS-KMRLEQDLKNQAL--DNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENLPHYD---------------------EKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHA 454          

HSP 2 Score: 52.373 bits (124), Expect = 3.669e-6
Identity = 35/124 (28.23%), Postives = 57/124 (45.97%), Query Frame = 3
Query: 1863 NSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCK-FESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEV 2231
            + + W+  + ++ +  D + G  DG FL+R+SS K  G Y  ++                  +GE K   I      YGF EP   + S+ +L+ +YQ   L ++ND LN+ L YP     P +
Sbjct:  354 DEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKK--GCYACSVVA----------------DGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSL 459          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Celegans
Match: aap-1 (Phosphoinositide 3-kinase adapter subunit; Phosphoinositide kinase AdAPter subunit [Source:UniProtKB/TrEMBL;Acc:G5EDP9])

HSP 1 Score: 63.5438 bits (153), Expect = 5.127e-10
Identity = 35/123 (28.46%), Postives = 63/123 (51.22%), Query Frame = 3
Query: 1848 INNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQ-EPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCS 2213
            + + +  Q WYW +  +  V+  ++   DG F+VR++S    G YTL+++                     KL+RI+ +DG  GF  +    +SV +LI++++   L+ +ND L++ L YP S
Sbjct:   11 VTHSLMEQGWYWADADRSAVSKALSDQPDGSFIVRNASTP--GDYTLSVKFAAQV----------------KLLRIVVKDGKCGFNTDSLTHDSVVRLIEFHRNISLNIFNDALDVRLLYPVS 115          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Celegans
Match: aap-1 (Phosphoinositide 3-kinase adapter subunit; Phosphoinositide kinase AdAPter subunit [Source:UniProtKB/TrEMBL;Acc:G5EDP9])

HSP 1 Score: 63.5438 bits (153), Expect = 5.127e-10
Identity = 35/123 (28.46%), Postives = 63/123 (51.22%), Query Frame = 3
Query: 1848 INNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQ-EPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCS 2213
            + + +  Q WYW +  +  V+  ++   DG F+VR++S    G YTL+++                     KL+RI+ +DG  GF  +    +SV +LI++++   L+ +ND L++ L YP S
Sbjct:   11 VTHSLMEQGWYWADADRSAVSKALSDQPDGSFIVRNASTP--GDYTLSVKFAAQV----------------KLLRIVVKDGKCGFNTDSLTHDSVVRLIEFHRNISLNIFNDALDVRLLYPVS 115          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Celegans
Match: chin-1 (CHImaeriN (Rac-GTPase-activating protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q965N4])

HSP 1 Score: 58.5362 bits (140), Expect = 1.428e-8
Identity = 60/240 (25.00%), Postives = 109/240 (45.42%), Query Frame = 3
Query:  939 HKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNL-DLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLI----ESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTL 1643
            H     +F     CDYC   + GL  QG+ C  CG   HK C+ +  L  C   +P+  + +   +FGV++  L   H   +P  +  CI E++ R L+     ++  +Y +         LK+ F   ++ + + +  I  +       L+KLY + LP+ LI + ++  L+    E+ ++   ++    QI  ++  L   NI TL  ++ H   + +   K K+  +  + IFS TL
Sbjct:  172 HNFTSYTFKAPHYCDYCRNFLWGLVHQGMRCEDCGFAAHKKCS-EKTLHDC---VPD--SKYVKRMFGVDITTLCMAHGADLPPIVPLCIGEVESRGLDVEGIYRVSGSYDHMEK------LKQQFDSNQYVDLATVCDIHTV-----CGLLKLYFRLLPQQLIPFSVHKQLLVAYQETNQRSTHERE--RQIRKVMMELSDANIITLGAVLAHLKKVADHSAKNKMTVENLATIFSPTL 392          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Celegans
Match: spv-1 (Spermathecal Physiology Variant [Source:UniProtKB/TrEMBL;Acc:G5ECK6])

HSP 1 Score: 54.299 bits (129), Expect = 4.656e-7
Identity = 65/239 (27.20%), Postives = 104/239 (43.51%), Query Frame = 3
Query:  978 CDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSNG-VPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVKKDFEDKMCCS--------------QIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIW 1649
            C  C+ + I      V CI CG  +HK C  +I  Q+C +    V     +SIFGV L     H N  +PL I+  ID+LQ R      G +    Y      +    +   F     D+E   V + + N + LA ++KLYL++LPEPL+ + +Y   +    +      CCS              Q+  +   LP  N ETL++++ H + +        + +   S + + +LIW
Sbjct:   92 CSACDTLSILYT---VQCIDCGGQWHKACFPRIQ-QVCGQAAKLVDR--RTSIFGVPLKGLLEHQNRHIPLIIEKSIDQLQRR------GLRAKGIYRTCGVKSKIEEICNAFERSSSDDE---VCLDNENPMNLASVVKLYLRKLPEPLLTFELYDDFVRLGTE------CCSAQASGSNCEEERVEQLRQLARKLPVHNYETLKFIMLHLNRVSWFHEVNLMSTSNLSTVIAPSLIW 309          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Celegans
Match: spv-1 (Spermathecal Physiology Variant [Source:UniProtKB/TrEMBL;Acc:G5ECK6])

HSP 1 Score: 53.9138 bits (128), Expect = 5.060e-7
Identity = 65/239 (27.20%), Postives = 104/239 (43.51%), Query Frame = 3
Query:  978 CDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSNG-VPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVKKDFEDKMCCS--------------QIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIW 1649
            C  C+ + I      V CI CG  +HK C  +I  Q+C +    V     +SIFGV L     H N  +PL I+  ID+LQ R      G +    Y      +    +   F     D+E   V + + N + LA ++KLYL++LPEPL+ + +Y   +    +      CCS              Q+  +   LP  N ETL++++ H + +        + +   S + + +LIW
Sbjct:  130 CSACDTLSILYT---VQCIDCGGQWHKACFPRIQ-QVCGQAAKLVDR--RTSIFGVPLKGLLEHQNRHIPLIIEKSIDQLQRR------GLRAKGIYRTCGVKSKIEEICNAFERSSSDDE---VCLDNENPMNLASVVKLYLRKLPEPLLTFELYDDFVRLGTE------CCSAQASGSNCEEERVEQLRQLARKLPVHNYETLKFIMLHLNRVSWFHEVNLMSTSNLSTVIAPSLIW 347          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Fly
Match: Pi3K21B (gene:FBgn0020622 transcript:FBtr0331208)

HSP 1 Score: 115.546 bits (288), Expect = 1.537e-26
Identity = 120/451 (26.61%), Postives = 198/451 (43.90%), Query Frame = 3
Query: 1875 WYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLK--PEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEIT---KILKGIDQI---QTWCNKHIFQIMNIINSNE------------RTDWVSHSRDCLQQLNK---KLNDCVQVAKEM------NERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            WYWG  S+EE    + G  DG FLVRD+     G YTLT+                 K+G  KL++I   D  YGF E   F SV ++I YY+ + LS YN  L+I L  P  + +   E + H  +L   +NE  IR    T   +  +   ++    ++N  ++EL E      +    ++I   Q   N+   +      S E                 +++R  LQ+  +    L D +Q   ++      N+++E+L+     L R++   +P+L+ L   + + I   K   + D+   +      D   ++ E+  N+  ++ +L+ +K    R A                       EE+LK    GTFLI R+R+ G+YAL +    +VQHC I+  +  +GF      + +L+ LV+ +   SL  HN +LTT L +PV
Sbjct:   22 WYWGRISREEAKSILHGKPDGSFLVRDALSMK-GEYTLTLM----------------KDGCEKLIKICHMDRKYGFIETDLFNSVVEMINYYKENSLSMYNKTLDITLSNPIVRAREDEESQPH-GDLCLLSNE-FIR----TCQLLQNLEQNLENKRNSFNAIREELQEKKLHQSVFGNTEKIFRNQIKLNESFMKAPADAPSTEAGGAGDGANAAASAAANANARRSLQEHKQTLLNLLDALQAKGQVLNHYMENKKKEELL-----LERQINALKPELQILQLRKDKYIERLKGFNLKDDDLKMILQMGFDKWQQLYETVSNQPHSNEALWLLKDAKRRNA-----------------------EEMLKGAPSGTFLI-RARDAGHYALSIACKNIVQHCLIYETSTGFGFAAPYNIYATLKSLVEHYANNSLEEHNDTLTTTLRWPV 420          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Fly
Match: Pi3K21B (gene:FBgn0020622 transcript:FBtr0331205)

HSP 1 Score: 115.546 bits (288), Expect = 1.537e-26
Identity = 120/451 (26.61%), Postives = 198/451 (43.90%), Query Frame = 3
Query: 1875 WYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLK--PEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEIT---KILKGIDQI---QTWCNKHIFQIMNIINSNE------------RTDWVSHSRDCLQQLNK---KLNDCVQVAKEM------NERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            WYWG  S+EE    + G  DG FLVRD+     G YTLT+                 K+G  KL++I   D  YGF E   F SV ++I YY+ + LS YN  L+I L  P  + +   E + H  +L   +NE  IR    T   +  +   ++    ++N  ++EL E      +    ++I   Q   N+   +      S E                 +++R  LQ+  +    L D +Q   ++      N+++E+L+     L R++   +P+L+ L   + + I   K   + D+   +      D   ++ E+  N+  ++ +L+ +K    R A                       EE+LK    GTFLI R+R+ G+YAL +    +VQHC I+  +  +GF      + +L+ LV+ +   SL  HN +LTT L +PV
Sbjct:   22 WYWGRISREEAKSILHGKPDGSFLVRDALSMK-GEYTLTLM----------------KDGCEKLIKICHMDRKYGFIETDLFNSVVEMINYYKENSLSMYNKTLDITLSNPIVRAREDEESQPH-GDLCLLSNE-FIR----TCQLLQNLEQNLENKRNSFNAIREELQEKKLHQSVFGNTEKIFRNQIKLNESFMKAPADAPSTEAGGAGDGANAAASAAANANARRSLQEHKQTLLNLLDALQAKGQVLNHYMENKKKEELL-----LERQINALKPELQILQLRKDKYIERLKGFNLKDDDLKMILQMGFDKWQQLYETVSNQPHSNEALWLLKDAKRRNA-----------------------EEMLKGAPSGTFLI-RARDAGHYALSIACKNIVQHCLIYETSTGFGFAAPYNIYATLKSLVEHYANNSLEEHNDTLTTTLRWPV 420          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Fly
Match: Pi3K21B (gene:FBgn0020622 transcript:FBtr0331206)

HSP 1 Score: 78.1814 bits (191), Expect = 6.763e-16
Identity = 37/95 (38.95%), Postives = 58/95 (61.05%), Query Frame = 3
Query: 2856 WFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            W +++ +R  +EE+LK    GTFLIR +R+ G+YAL +    +VQHC I+  +  +GF      + +L+ LV+ +   SL  HN +LTT L +PV
Sbjct:   28 WLLKDAKRRNAEEMLKGAPSGTFLIR-ARDAGHYALSIACKNIVQHCLIYETSTGFGFAAPYNIYATLKSLVEHYANNSLEEHNDTLTTTLRWPV 121          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Fly
Match: Pi3K21B (gene:FBgn0020622 transcript:FBtr0331207)

HSP 1 Score: 78.1814 bits (191), Expect = 6.763e-16
Identity = 37/95 (38.95%), Postives = 58/95 (61.05%), Query Frame = 3
Query: 2856 WFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            W +++ +R  +EE+LK    GTFLIR +R+ G+YAL +    +VQHC I+  +  +GF      + +L+ LV+ +   SL  HN +LTT L +PV
Sbjct:   28 WLLKDAKRRNAEEMLKGAPSGTFLIR-ARDAGHYALSIACKNIVQHCLIYETSTGFGFAAPYNIYATLKSLVEHYANNSLEEHNDTLTTTLRWPV 121          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Fly
Match: RhoGAP5A (gene:FBgn0029778 transcript:FBtr0070785)

HSP 1 Score: 58.151 bits (139), Expect = 3.451e-8
Identity = 58/245 (23.67%), Postives = 109/245 (44.49%), Query Frame = 3
Query:  939 HKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVK--KDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMV 1667
            H  +  +F G   C++C   + G   QGV C  CG   H  C+ ++    C  ++  +  VF + +  + + L+  H   +P  ++ C++E++ R      G      Y  +   ++   LK   A  R  E++++      N   +A  +KLYL+ LP PLI +  Y S + + +  K  E +   ++    +  LP  +   L+Y+++H   +       K+     + +F+ TLI  PQ M 
Sbjct:  242 HHFKVHTFKGLNWCEFCANFLWGFTAQGVKCEACGFVAHSKCS-ELVPPKCVPDLKRIRGVFGTDLTTM-VQLEPHHQ--IPFVVRRCVEEVEAR------GMLQEGIYRVSGFADEIEALK--LALDREGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAE---AVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMT 471          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Zebrafish
Match: pik3r1 (phosphoinositide-3-kinase, regulatory subunit 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030131-1280])

HSP 1 Score: 187.578 bits (475), Expect = 7.175e-49
Identity = 164/600 (27.33%), Postives = 278/600 (46.33%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDS---LPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSR---HQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQT---WCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P+P+I   IY+ +I  + ++ +    C+Q   ++ S   LP     TL+ L++HF  + +S     L ++  + IFS      P +   + T+ +     H RII+++   +        W     S+ Q + +      +   +       N  +   EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+T  L++YN +L++ L YP SK +       +++ +  N E + + LH       E N + D+  E Y    +E+          +E  KI +  +Q QT   +  ++I +     N  E    +       ++L  ++++ V   + + E  +K   +  E+ +++   +PDL +L + + Q +     + V     +E   ++N +N D    ++E DE+   +D                       + +W + NI R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  194 PQPVIPPVIYNEMIR-IAQEVQGTDECAQHLRLVASSTALPPQYWLTLQSLLRHFSHVCQSSAVNLLSARALAEIFS------PALFRHQPTSCEPSPEAHIRIIEVLVTSE--------W-----SDSQAAPALPPKPPKPTSVANNGMNNNMALQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRTESLAQYNPKLDVKLLYPVSKHQQ------DQVVKEDNIEAVGKKLHEYHQQFQEKNREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFE--EQCQTQERYSKEYIEKFRREGNEKE----IQRIMVNYEKLKSRISEIVDSKRRLEEDLKKQAADYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGIKN-ENQDDQYSMVEDDEDLPHHD-----------------------ERSWKLGNINRIQAEALLRGKRDGTFLVRDSSKAGCYACSVVVDGEVKHCVINKTPTGYGFAEPYNLYNSLKELVLHYQHTSLVQHNDSLNVTLAYPV 721          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Zebrafish
Match: pik3r1 (phosphoinositide-3-kinase, regulatory subunit 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030131-1280])

HSP 1 Score: 187.578 bits (475), Expect = 7.175e-49
Identity = 164/600 (27.33%), Postives = 278/600 (46.33%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDS---LPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSR---HQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQT---WCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P+P+I   IY+ +I  + ++ +    C+Q   ++ S   LP     TL+ L++HF  + +S     L ++  + IFS      P +   + T+ +     H RII+++   +        W     S+ Q + +      +   +       N  +   EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+T  L++YN +L++ L YP SK +       +++ +  N E + + LH       E N + D+  E Y    +E+          +E  KI +  +Q QT   +  ++I +     N  E    +       ++L  ++++ V   + + E  +K   +  E+ +++   +PDL +L + + Q +     + V     +E   ++N +N D    ++E DE+   +D                       + +W + NI R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  194 PQPVIPPVIYNEMIR-IAQEVQGTDECAQHLRLVASSTALPPQYWLTLQSLLRHFSHVCQSSAVNLLSARALAEIFS------PALFRHQPTSCEPSPEAHIRIIEVLVTSE--------W-----SDSQAAPALPPKPPKPTSVANNGMNNNMALQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRTESLAQYNPKLDVKLLYPVSKHQQ------DQVVKEDNIEAVGKKLHEYHQQFQEKNREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFE--EQCQTQERYSKEYIEKFRREGNEKE----IQRIMVNYEKLKSRISEIVDSKRRLEEDLKKQAADYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGIKN-ENQDDQYSMVEDDEDLPHHD-----------------------ERSWKLGNINRIQAEALLRGKRDGTFLVRDSSKAGCYACSVVVDGEVKHCVINKTPTGYGFAEPYNLYNSLKELVLHYQHTSLVQHNDSLNVTLAYPV 721          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Zebrafish
Match: pik3r1 (phosphoinositide-3-kinase, regulatory subunit 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030131-1280])

HSP 1 Score: 176.022 bits (445), Expect = 6.140e-47
Identity = 133/445 (29.89%), Postives = 215/445 (48.31%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQT---WCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            +   EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+T  L++YN +L++ L YP SK +       +++ +  N E + + LH       E N + D+  E Y    +E+          +E  KI +  +Q QT   +  ++I +     N  E    +       ++L  ++++ V   + + E  +K   +  E+ +++   +PDL +L + + Q +     + V     +E   ++N +N D    ++E DE+   +D                       + +W + NI R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:   51 LQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRTESLAQYNPKLDVKLLYPVSKHQQ------DQVVKEDNIEAVGKKLHEYHQQFQEKNREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFE--EQCQTQERYSKEYIEKFRREGNEKE----IQRIMVNYEKLKSRISEIVDSKRRLEEDLKKQAADYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGIKN-ENQDDQYSMVEDDEDLPHHD-----------------------ERSWKLGNINRIQAEALLRGKRDGTFLVRDSSKAGCYACSVVVDGEVKHCVINKTPTGYGFAEPYNLYNSLKELVLHYQHTSLVQHNDSLNVTLAYPV 443          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Zebrafish
Match: pik3r3b (phosphoinositide-3-kinase, regulatory subunit 3b (gamma) [Source:ZFIN;Acc:ZDB-GENE-040426-743])

HSP 1 Score: 172.94 bits (437), Expect = 9.477e-46
Identity = 143/465 (30.75%), Postives = 212/465 (45.59%), Query Frame = 3
Query: 1842 EEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELD----EITKILKGIDQIQTWC---NKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELH---------------------RKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            E  +  +   EWYWG+ S+EEVND +  + DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP S+              Y  + L++       +I  V  K+ +    Y E  KE D    E TK  + I   +T     N+ I       ++ ER     +S++ +++  ++ ND       MN   EKL +   E+H                     +K+   +PDL +L +++ Q +     + V     ++   L+N    DA   + E DEN        Y  KS                  WF+ ++ RT+SE+LL  +  G FLIR S + G YA  V V G V+HC I+     +GF +    + +L+DLV  +H  SL  HN SL   LAYPV
Sbjct:   56 EAASGSLQEAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLR----------------KGGNNKLIKIYHRDGKYGFSDPLTFNSVVELISHYRHESLAQYNTKLDVKLMYPVSR--------------YQQDQLVK-----EDNIDAVGRKLQEYHNQYQEKSKEYDRLYEEHTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQER-----YSKEYIERFRREGNDKEIERIMMN--YEKLKSRLGEIHDSKTRLEQDLKTQALDNRETDKKMNSLKPDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGLKNETTDDAYF-VSEEDEN-----LPHYDEKS------------------WFVGDLNRTQSEDLLHGKPDGAFLIRESSKKGCYACSVVVEGEVKHCVIYSTPRGFGFAEPYNLYSTLKDLVLHYHQTSLVQHNDSLNVRLAYPV 454          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Zebrafish
Match: pik3r3b (phosphoinositide-3-kinase, regulatory subunit 3b (gamma) [Source:ZFIN;Acc:ZDB-GENE-040426-743])

HSP 1 Score: 172.94 bits (437), Expect = 9.477e-46
Identity = 143/465 (30.75%), Postives = 212/465 (45.59%), Query Frame = 3
Query: 1842 EEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELD----EITKILKGIDQIQTWC---NKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELH---------------------RKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            E  +  +   EWYWG+ S+EEVND +  + DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP S+              Y  + L++       +I  V  K+ +    Y E  KE D    E TK  + I   +T     N+ I       ++ ER     +S++ +++  ++ ND       MN   EKL +   E+H                     +K+   +PDL +L +++ Q +     + V     ++   L+N    DA   + E DEN        Y  KS                  WF+ ++ RT+SE+LL  +  G FLIR S + G YA  V V G V+HC I+     +GF +    + +L+DLV  +H  SL  HN SL   LAYPV
Sbjct:   56 EAASGSLQEAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLR----------------KGGNNKLIKIYHRDGKYGFSDPLTFNSVVELISHYRHESLAQYNTKLDVKLMYPVSR--------------YQQDQLVK-----EDNIDAVGRKLQEYHNQYQEKSKEYDRLYEEHTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQER-----YSKEYIERFRREGNDKEIERIMMN--YEKLKSRLGEIHDSKTRLEQDLKTQALDNRETDKKMNSLKPDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGLKNETTDDAYF-VSEEDEN-----LPHYDEKS------------------WFVGDLNRTQSEDLLHGKPDGAFLIRESSKKGCYACSVVVEGEVKHCVIYSTPRGFGFAEPYNLYSTLKDLVLHYHQTSLVQHNDSLNVRLAYPV 454          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Xenopus
Match: PIK3R1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:NCBI gene;Acc:100486835])

HSP 1 Score: 174.481 bits (441), Expect = 1.394e-44
Identity = 156/589 (26.49%), Postives = 264/589 (44.82%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSIL--DSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKL-VLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P P+I   +Y  ++ + ++          +   +   ++P     TL+YL++HF  + +S +K  L +K  + IFS      P +   + + L   H  +  L+ E  L  L+ + T P       + +   +   N +  LQ A           EWYWG+ S+EEVN+ +    DG FLVRD+S    G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK + +     + +     E + + L        E N + D+  E Y    +E+          +E  KI +   Q Q   +K   +      + +    + H+ +   +L  ++++ V   + + E  +K   E  E+ +++   +PDL +L + + Q +     + V  +  +           E L S+  ED+  YS+ + +    +           +  W + NI R ++E LL+ ++ GTFL+R S + G YA  V  +G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LA PV
Sbjct:  174 PNPVIPALMYSEMLSAARESISSDEYVQLLRKTIRCANVPQQYWLTLQYLLKHFLQLCQSSSKNLLSAKSLAEIFS------PLLFRIQASILHGGHY-VQDLVIESMLGFLVVQQTLP---PKPPKSTAVTNNGTNHIMSLQDA-----------EWYWGDISREEVNEKLRDTTDGTFLVRDASTIMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFNSVVELITHYRNESLAQYNPKLDVKLLYPVSKFQQDQLVKEDSI-----EAVGKKLREYNVQFEEKNQEYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQEKYSKEYIEKFRREGNEKEIQRILHNHE---KLKSRISEIVDSKRRLEEDLKKQTAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLN-----------EWLGSENTEDQ--YSVVEDEDLPHQD----------ERTWNVGNINRNQAENLLRGKRDGTFLVRESSKAGCYACSVVADGEVKHCVINKTLTGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLANPV 694          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Xenopus
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:Xenbase;Acc:XB-GENE-955585])

HSP 1 Score: 168.703 bits (426), Expect = 1.534e-44
Identity = 125/442 (28.28%), Postives = 210/442 (47.51%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            +   EWYWG+ S+EEVND +  + DG FLVRD+S K  G YTLT+R                K G NKL++I  +DG YGF +P  F SV +LI +Y+   L++YN +L++ L YP S+ + +      +L +  N + + R L        + + + DK  E Y +  +E+          +E  KI +     Q   +K   +  N   + +  + +  +    ++L  +L +       + +  +K   ++ E+ +K+   +PDL +L +++ Q +     + V     ++   ++N +NID    + E D+N    D                       +  WF+ ++ R ++EELL  +  G FLIR S + G YA  V  +G V+HC I+  +  YGF +    + +L++LV  +   SL  HN SL   LAYPV
Sbjct:   23 LQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKVQGDYTLTLR----------------KGGNNKLIKIYHQDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSRYQQD------QLVKEDNIDAVGRKLQEYHGQFQDKSKEYDKLYEEYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQERYSKEYMERFNREGNEKEMERIIMN---YEKLKSRLGEIHDSKLRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGIKN-ENIDDTYFVSEEDDNLPHYD-----------------------EKTWFVGDLNRIQAEELLSGKPDGAFLIRESSKKGCYACSVVADGDVKHCVIYSTSRGYGFAEPYNLYSTLKELVLHYQHTSLVQHNDSLNVRLAYPV 415          

HSP 2 Score: 52.373 bits (124), Expect = 3.587e-6
Identity = 33/120 (27.50%), Postives = 57/120 (47.50%), Query Frame = 3
Query: 1875 WYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCK-FESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEV 2231
            W+ G+ ++ +  + ++G  DG FL+R+SS K  G Y  ++                  +G+ K   I      YGF EP   + ++ +L+ +YQ   L ++ND LN+ L YP     P +
Sbjct:  321 WFVGDLNRIQAEELLSGKPDGAFLIRESSKK--GCYACSVVA----------------DGDVKHCVIYSTSRGYGFAEPYNLYSTLKELVLHYQHTSLVQHNDSLNVRLAYPVYAQMPSL 422          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Xenopus
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:Xenbase;Acc:XB-GENE-955585])

HSP 1 Score: 169.088 bits (427), Expect = 2.031e-44
Identity = 125/442 (28.28%), Postives = 210/442 (47.51%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            +   EWYWG+ S+EEVND +  + DG FLVRD+S K  G YTLT+R                K G NKL++I  +DG YGF +P  F SV +LI +Y+   L++YN +L++ L YP S+ + +      +L +  N + + R L        + + + DK  E Y +  +E+          +E  KI +     Q   +K   +  N   + +  + +  +    ++L  +L +       + +  +K   ++ E+ +K+   +PDL +L +++ Q +     + V     ++   ++N +NID    + E D+N    D                       +  WF+ ++ R ++EELL  +  G FLIR S + G YA  V  +G V+HC I+  +  YGF +    + +L++LV  +   SL  HN SL   LAYPV
Sbjct:   43 LQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKVQGDYTLTLR----------------KGGNNKLIKIYHQDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSRYQQD------QLVKEDNIDAVGRKLQEYHGQFQDKSKEYDKLYEEYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQERYSKEYMERFNREGNEKEMERIIMN---YEKLKSRLGEIHDSKLRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGIKN-ENIDDTYFVSEEDDNLPHYD-----------------------EKTWFVGDLNRIQAEELLSGKPDGAFLIRESSKKGCYACSVVADGDVKHCVIYSTSRGYGFAEPYNLYSTLKELVLHYQHTSLVQHNDSLNVRLAYPV 435          

HSP 2 Score: 52.373 bits (124), Expect = 3.516e-6
Identity = 33/124 (26.61%), Postives = 59/124 (47.58%), Query Frame = 3
Query: 1863 NSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCK-FESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEV 2231
            + + W+ G+ ++ +  + ++G  DG FL+R+SS K  G Y  ++                  +G+ K   I      YGF EP   + ++ +L+ +YQ   L ++ND LN+ L YP     P +
Sbjct:  337 DEKTWFVGDLNRIQAEELLSGKPDGAFLIRESSKK--GCYACSVVA----------------DGDVKHCVIYSTSRGYGFAEPYNLYSTLKELVLHYQHTSLVQHNDSLNVRLAYPVYAQMPSL 442          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Xenopus
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:Xenbase;Acc:XB-GENE-955585])

HSP 1 Score: 169.088 bits (427), Expect = 2.057e-44
Identity = 125/442 (28.28%), Postives = 210/442 (47.51%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            +   EWYWG+ S+EEVND +  + DG FLVRD+S K  G YTLT+R                K G NKL++I  +DG YGF +P  F SV +LI +Y+   L++YN +L++ L YP S+ + +      +L +  N + + R L        + + + DK  E Y +  +E+          +E  KI +     Q   +K   +  N   + +  + +  +    ++L  +L +       + +  +K   ++ E+ +K+   +PDL +L +++ Q +     + V     ++   ++N +NID    + E D+N    D                       +  WF+ ++ R ++EELL  +  G FLIR S + G YA  V  +G V+HC I+  +  YGF +    + +L++LV  +   SL  HN SL   LAYPV
Sbjct:   57 LQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKVQGDYTLTLR----------------KGGNNKLIKIYHQDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSRYQQD------QLVKEDNIDAVGRKLQEYHGQFQDKSKEYDKLYEEYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQERYSKEYMERFNREGNEKEMERIIMN---YEKLKSRLGEIHDSKLRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGIKN-ENIDDTYFVSEEDDNLPHYD-----------------------EKTWFVGDLNRIQAEELLSGKPDGAFLIRESSKKGCYACSVVADGDVKHCVIYSTSRGYGFAEPYNLYSTLKELVLHYQHTSLVQHNDSLNVRLAYPV 449          

HSP 2 Score: 52.373 bits (124), Expect = 3.455e-6
Identity = 33/124 (26.61%), Postives = 59/124 (47.58%), Query Frame = 3
Query: 1863 NSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCK-FESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEV 2231
            + + W+ G+ ++ +  + ++G  DG FL+R+SS K  G Y  ++                  +G+ K   I      YGF EP   + ++ +L+ +YQ   L ++ND LN+ L YP     P +
Sbjct:  351 DEKTWFVGDLNRIQAEELLSGKPDGAFLIRESSKK--GCYACSVVA----------------DGDVKHCVIYSTSRGYGFAEPYNLYSTLKELVLHYQHTSLVQHNDSLNVRLAYPVYAQMPSL 456          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Xenopus
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:Xenbase;Acc:XB-GENE-955585])

HSP 1 Score: 168.703 bits (426), Expect = 2.227e-44
Identity = 125/442 (28.28%), Postives = 210/442 (47.51%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            +   EWYWG+ S+EEVND +  + DG FLVRD+S K  G YTLT+R                K G NKL++I  +DG YGF +P  F SV +LI +Y+   L++YN +L++ L YP S+ +       ++L +  N + + R L        + + + DK  E Y +  +E+          +E  KI +     Q   +K   +  N   + +  + +  +    ++L  +L +       + +  +K   ++ E+ +K+   +PDL +L +++ Q +     + V     ++   ++N +NID    + E D+N    D                       +  WF+ ++ R ++EELL  +  G FLIR S + G YA  V  +G V+HC I+  +  YGF +    + +L++LV  +   SL  HN SL   LAYPV
Sbjct:   47 LQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKVQGDYTLTLR----------------KGGNNKLIKIYHQDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSRYQQ------DQLVKEDNIDAVGRKLQEYHGQFQDKSKEYDKLYEEYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQERYSKEYMERFNREGNEKEMERIIMN---YEKLKSRLGEIHDSKLRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGIKN-ENIDDTYFVSEEDDNLPHYD-----------------------EKTWFVGDLNRIQAEELLSGKPDGAFLIRESSKKGCYACSVVADGDVKHCVIYSTSRGYGFAEPYNLYSTLKELVLHYQHTSLVQHNDSLNVRLAYPV 439          

HSP 2 Score: 52.373 bits (124), Expect = 3.482e-6
Identity = 33/124 (26.61%), Postives = 59/124 (47.58%), Query Frame = 3
Query: 1863 NSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCK-FESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEV 2231
            + + W+ G+ ++ +  + ++G  DG FL+R+SS K  G Y  ++                  +G+ K   I      YGF EP   + ++ +L+ +YQ   L ++ND LN+ L YP     P +
Sbjct:  341 DEKTWFVGDLNRIQAEELLSGKPDGAFLIRESSKK--GCYACSVVA----------------DGDVKHCVIYSTSRGYGFAEPYNLYSTLKELVLHYQHTSLVQHNDSLNVRLAYPVYAQMPSL 446          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Mouse
Match: Pik3r1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:MGI Symbol;Acc:MGI:97583])

HSP 1 Score: 191.43 bits (485), Expect = 3.770e-50
Identity = 163/594 (27.44%), Postives = 274/594 (46.13%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIE-----TLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFS--LENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P P+I   +Y+ ++ S+ ++ +    C Q+   L  LP  NI      TL+YL++HF  + ++ +K  L ++  S IFS  L   P        A     + +I+ I     +LI    W     +E Q + +      +   +       N  +   EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK +       +++ +  N E + + LH   +   E + + D+  E Y    +E+          +E  KI +   Q Q   +K   +      + +    + H+ D   +L  ++++ +   + + E  +K   E  E+ +++   +PDL +L + + Q +     + V  +  +  L N +N +    ++E DE+   +D   + + S+N                       R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  194 PNPVIPVAVYNEMM-SLAQELQSPEDCIQLLKKLIRLP--NIPHQCWLTLQYLLKHFFKLSQASSKNLLNARVLSEIFSPVLFRFP-------AASSDNTEHLIKAI----EILIST-EW-----NERQPAPALPPKPPKPTTVANNSMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQ------DQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNHD---KLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN-ENTEDQYSLVEDDEDLPHHDEKTWNVGSSN-----------------------RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 718          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Mouse
Match: Pik3r1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:MGI Symbol;Acc:MGI:97583])

HSP 1 Score: 174.481 bits (441), Expect = 2.467e-46
Identity = 128/440 (29.09%), Postives = 211/440 (47.95%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFS--LENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            +   EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK +       +++ +  N E + + LH   +   E + + D+  E Y    +E+          +E  KI +   Q Q   +K   +      + +    + H+ D   +L  ++++ +   + + E  +K   E  E+ +++   +PDL +L + + Q +     + V  +  +  L N +N +    ++E DE+   +D   + + S+N                       R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:   58 LQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQ------DQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNHD---KLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN-ENTEDQYSLVEDDEDLPHHDEKTWNVGSSN-----------------------RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 448          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Mouse
Match: Pik3r3 (phosphoinositide-3-kinase regulatory subunit 3 [Source:MGI Symbol;Acc:MGI:109277])

HSP 1 Score: 170.629 bits (431), Expect = 5.763e-45
Identity = 132/444 (29.73%), Postives = 211/444 (47.52%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPVKC 3146
            +   EWYWG+ S+EEVND +  + DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF EP  F SV +LI +Y    L++YN +L++ L YP S+ +       ++L +  N + + + L    S   E + + D+  E Y    +E+          +E  KI +     Q   +K   +      + +  + +  + D L+    +++D  ++  E + +++ L  ++ E+ +K+   +PDL +L +++ Q +     R V     +    ++N D+ D    I E DEN    D                       +  WF+E+I R ++E+LL  +  G FLIR S + G YA  V  +G V+HC I+     YGF +    + SL++LV  +   SL  HN SL   LAYPV  
Sbjct:   60 LQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLR----------------KGGNNKLIKIYHRDGKYGFSEPLTFTSVVELINHYHHESLAQYNPKLDVKLTYPVSRFQQ------DQLVKEDNIDAVGKNLQEFHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKDYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDS-KLRLEQDLKKQAL--DNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHRGVRQRRLNAWLGIKNEDS-DESYFINEEDENLPHYD-----------------------EKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHA 454          

HSP 2 Score: 52.7582 bits (125), Expect = 2.252e-6
Identity = 35/122 (28.69%), Postives = 56/122 (45.90%), Query Frame = 3
Query: 1863 NSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCK-FESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKP 2225
            + + W+  + ++ +  D + G  DG FL+R+SS K  G Y  ++                  +GE K   I      YGF EP   + S+ +L+ +YQ   L ++ND LN+ L YP     P
Sbjct:  354 DEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKK--GCYACSVVA----------------DGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMP 457          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Mouse
Match: Gm49337 (predicted gene, 49337 [Source:MGI Symbol;Acc:MGI:6121526])

HSP 1 Score: 170.244 bits (430), Expect = 1.876e-44
Identity = 131/442 (29.64%), Postives = 206/442 (46.61%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            +   EWYWG+ S+EEVND +  + DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF EP  F SV +LI +Y    L++YN +L++ L YP S+ +       ++L +  N + + + L    S   E + + D+  E Y    +E+          +E  KI +     Q   +K   +      + +  + +  + D   +L  +L +       + +  +K   ++ E+ +K+   +PDL +L +++ Q +     R V     +    ++N D+ D    I E DEN    D                       +  WF+E+I R ++E+LL  +  G FLIR S + G YA  V  +G V+HC I+     YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  101 LQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLR----------------KGGNNKLIKIYHRDGKYGFSEPLTFTSVVELINHYHHESLAQYNPKLDVKLTYPVSRFQ------QDQLVKEDNIDAVGKNLQEFHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKDYIERFRREGNEKEIERIMMNYD---KLKSRLGEIHDSKLRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHRGVRQRRLNAWLGIKNEDS-DESYFINEEDENLPHYD-----------------------EKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPV 493          

HSP 2 Score: 52.373 bits (124), Expect = 2.753e-6
Identity = 35/122 (28.69%), Postives = 56/122 (45.90%), Query Frame = 3
Query: 1863 NSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCK-FESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKP 2225
            + + W+  + ++ +  D + G  DG FL+R+SS K  G Y  ++                  +GE K   I      YGF EP   + S+ +L+ +YQ   L ++ND LN+ L YP     P
Sbjct:  395 DEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKK--GCYACSVVA----------------DGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMP 498          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Mouse
Match: Pik3r2 (phosphoinositide-3-kinase regulatory subunit 2 [Source:MGI Symbol;Acc:MGI:1098772])

HSP 1 Score: 166.392 bits (420), Expect = 5.204e-42
Identity = 126/440 (28.64%), Postives = 211/440 (47.95%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNK-HIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPVKC 3146
            +   EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL+++  RDG YGF EP  F SV +LI +Y+   L++YN +L+  L YP SK + +    V E         +++ H    D +    + D+  E Y    +EL          +E  KI +   Q Q  C+K ++ +     N  E    + +S    ++L  ++ +  +   ++ +      +++ E+ +++   +PDL +L +++ Q +     +              I+    I    +NE ++ YSL + +            P + +  W++  I RT++EE+L  ++ GTFLIR S + G YA  V V+G  +HC I+     +GF +    + SL++LV  +   SL  HN +LT  LA+PV+ 
Sbjct:  319 LQDAEWYWGDISREEVNERLRDTPDGTFLVRDASSKIQGEYTLTLR----------------KGGNNKLIKVFHRDGHYGFSEPLTFCSVVELISHYRHESLAQYNAKLDTRLLYPVSKYQQDQV--VKEDSIEAVGAQLKVYHQQYQDKSR---EYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNS----ERLKSRIAEIHESRTKLEQDLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGA--------RQRKINEWLGI----KNETEDQYSLMEDEDA---------LPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRA 712          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. UniProt/SwissProt
Match: sp|P26450|P85A_MOUSE (Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Mus musculus OX=10090 GN=Pik3r1 PE=1 SV=2)

HSP 1 Score: 191.43 bits (485), Expect = 2.637e-49
Identity = 163/594 (27.44%), Postives = 274/594 (46.13%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIE-----TLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFS--LENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P P+I   +Y+ ++ S+ ++ +    C Q+   L  LP  NI      TL+YL++HF  + ++ +K  L ++  S IFS  L   P        A     + +I+ I     +LI    W     +E Q + +      +   +       N  +   EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK +       +++ +  N E + + LH   +   E + + D+  E Y    +E+          +E  KI +   Q Q   +K   +      + +    + H+ D   +L  ++++ +   + + E  +K   E  E+ +++   +PDL +L + + Q +     + V  +  +  L N +N +    ++E DE+   +D   + + S+N                       R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  194 PNPVIPVAVYNEMM-SLAQELQSPEDCIQLLKKLIRLP--NIPHQCWLTLQYLLKHFFKLSQASSKNLLNARVLSEIFSPVLFRFP-------AASSDNTEHLIKAI----EILIST-EW-----NERQPAPALPPKPPKPTTVANNSMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQ------DQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNHD---KLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN-ENTEDQYSLVEDDEDLPHHDEKTWNVGSSN-----------------------RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 718          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. UniProt/SwissProt
Match: sp|Q5R685|P85A_PONAB (Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Pongo abelii OX=9601 GN=PIK3R1 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.380e-48
Identity = 161/594 (27.10%), Postives = 275/594 (46.30%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSIL---DSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQ--EWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFS--LENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P P+I   +Y  +I S+ ++ +      Q+   L    S+P     TL+YL++HF  + ++ +K  L ++  S IFS  L          F+A  S +   +  + E            L+S    +   + ++         +A   +NN+++ Q  EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK +       +++ +  N E + + LH   +   E + + D+  E Y    +E+          +E  KI +   Q Q   +K   +      + +    + H+ D   +L  ++++ +   + + E  +K   E  E+ +++   +PDL +L + + Q +     + V  +  +  L N +N +    ++E DE+   +D   + + S+N                       R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  194 PNPVIPAAVYSEMI-SLAQEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLF--------RFSAASSDNTENLIKVIEI-----------LISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQ------DQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYD---KLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN-ENTEDQYSLVEDDEDLPHHDEKTWNVGSSN-----------------------RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 718          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. UniProt/SwissProt
Match: sp|P27986|P85A_HUMAN (Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Homo sapiens OX=9606 GN=PIK3R1 PE=1 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 1.816e-48
Identity = 161/594 (27.10%), Postives = 274/594 (46.13%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSIL---DSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQ--EWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFS--LENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P P+I   +Y  +I S+  + +      Q+   L    S+P     TL+YL++HF  + ++ +K  L ++  S IFS  L          F+A  S +   +  + E            L+S    +   + ++         +A   +NN+++ Q  EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK +       +++ +  N E + + LH   +   E + + D+  E Y    +E+          +E  KI +   Q Q   +K   +      + +    + H+ D   +L  ++++ +   + + E  +K   E  E+ +++   +PDL +L + + Q +     + V  +  +  L N +N +    ++E DE+   +D   + + S+N                       R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  194 PNPVIPAAVYSEMI-SLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLF--------RFSAASSDNTENLIKVIEI-----------LISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQ------DQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYD---KLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN-ENTEDQYSLVEDDEDLPHHDEKTWNVGSSN-----------------------RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 718          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. UniProt/SwissProt
Match: sp|Q63787|P85A_RAT (Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Rattus norvegicus OX=10116 GN=Pik3r1 PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 6.302e-47
Identity = 158/594 (26.60%), Postives = 271/594 (45.62%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIE-----TLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFS--LENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P P+I   +Y+ ++ S+ ++        Q+   L  + SPNI      TL+YL++HF  + ++ +K  L ++  S IFS  L   P        A     + +I+ +      L+    W     SE Q + +      +   +       N  +   EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK +       +++ +  N E + + LH   +   E + + D+  E Y    +E+          ++  KI +     Q   +K   +      + +    + H+ D   +L  ++++ +   + + E  +K   E  E+ +++   +PDL +L + + Q +     + V  +  +  L N +N +    +++ DE+   +D   + + S+N                       R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  194 PNPVIPVAVYNEMM-SLAQEVPSSEDYIQLLKKL--IRSPNIPHQYWLTLQYLLKHFFKLSQASSKNLLNARALSEIFSHVLFRFP-------AASSDNTEHLIKAV-----ELLISAEW-----SERQPAPALPPKPPKPTSIANNSMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQ------DQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNDTIKIFEEQCHPQERYSKDYIEKFKREGNEKEIQRIMHNHD---KLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN-ENTEDQYSLVDDDEDLPHHDEKTWNVGSSN-----------------------RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 718          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. UniProt/SwissProt
Match: sp|P23727|P85A_BOVIN (Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Bos taurus OX=9913 GN=PIK3R1 PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 7.094e-47
Identity = 161/594 (27.10%), Postives = 271/594 (45.62%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSIL---DSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQ--EWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFS--LENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P P+I   +   LI S+  + +      Q+   L    S+P     TL+YL++HF  + ++ +K  L ++  S +FS  L          F A  S +   +  I E            L+S    +   + ++         +A   +NN+++ Q  EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK +       +++ +  N E + + LH   +   E + + D+  E Y    +E+          +E  KI +   Q Q   +K   +      +      + H+    ++L  ++++ V   + + E  +K   E  E+ +++   +PDL +L + + Q +     + V  +  +  L N +N +    ++E DE+   +D   + + S+N                       R ++E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  194 PNPVIPVAVSSELI-SLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSELFSPLLF--------RFPAASSENTEHLIKIIEI-----------LISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQ------DQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHN---YEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN-ENTEDQYSLVEDDEDLPHHDEKTWNVGSSN-----------------------RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 718          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. TrEMBL
Match: C3YA44 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_91712 PE=4 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 3.110e-69
Identity = 236/877 (26.91%), Postives = 406/877 (46.29%), Query Frame = 3
Query:  582 SDWSNEQVLQWLCSVNFFRLVDLFENKNINGKDILSQMPQDSKELDNLEHNNATFWGQIADPFYRQTLYYALHALIDTKITGTLECKTRDILDLNDLKQTAHDNSGSKIKEKYIIELANHKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSS---IFGVNLDLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTW----PLVSVSEEQMSLSQSMNKNQLGCL-QIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEI----TKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSR----------DCLQQLNKKLNDCVQVAKEMNERREKLITESDE-LHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALD-VNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            S WS E V  W+ +VN  R  +LF+ ++++G            +L+ L ++ A     I D F+R  L  +    ID    GT   +T   LD      ++H    S       + +++H+ +E SF+    CD C++ + GL +QG+ C  C  + H++CA    +  C   + +     + S   +FG +L LQ    +  P+ +  C   ++ R L+     ++    S TAA N+   LK+      F+ + N V +   +   ++  +K YL+ELP P++   +Y S I + K+  E+    +++  ++  LP  +  TL +L+ HF  + +     K+  K  +++F   L+ PP   V + T+    H ++++L       L+   +W    P V + E++ ++   M   + G        E    +   EWYWG+ S+EEVND +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF EP +F SV +LI++Y+   L++YN +L++ L YP SK+            Q  +EG+        S +  V  K+ +  + Y +  K+ D++    TK  + I Q++        + ++I     ++    HS           +  + L  +LN+ ++ +K++ E   KL TE +  L R++   +PD+ +L +++ Q +     + V             D + E L++  +    D +        +          +++S WF+ +  R  +E LL  +  GTFL+R+S +  NYAL  V   G  +HC I+     YGF +    + SL+DLV  +   SL  HN SL T LAYPV
Sbjct:  237 SRWSVENVQHWMAAVNLSRYSELFKARHVDGS-----------KLETL-NDQALMHMGIMDDFHRICLMNS----IDELCKGTSAMRTAVPLD-----PSSHGEEAS-------LPISSHRFKEHSFSTVTWCDKCHKFLWGLIRQGLQCQDCAYSCHRMCA-HTGVPPCNTEVRDRRRRESYSPNPLFGEDLKLQFSPPDPAPVVVIKCCKAIEERGLDLDGIYRIS---SSTAAINE---LKK-----SFNTDPNSVDLSIYDLHCVSGALKRYLRELPNPVLTTELYDSFIAAAKELKEEVELVARLLELVKQLPEQHRLTLEWLMAHFCRVCQHIKANKMTPKHLAVVFCHILMRPPWENVLQVTSNTEYHVKVVEL-------LLTGGSWGEALPDVELEEDKPAIPPRMPLGRKGKENSFNNYETPQSLQEAEWYWGDISREEVNDKLKDTPDGTFLVRDASTKYKGDYTLTLR----------------KGGNNKLIKICHRDGKYGFSEPLRFSSVVELIQHYRKESLAQYNCKLDVRLTYPVSKI------------QQGDEGV------EGSSVDMVGKKLQELNKEYLDKSKQYDQLYESYTKSTQEI-QMKRQALDAFKETISIFEEQAKSHERYHSEVKGQEYKKIMENYENLKSRLNEIIESSKQL-ELDLKLQTEGNRNLDREMNSIKPDIIQLRKIRDQYVMWLGHKGVKQ-----------DKINEWLKASYDGHGGDTTAPNFNEEALPH--------HDESLWFLPDCSRVHAESLLDGKPEGTFLVRKSSQQNNYALSIVAEEGAARHCVIYNSATGYGFAEPYNLYASLKDLVLHYQQNSLYEHNDSLNTTLAYPV 1011          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. TrEMBL
Match: A0A2P6K857 (Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Nephila clavipes OX=2585209 GN=NCL1_48895 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 8.089e-68
Identity = 241/885 (27.23%), Postives = 396/885 (44.75%), Query Frame = 3
Query:  579 LSDWSNEQVLQWLCSVNFFRLVDLFENKNINGKDILSQMPQDSKELDNLEHNNATFWGQIADPFYRQTLYYALHALIDTKITGTLECKTRDILDLNDLKQTAHDNSG--SKIKEKYIIELANHKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFN--SSIFGVNLDLQKLHS-NGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEF--TALKSRHQRIIQLIFEYK--------LVLIDKFTWPLV------SVSEEQMSL----------SQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            LS W++  V++W+ ++N +R  +LF++K+I G D+   M  D  +L N+          + D F+++ +               L C   D+   N+L ++ H+     + ++E       NH++ E SF+  + CD C+  + G+  QGV C +CG  +H+ CA    L  C  +     N  N  S+IFG +L  Q L S    PL +  CI E+++R    +N   L   Y  +A ++    L++     +  E+     +       +A  +K YL+ELP P+     Y   IE+ K    D  C   +  ++  LP  +  TL+ L+ HF      C   +LQ       +S+ +  PP I+++      L+   +RI+Q+++  +        L+L  K+  P+       ++   ++S           S SM+ N    +     E    +   EWYWG+ ++EEVN+ +    DG FLVRD+S+K  G YTLT+R                K G NKL++I  R+G YGF EP  F SV +LI YY    L++YN  L++ L +P S+  P+ K     LY    E   +    T  D+       D    T    ++++  +   LKG             +I  ++ + E                  L   +Q  +E  +  +  +      HR L       + +N L+ +I+RL+K RE    M   + V   D + ++L+    E ++      I+ +   Q  +   P +N+S WF+++I R E+  LL  +  GTFLIR SR  G YAL +  +G V HC I+  +  YGF +      SL+ LV  +   SL  HN +L T LAYPV
Sbjct:   12 LSQWTSSNVVEWMAALNLYRYAELFKSKDIKGSDL---MALDRDKLMNM---------GVKDEFHQKAI---------------LVC-VDDLCQRNNLNRSLHETKALNASLREGASPTGNNHQLLEQSFSCVLQCDKCHNYLHGVIHQGVVCQECGLIWHRTCA-ATGLPRCNSDNVEKANRKNLISAIFGKDLSCQFLPSVQSAPLLVIRCIFEIENRGAA-TNNIDLYRVYRTSAPSDIVAELRQ-----KLSEDVERTNLASYELHCIASALKKYLRELPNPVFPVQFYDKFIETAKIQNNDH-CVQALEQLVHQLPIHHKSTLQTLMAHF------CRVCRLQ-------YSRGIKEPPTILIQMLCHILLRPPWERIVQIVYNTEAHIRVVELLLLKGKWGEPMPVFDSAPALPPRRISKPFPESMLHGGSLSMSPNSAATIPQRPSEGPKSLADAEWYWGDITREEVNEKLKDTPDGTFLVRDASNKGSGEYTLTLR----------------KGGSNKLIKICQRNGKYGFTEPLMFNSVVELITYYHNVSLAQYNRTLDVKLLHPVSRFHPKTK-----LYDQFYEDYSK----TFQDVQLKKQAQDAFIATLAVFEEQIHLLEDNLKGAAPC---------EIQPLMENYEL-----------------LKSRLQALEESKKHLDMELKHQAAFHRSLD------REMNTLKPEIMRLYKQREDFQAMLYAKGVKK-DRVFKLLQDSCTEARDI-----IRESAFLQD-DETLPHHNESLWFLQDISRNEATRLLTGKPDGTFLIRNSRTQGQYALSIVADGKVGHCLIYKTDKGYGFAEPYNVHPSLKSLVLHYAQTSLEEHNDTLKTTLAYPV 783          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. TrEMBL
Match: A0A4Y2HHT6 (Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Araneus ventricosus OX=182803 GN=PIK3R1 PE=4 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 6.166e-67
Identity = 248/937 (26.47%), Postives = 423/937 (45.14%), Query Frame = 3
Query:  453 TSCNQVFHSICHKNHKTFKSCQKFLKNTNKDSVELFQSTEMSLSDWSNEQVLQWLCSVNFFRLVDLFENKNINGKDILSQMPQDSKELDNLEHNNATFWGQIADPFYRQTLYYALHALIDTKITGTLECKTRDILDLNDLKQTAHDNS--GSKIKEKYIIELANHKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFN--SSIFGVNLDLQKLHS-NGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEF--TALKSRHQRIIQLIFEYK--------LVLIDKFTWPLV------SVSEEQMS----------LSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEI----TKILKGIDQIQTWCNKHIFQIMNIINSNER--TDWVSHSRDC-LQQLNKK---LNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            T C   FH +C      F       +N+ +         E+ LS W++  V++W+ ++N +R  +LF++K+I G D+++           L+ +     G + D F+++    A+   +D            D+   N+L ++ H+     + ++E       NH++ E SF+  + CD C+  + G+  QGV C +CG  +H+ CA    L  C  +     N  N  S+IFG +L  Q L S    PL +  CI E++ R    +N   L   Y  +A ++    L++     +  E+     +       +A  +K YL+ELP P+     Y   IE+ K    D+ C   +  ++  LP  +  TL+ L+ HF      C   +LQ       +S+ +  PP I+++      L+   +RI+Q+++  +        L+L  K+  P+       ++   ++S          L  +M+ N    +     E    +   EWYWG+ ++EEVN+ +    DG FLVRD+S+K  G YTLT+R                K G NKL++I  R+G YGF EP  F SV +LI YY    L++YN  L++ L +P S+  P     ++E     +E +         D+ +V  K+ K  + Y +  K  D+     +K  + + Q++          + +         D +  +  C +Q L +    L   +Q  +E  ++ +  +      HR L       + +N L+ +I+RL+K RE    M   + V   D + ++L+   +E ++      I+ +   Q  +   P +N+S WF+++I R E+  LL  +  GTFLIR SR  G YAL +  +G V HC I+  +  YGF +      SL+ LV  +   SL  HN +L T LAYPV
Sbjct:   57 TECLGCFHDVC----VPFAPSHLCQRNSGEPPPNTLDR-EVPLSQWTSSNVVEWMAALNLYRYAELFKSKDIKGSDLMT-----------LDRDKLMSMG-VKDEFHQK----AILVCVD------------DLCQRNNLNRSLHETKTQNASLREGSSPTSNNHQLLEQSFSCVLQCDKCHNYLHGVIHQGVVCQECGLIWHRTCA-ATGLPRCNTDNIEKANRKNLISAIFGKDLSCQFLPSVQSAPLLVIRCILEIESRGAA-TNNIDLYRVYRTSAPSDIVAELRQ-----KLSEDVERTNLASYELHCIASALKKYLRELPNPVFPVQFYDKFIETAKIQNNDQ-CVQALEQLVHQLPIHHKSTLQTLMAHF------CRVCRLQ-------YSRGIKEPPTILIQMLCHILLRPPWERIVQIVYNTEAHIRVVELLLLKGKWGEPMPVFDSAPALPPRRISKINQPFPESVLHGNMSPNSGSTIPQRPSEGPKSLADAEWYWGDITREEVNEKLKDTPDGTFLVRDASNKGSGEYTLTLR----------------KGGSNKLIKICHRNGKYGFTEPLMFNSVVELINYYHNVSLAQYNRTLDVKLLHPVSRFHPT---GIDE-----DESI---------DVEKVGEKLMKINQEYLQKTKLYDQFYEDYSKTFQDV-QLKKQAQDAFVATLAVFEEQIHLLEDNLKGAAPCEIQPLMENYELLKSRLQALEESKKQLDMELKHQAAFHRSLD------REMNTLKPEIMRLYKQREDFQAMLYAKGVKK-DRVFKLLQDSCSEARD-----IIRESAFLQD-DETLPHHNESLWFLQDITRNEAIRLLTGKPDGTFLIRNSRTQGQYALSIVADGKVGHCLIYKTDKGYGFAEPYNVHPSLKSLVLHYAQTSLEEHNDTLKTTLAYPV 892          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. TrEMBL
Match: A0A0M3TCH6 (PI3K21B OS=Leptinotarsa decemlineata OX=7539 PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 2.966e-65
Identity = 253/937 (27.00%), Postives = 415/937 (44.29%), Query Frame = 3
Query:  387 TISLCFICGENMMGLGLDFIYCTSCNQVFHSICHKNHKTFKSCQKFLKNTNKDSVELFQSTEMSLSDWSNEQVLQWLCSVNFFRLVDLFENKNINGKDILSQMPQDSKELDNLEHNNATFWGQIADPFYRQTLYYALHALIDTKITGTLECKTRDILDLNDLKQTAHD---NSGSKIKEKYIIELANHKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVF--NSSIFGVNLDLQ-KLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLI--WESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEY-----KLV-LIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDE----LHRKLQMDRPDLKRLNRLQAQIIRLFKDREV-PDEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            T  LC  C + + G G   + C  C+  FH+ C +    +  CQK   N     V L    +  +S+W++  V++W+ ++N +   D+F  K+I G D++           NL+ +     G I D F+++ +   +  L+          K  D L +    ++ HD   NS S            H + + SF+    CD CN+ + GL  QG  C  CG   H+ CA    L  C     +  + F    S FG  L  Q KL  +  P  +  C  EL+ R    +   + ++ Y+   AT  +  L+ L    R +E SN V + + + + +A + K YL+ELP+PL+    Y   +E+ KK   D+ C S +  +++ LP  +  TLR+++ H   I   E     K        +     + PP   V +       H RI++L+  Y     KL         P   VS    S+  S+       L+   E+ N  +   EWYWG+  +E+VN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  R+G YGF EP  F SV +LI +++   LS+YN  L+I L YP S+   E +    E      E LI  ++  +++  +++  V K+   +NE   E+      L  + ++       +F+    I    + +   H    L+  ++ L   + +  E  E+ E+++ + +     L R+L   +P +  L R + + +R  + R   P ++  + N  NI+   E  + D +   ++   Y                      W + +  RTE+E+LL+ +  GTFL+R+SR++  YAL V  NG   HC I   +   GF +    + +L+DLV  +   SL  HN  L TVLAYP+
Sbjct:  108 TPILCKHCKDYIWGQGHVGVKCKDCHACFHNYCLRFFPGY-LCQK--DNDVLPPVTL--DYDKPISEWTSSNVIEWMAALNLYTYCDVFRCKDIKGADLI-----------NLDRDKLIGMG-IKDEFHQKAILSCIDELLK---------KPDDKLSM----RSEHDETLNSNSNYA---------HNLSQHSFSSLERCDKCNKYLRGLLHQGFICQDCGLVAHRTCA-ATGLPSCTHRPMDDRSHFIQFKSFFGQGLCCQFKLSDSPAPELLINCALELEKR----AKASESLELYNLYCATPPSDQLQLLVK--RIEENSNNVNLSEFSPVCIASVFKKYLRELPDPLVPVQWYDKFLEASKKR-NDEECTSILRQLVEELPDHHKSTLRFIMGHLCRICQLEYARGNKSPPTVLVQVMCHIFLRPPWERVIQVVYNTQAHNRIVELLLLYCDWGEKLPEFASAPAIPPRKVSRMGSSVYYSL-------LEREKEKNNMSLQDAEWYWGSIKREDVNEVLNDTVDGTFLVRDASSKC-GEYTLTLR----------------KGGANKLIKICHRNGMYGFTEPYTFHSVVELINHFRNDSLSQYNASLDIKLLYPVSRNNQEEELAKTEKIDKLVENLIN-INQNLAEKNKISETVSKD---FNETSTEVQTKRHALDALKELV-----QLFKDQTTIQEKSQNEAQPHEIKSLEINSELLKKRLNLMSESCEQLEEILKQKEAYKKVLERELTSLKPGIVGLARERDRYVRWLQQRGFSPAKINQILNT-NIEEPSEGCDVDTDTLPHNDERY----------------------WLMLDCSRTEAEKLLEGKPDGTFLVRKSRQMNKYALSVVCNGSTNHCIINETSKGLGFTEPYNIYPTLKDLVLHYATNSLEIHNDLLNTVLAYPI 941          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. TrEMBL
Match: A0A1Y1KD31 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_05851 PE=4 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 1.412e-64
Identity = 248/943 (26.30%), Postives = 415/943 (44.01%), Query Frame = 3
Query:  360 HRVFKKSVGTISLCFICGENMMGLGLDFIYCTSCNQVFHSICHKNHKTFKSCQKFLKNTNKDSVELFQSTEMSLSDWSNEQVLQWLCSVNFFRLVDLFENKNINGKDILSQMPQDSKELDNLEHNNATFWGQIADPFYRQTLYYALHALIDTKITGTLECKTRDILDLNDLKQTAHDNSGSKIKEKYIIELANHKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSN-GVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLI--FSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQ----LNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNR--------LQAQIIRLFKDREVPDEMFSLENVDNIDAMCEILESD-ENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            HR+      T  LC  C + + G G   + C  C+  FH IC +   T   CQK   N    +  L Q  +  +++WS+  V++W+ ++N +   D+F  K+I G D++     D ++L N+          I D F+++ +   +  L                     LKQ   D+S   + +    E+  H + + SF+    C  CN+ + GL  QG  C  CG   H+ CA    L LC  ++   +   + SIFG  L LQ    +   PL +  C  EL+ R  NN++    ++ YS   A+     + EL    + +E  N V + + +   +A ++K +L+ELP+P+I    Y   +ES K    D+ C + +  ++  +P  +  TL YL+ HF  I +    +  ++    LI      L+ PP   + +       H RII+L     L+L   +   L   +       + +++     L      I+ ++   EWYWG+  +EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  R+G YGF EP  F SV +LI +Y+   LS+YN  L+I L YP SK   E +    E        L+  +H+ + D  ++  +V   TE +N+  +E+    + L  + ++       +FQ         +++   H    L      L ++L    +  ++++E  ++    +  L R+L   +P+++ L R        L  + ++L + R++ +     ++ D  D + +  E D EN   ND                       +  WF+ N  R+ +E+ L  +  GTFL+R S     +AL +  NG+  HC I       GF +    + SL+ LV  +   SL  HN SL T L YP+
Sbjct:  104 HRLGDVYFLTPILCGHCKDYVWGCGRVGVQCKDCHACFHKICVR-FATNYVCQK--NNEVLTAATLDQ--DKPITEWSSSTVVEWMAALNLYPYADVFRCKDIKGSDLVHL---DKEKLMNM---------GIKDEFHQKAILSCVSEL---------------------LKQP--DDSSVTVDQYNYTEVYAHNLTQHSFSTLERCKKCNKFLRGLLHQGFICQDCGLVAHRTCA-ATGLPLCLPSVEKPLGTQSKSIFGEGLCLQFNSPDMPAPLIVVKCTQELESRAKNNTS----LELYSLYCASPPADQVNEL--RQKLNESPNNVDLSEYSPACIANVLKKFLRELPDPIIPVQWYDRFLESSKLR-NDEQCSTLLGRLVQEIPEHHRSTLTYLMSHFCRICQMEYARGNRNPPTILIQTMCHILLRPPWERIIQVVYNTQAHNRIIEL-----LLLHCDWNETLPKFAGAPAVPPRKVSRIGASILDKEKSSISTNLQDAEWYWGDIKREEVNEKLNDTVDGTFLVRDASSKG-GEYTLTLR----------------KGGTNKLIKICHRNGKYGFTEPYTFSSVVELINHYRNDSLSQYNASLDIKLLYPISKNNQEEEIANTENIDKLTANLVE-VHNKLLDKNKLFEQV---TEDFNKTSQEVTSKRQALDALKEL-----VKVFQDQTKTQEKFQSEAQPHEIKTLMDNADLLKQRLKMMEESCEQLDENLQRQEAYNRSLERELTSLKPEIRDLMRECDNYQRWLITRGVKLARIRQLLN-----KDDDGTDGVDQTEECDIENLPHND-----------------------EKTWFVANCSRSMAEQYLAGKPDGTFLVRPS-STHQFALSIACNGITNHCIIQKTKRGLGFAEPYNIYDSLKSLVLHYSQNSLEIHNDSLNTTLRYPI 938          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Cavefish
Match: pik3r1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:NCBI gene;Acc:103046618])

HSP 1 Score: 176.407 bits (446), Expect = 2.885e-45
Identity = 156/596 (26.17%), Postives = 267/596 (44.80%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDS--LPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQT---WCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P+P+I   IY+ ++  V++    + C   +  +  S  +P     TL+  ++H   + ++     L ++  + IFS TL    +            H RI++++   +               +     +  MN N      +AL +        EWYWG+ S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L+YP SK +       +++ +  N E +   LH         N + D+  E Y    +E+          +E  KI +  +Q QT   +  ++I +     N  E    +       ++L  ++++ V   + + E  +K   E  E+ +K+   +PDL +L + + Q +     + V     +E   ++N +N +    ++E DE+   +D                       + +W + NI R ++E LL+ ++ GTFL+R S + G YA  V V+  V+HC I      +GF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  195 PQPVIHSAIYNDMVHIVQEVQGSEECAQHLRRVASSSAMPPQYWLTLQCFLRHLAHVCQASAVNLLNARALAEIFSPTLF---RQQASSCEPNPESHIRILEVLVTSEWSSSQAAPALPPKPPKPTPVTNNGMNNN------MALHDA-------EWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRHESLAQYNPKLDVKLQYPVSKHQQ------DQVVKEDNIEAVGTKLHEYHQQFQAKNKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFE--EQCQTQERYSKEYIEKFRREGNDKE----IQRIMVNYEKLKSRISEIVDSKRRLEEDLKKQAAEYREIDKKMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGIKN-ENQEDQYAMVEDDEDLPHHD-----------------------ERSWKLGNINRIQAEALLRGKRDGTFLVRDSSKPGCYACSVVVDSEVKHCVINKTPTGFGFAEPYNLYGSLKELVLHYQHTSLVQHNDSLNVTLAYPV 722          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Cavefish
Match: pik3r1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:NCBI gene;Acc:103046618])

HSP 1 Score: 167.548 bits (423), Expect = 1.306e-42
Identity = 154/596 (25.84%), Postives = 265/596 (44.46%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDS--LPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQT---WCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P+P+I   IY+ ++  V++    + C   +  +  S  +P     TL+  ++H   + ++     L ++  + IFS TL    +            H RI++++   +               +     +  MN N      +AL +        EWYWG+ S++EVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L+YP SK +       +++ +  N E +   LH         N + D+  E Y    +E+          +E  KI +  +Q QT   +  ++I +     N  E    +       ++L  ++++ V   + + E  +K   E  E+ +K+   +PDL +L + + Q +     + V     +E   ++N +N +    ++E DE+   +D                       + +W + NI R ++E LL+ ++ GTFL+R S + G YA  V     V+HC I      +GF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  151 PQPVIHSAIYNDMVHIVQEVQGSEECAQHLRRVASSSAMPPQYWLTLQCFLRHLAHVCQASAVNLLNARALAEIFSPTLF---RQQASSCEPNPESHIRILEVLVTSEWSSSQAAPALPPKPPKPTPVTNNGMNNN------MALHDA-------EWYWGDISRQEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRHESLAQYNPKLDVKLQYPVSKHQQ------DQVVKEDNIEAVGTKLHEYHQQFQAKNKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFE--EQCQTQERYSKEYIEKFRREGNDKE----IQRIMVNYEKLKSRISEIVDSKRRLEEDLKKQAAEYREIDKKMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGIKN-ENQEDQYAMVEDDEDLPHHD-----------------------ERSWKLGNINRIQAEALLRGKRDGTFLVRDSSKPGCYACSVV---EVKHCVINKTPTGFGFAEPYNLYGSLKELVLHYQHTSLVQHNDSLNVTLAYPV 675          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Cavefish
Match: ENSAMXT00000043367.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002343.1:239988:244063:1 gene:ENSAMXG00000034321.1 transcript:ENSAMXT00000043367.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.214 bits (378), Expect = 3.585e-38
Identity = 126/440 (28.64%), Postives = 206/440 (46.82%), Query Frame = 3
Query: 1842 EEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELD----EITKILKGIDQIQTWC---NKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLND------CVQVAK------EMNERREKL-------ITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLV 3071
            E  ++ +   EWYWG+ S+EEVND +  + DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP S+              Y  + L++       +I  V  K+ +    Y E  KE D    E TK  + I   +T     N+ I       ++ ER     +S++ +++  ++ ND       +  AK      E+++ + +L         ++ E  +K+   +PDL +L +++ Q +     + V     ++   ++N +N D    + E DEN    D                       +++WF+ ++ RT+SE+LL  +  G FLIR S + G YA  V V+G V+HC I+     YGF +    + +L+DL 
Sbjct:   56 EAASSSLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLR----------------KGGNNKLIKIYHRDGKYGFSDPLTFSSVVELISHYRHESLAQYNTKLDVKLMYPISR--------------YQQDQLVK-----EDNIDAVGKKLQEYHNQYQEKSKEYDRLYEEYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQER-----YSKEYIERFRREGNDKEIERIMMNYAKLKSRLGEIHDSKIRLEQDLKTQALDNRETDKKMNSLKPDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGIKN-ENTDEAYFVSEEDENLPHYD-----------------------ETSWFVGDLNRTQSEDLLLGKPDGAFLIRESSKKGCYACSVVVDGEVKHCVIYSTPRGYGFAEPYNLYSTLKDLT 431          

HSP 2 Score: 60.077 bits (144), Expect = 9.302e-9
Identity = 32/97 (32.99%), Postives = 54/97 (55.67%), Query Frame = 3
Query: 2856 WFIENIERTESEELLKNRQHGTFLIR--RSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            W+  +I R E  + L++   GTFL+R   ++  G+Y L +   G  +  KI+ ++GKYGF  +  +F S+ +L+  +   SLA +N  L   L YP+
Sbjct:   67 WYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGF-SDPLTFSSVVELISHYRHESLAQYNTKLDVKLMYPI 162          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Cavefish
Match: pik3r3b (phosphoinositide-3-kinase, regulatory subunit 3b (gamma) [Source:ZFIN;Acc:ZDB-GENE-040426-743])

HSP 1 Score: 146.747 bits (369), Expect = 8.797e-36
Identity = 127/463 (27.43%), Postives = 205/463 (44.28%), Query Frame = 3
Query: 1842 EEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELD----EITKILKGIDQIQTWC---NKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLND------CVQVAK------EMNERREKL-------ITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            E  ++ +   EWYWG+ S+EEVND +  + DG FL                                   G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP S+              Y  + L++       +I  V  K+ +    Y E  KE D    E TK  + I   +T     N+ I       ++ ER     +S++ +++  ++ ND       +  AK      E+++ + +L         ++ E  +K+   +PDL +L +++ Q +     + V     ++   ++N +N D    + E DEN    D +                       +WF+ ++ RT+SE+LL  +  G FLIR S + G YA  V V+G V+HC I+     YGF +    + +L+DLV  +H  SL  HN SL   LAYPV
Sbjct:  309 EAASSSLQDAEWYWGDISREEVNDKLRDMPDGTFLSTGC-------------------------------GNNKLIKIYHRDGKYGFSDPLTFSSVVELISHYRHESLAQYNTKLDVKLMYPISR--------------YQQDQLVK-----EDNIDAVGKKLQEYHNQYQEKSKEYDRLYEEYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQER-----YSKEYIERFRREGNDKEIERIMMNYAKLKSRLGEIHDSKIRLEQDLKTQALDNRETDKKMNSLKPDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGIKN-ENTDEAYFVSEEDENLPHYDET-----------------------SWFVGDLNRTQSEDLLLGKPDGAFLIRESSKKGCYACSVVVDGEVKHCVIYSTPRGYGFAEPYNLYSTLKDLVLHYHQTSLVQHNDSLNVRLAYPV 692          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Cavefish
Match: ENSAMXT00000040806.1 (phosphatidylinositol 3-kinase regulatory subunit gamma-like [Source:NCBI gene;Acc:103035767])

HSP 1 Score: 105.916 bits (263), Expect = 2.377e-24
Identity = 51/116 (43.97%), Postives = 68/116 (58.62%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYP 2207
            I   EWYWG+ S+EE ++ +  L DG FLVRD+S+K  G YTL++R                K+   +LVRI   DG +GF EP  F SVP+LI Y+Q H L++YN  L+I L  P
Sbjct:   36 IQDAEWYWGDISREEASEKLNSLPDGSFLVRDASNKVPGQYTLSLR----------------KDNSTRLVRITQHDGLFGFCEPLTFTSVPELISYHQQHSLAQYNPALDITLTRP 135          

HSP 2 Score: 73.559 bits (179), Expect = 1.955e-13
Identity = 41/96 (42.71%), Postives = 53/96 (55.21%), Query Frame = 3
Query: 2856 WFIENIERTESEELLKNRQHGTFLIRRSRELGN-YALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            WF+ N+ R E+EELL  +  G FLIR S    + YA  V VN  V+HC I      +GF +      SL+ LV+ +H  SLA HN +L   LA PV
Sbjct:  203 WFVGNLSRAEAEELLDGKPSGAFLIRSSGTRKDCYACSVMVNDEVRHCMIIRTPRGFGFAEPYDLHGSLKALVQHYHHTSLAQHNRALDVRLAIPV 298          

HSP 3 Score: 51.6026 bits (122), Expect = 2.556e-6
Identity = 29/97 (29.90%), Postives = 51/97 (52.58%), Query Frame = 3
Query: 2856 WFIENIERTESEELLKNRQHGTFLIRRS--RELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            W+  +I R E+ E L +   G+FL+R +  +  G Y L +  +   +  +I   +G +GF + + +F S+ +L+      SLA +NP+L   L  PV
Sbjct:   41 WYWGDISREEASEKLNSLPDGSFLVRDASNKVPGQYTLSLRKDNSTRLVRITQHDGLFGFCEPL-TFTSVPELISYHQQHSLAQYNPALDITLTRPV 136          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Sea Lamprey
Match: pik3r1 (phosphoinositide-3-kinase, regulatory subunit 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030131-1280])

HSP 1 Score: 172.94 bits (437), Expect = 1.640e-46
Identity = 127/442 (28.73%), Postives = 212/442 (47.96%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            +   EWYWG+ S+EEVN+ +    DG +LVRD+S K  G YTLT+R                K G NKL++I  RD  YGF EP  F SV +LI +Y+   L++YN +L++ L+YP SK         +++ +  N + + + L     D  + +   DK  E Y    +E+          +E  KI +     Q    K   +      + +  + +  + + LQ    +L++       + +  +K  TE+ E+ + +   +PDL +L +++ Q +     + V     +E   ++N DN +    I++ +EN    D                       + +W++ +I R ++E++L++R +GTFLIR+S + G YA  V V G V+HC IF ++  YGF +    + SL +LV  +   SL  HN SL   LA+PV
Sbjct:   64 LQDAEWYWGDISREEVNEKLRNTPDGTYLVRDASTKMQGDYTLTLR----------------KGGNNKLIKIFHRDSKYGFSEPLTFNSVVELITHYRHESLAQYNPKLDVKLQYPVSK------SQQDQVVKEDNIDAVGKKLQELHKDYQDKSHDYDKLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQRHTQERYTKEYIERFKREGNEKEIERIMLNYEKLQS---RLSEIRDSKLRLEQDLKKQATENREIDKLMNSIKPDLIQLRKIRDQYLMWLTHKGVRQKKINEWLGIKN-DNTEDPYSIIDEEENLPHQD-----------------------EKSWYVPDINREKAEDMLRDRANGTFLIRKSSKHGFYACSVVVYGEVKHCMIFSRSTGYGFAEPYNLYGSLRELVLHYQQTSLVQHNDSLNVTLAHPV 456          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 73.1738 bits (178), Expect = 3.669e-14
Identity = 73/259 (28.19%), Postives = 121/259 (46.72%), Query Frame = 3
Query:  957 SFTGKIICDYCNRIMIGLQKQGVHC--IKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLV--GIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVK-KDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQK--LQSKKWSLIFSKTLIWP-PQIMVKEFTALKSRHQRII 1709
            +F G   C+YC   M GL  QGV C  + CG N HK C   +    C+ +   +  VF   +      L K H   +P+ ++ CI E++ R L  S G   +   S       T + KE        E++++     +D+N   +   +KLY +ELP PL+ Y  Y   +E+ K  D  +++   Q+   L +LP  + +TL  L+ H H    S  ++   + S+  S++F  TL+ P  Q ++     +  RHQR++
Sbjct:   54 TFRGPHWCEYCANFMWGLIAQGVKCSALDCGLNVHKQCCRLVPTD-CQPDPRRLPKVFGCDLTA----LVKAHRGRLPMVVEMCIGEIEARGL-KSEGLYRVSGVSDLVEEVRTAFDKE-------GEKADISAKAYEDVN--VITGALKLYFRELPTPLVTYQAYPHFVEAAKVSDPAERL--EQLRRALQTLPPAHYDTLHCLMAHLHRRRVSQQEKHNLMSSENLSIVFGPTLMRPHEQDVLATLNGM--RHQRLL 293          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 59.3066 bits (142), Expect = 6.106e-10
Identity = 61/227 (26.87%), Postives = 109/227 (48.02%), Query Frame = 3
Query: 1038 CGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVG--IKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVK-KDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRII 1709
            CG N HK C+ ++    CE ++ +V  V++  +      L K H+   P+ +  CI E++ R L +   + L     ++    D        A  R  E++++      DIN   +   +KLY ++LP PLI Y  Y   IE+ K  D ++++    I+  L  LP  + E+LRYL+ H   +     +  + ++  +++F  TL+ PP+  V   T    R+QR++
Sbjct:    3 CGLNVHKQCS-KVVPHDCEPDLKHVKKVYSCDLTT----LVKAHNRKRPMVVDMCIKEIEMRGLRS---EGLYRVSGFSEHIEDV-----KMAFDRDGEKADISANSYDDIN--IITGALKLYFRDLPIPLITYDAYPKFIEASKLMDADERL--EGIHEALRLLPPAHYESLRYLMAHLKRVTLYSKENLMSAENLAIVFGPTLMRPPEQDVLA-TLNDIRYQRLV 211          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002350.1 (pep scaffold:Pmarinus_7.0:GL490795:1252:4138:-1 gene:ENSPMAG00000002143.1 transcript:ENSPMAT00000002350.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 1.570e-9
Identity = 35/96 (36.46%), Postives = 54/96 (56.25%), Query Frame = 3
Query: 2859 FIENIERTESEELLKNRQHGTFLIR-RSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPVK 3143
            F E +ER+ + ++L +  HGT+L+R R R+   YA+ +  N  V+H KI  + GK+  I     F+SL  LV+ + + SL     +L T L YP K
Sbjct:    1 FAEVLERSAAGDILMSCPHGTYLVRGRVRDQREYAISIRHNDEVKHIKIVAKEGKF-HITETKRFKSLVQLVEYYQVHSLKEGFSALDTNLKYPYK 95          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Sea Lamprey
Match: si:ch1073-416j23.1 (si:ch1073-416j23.1 [Source:ZFIN;Acc:ZDB-GENE-100922-35])

HSP 1 Score: 56.225 bits (134), Expect = 3.677e-8
Identity = 62/247 (25.10%), Postives = 99/247 (40.08%), Query Frame = 3
Query:  948 RETSFTGKII-----CDYC-NRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKE-------LFAHPRFDEESNLVGI-KDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLI 1646
            R+ SF  K +     C  C NRI  G  K    C  C    H  C     L      +P+++        G   D     +  +P  +  C+DE++ R      G   +  Y    +  D   LKE       L A  R D    + G+ KD             L+ L EPL+ + ++H+ +++++   ED    + +Y  +  LP PN +TL YL+ H   + ES  + K+     S +F  TL+
Sbjct:  285 RQHSFVPKTVIKPESCVPCGNRIKFG--KLAHKCRDCRMVAHAECREHCPLPC----VPHILGTCRDYGEGTVADFSPPTAPMIPSLVLHCVDEIERR------GMMEVGLYRIPGSDRDVKELKERWLRGKGLPALARVDNVHVVCGLLKDF------------LRSLKEPLLTHRLHHTFLKAIEISDEDNRAAA-MYGAIGQLPQPNRDTLAYLMLHLQRVAES-TECKMNQSNLSRVFGPTLV 505          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Nematostella
Match: EDO48108 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK55])

HSP 1 Score: 98.2117 bits (243), Expect = 9.265e-23
Identity = 87/277 (31.41%), Postives = 130/277 (46.93%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKL--KPEVKGHVNELYQYTNEG-LIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQ----LNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRL 2669
            +   EWYWG  SKE VN  M   +DG F+VRDS  +  G YTLT+                 K G  KL+RI+ +DG YGF EP  F+SV  L+ YY+   L++YN +L++ L +P S+   + EV    N+ Y     G L+ +    M   TE     +K  + Y ++ +E+ ++  IL    + Q      I + + +    +R     H R  L+Q    L  +LND           + +L     EL  K Q +R   KR+N L+ +II L
Sbjct:    1 LKKAEWYWGEASKEAVNARMRDTEDGTFIVRDSK-RFPGEYTLTLM----------------KGGVIKLIRIMYKDGKYGFSEPLTFKSVIDLVSYYKDRSLAQYNPKLDVKLAHPLSRFEQEGEVPPEKNDEYMTKMVGDLVDINKEFMGSSTE----YEKLYKHYTDSSEEIADLQMIL----EAQRSVISMIEEQLRLHEHFQREASPEH-RGLLRQNYELLKHRLNDA----------KLELGNSERELSNKTQDNRLADKRMNSLRPKIIEL 241          

HSP 2 Score: 64.3142 bits (155), Expect = 3.698e-11
Identity = 32/96 (33.33%), Postives = 54/96 (56.25%), Query Frame = 3
Query: 2856 WFIENIERTESEELLKNRQHGTFLIRRSREL-GNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            W+     +      +++ + GTF++R S+   G Y L +   GV++  +I  ++GKYGF     +F+S+ DLV  +  RSLA +NP L   LA+P+
Sbjct:    6 WYWGEASKEAVNARMRDTEDGTFIVRDSKRFPGEYTLTLMKGGVIKLIRIMYKDGKYGF-SEPLTFKSVIDLVSYYKDRSLAQYNPKLDVKLAHPL 100          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Nematostella
Match: EDO42176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S254])

HSP 1 Score: 88.1965 bits (217), Expect = 4.170e-18
Identity = 84/287 (29.27%), Postives = 131/287 (45.64%), Query Frame = 3
Query:  939 HKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSI---FGVNL-DLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELF----AHPRFD----EESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVKKDFEDK-MCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKS----RHQRI-IQLIFEYKLVLID 1745
            H  +  +F G   CD+C   + GL  QGV C  CG N HK C          + IPN        I   FGV+L  L KLH+   P  +  CI+E++ R L++         Y  +   +D   LK  F     H   +    E  NL    DIN   +  + KLY ++LP PLI +  Y   I + K   +DK +   ++   L  LP  + ET+++L+ H H + +  +K  +  +  S++F  TL+  P     E  +L S    + QR+ ++L+  ++ VL D
Sbjct:  193 HNFKTNTFKGPHWCDHCRNFLWGLTMQGVKCQDCGFNAHKQCT---------KAIPNNCKPDKKYIKRAFGVDLTTLVKLHNTKRPFVVDICINEVEKRGLDSEG------LYRVSGFADDIEALKNSFDKGNTHTTVNYSDGESVNLSTYDDIN--TITGVCKLYFRQLPLPLITFETYSKFIAAAKT--QDKHLRIEELSKALGELPQAHYETMKFLMGHLHRVSQRRSKNMMTEENLSIVFGPTLMRAP-----EGDSLDSLVDMKFQRLAVELLISHQHVLFD 455          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Nematostella
Match: EDO47441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM51])

HSP 1 Score: 57.3806 bits (137), Expect = 2.961e-8
Identity = 60/223 (26.91%), Postives = 102/223 (45.74%), Query Frame = 3
Query:  996 IMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCE--ENIPNVINVFNSSIFGVNLD-LQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIES-VKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWP 1652
            I I L KQG              A  ++LQ  +  + I    +V +  +FGV+++ +    S  +PL +  C+ E++ R L        +  Y  + A++D   LKE F     + +S LV + + +   +A L K+YL++LPEPL    +Y   +++    D E+K     +  +  SLP+PN  T  YL QH   + E     K+     S +F   ++ P
Sbjct:  575 ITIALDKQG--------------AITLSLQYSKTRQGIERKKSVNSVGVFGVDIETVTSRESCDIPLIVIGCVREIEKRGLEE------VGIYRLSGASSDVKRLKEGFDE---NSQSALVLVSEADIHAVAGLFKMYLRDLPEPLFTDELYDKFVKAYAMADAEEKR--ETMLELFQSLPTPNRLTACYLFQHLRKVAEKSEVHKMGLNNLSTVFGPNVLRP 772          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Nematostella
Match: EDO41241 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z5])

HSP 1 Score: 53.9138 bits (128), Expect = 3.405e-7
Identity = 35/120 (29.17%), Postives = 53/120 (44.17%), Query Frame = 3
Query:  900 SKIKEKYIIELANHKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMD 1259
            +K+ E   I   +H++   S+     CD+C +++ GL +QG+ C  CG NFHK CA++I    C ++   +   FN+           L  N  P    C    LQ     N  G  L D
Sbjct:   89 AKVPEDETIA-RSHQLAVHSYKSPTFCDFCGQMLYGLVRQGLKCDGCGGNFHKRCAYRIR-NNCSDSKHRISGHFNT-----------LPRNVAPGLDLCTPPSLQPINSWNEGGHNLRD 195          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Nematostella
Match: EDO49086 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI38])

HSP 1 Score: 48.1358 bits (113), Expect = 2.495e-6
Identity = 28/104 (26.92%), Postives = 54/104 (51.92%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFE-DKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIF 1721
            PE L+   +Y S IE+ +KD   ++M    +  +++ LP  N ETLR+L+ H   + E  +  K++++  +++F  TL+   +  +       S   RI++ I 
Sbjct:   54 PEGLVTAELYESFIEANRKDDPVERM--GALKMLINELPDHNYETLRHLLTHLKHVAEHADTNKMEARNLAIVFGPTLVRTGEDTMMSMVKDMSDQCRIVETIL 155          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Medaka
Match: pik3r1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:NCBI gene;Acc:101171597])

HSP 1 Score: 172.555 bits (436), Expect = 5.032e-46
Identity = 136/455 (29.89%), Postives = 215/455 (47.25%), Query Frame = 3
Query: 1848 INNDINSQ------EWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQT---WCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            INN +N+       EWYWG  S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK +       +++ +  N E + R L        E N + D+  E Y    +E+          +E  KI +  +Q QT   +   +I +     N  E    +       ++L  ++++ V   + + E   K   +  E+ +++   +PDL +L + + Q +     + V     +E   ++N +N +    ++E DE+   +D                       +  W +E I+R E+E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:   28 INNGMNNNMALQDAEWYWGEISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKQQQ------DQVVKEDNIEAVGRKLCEYHQQYQEKNKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFE--EQCQTQERYSKDYIERFRKEGNEKE----IQRIMGNYEKLKSRISEIVDSKRRLEEDLRKQAADYREIDKRMNSIKPDLIQLRKTRDQYLTWLTQKGVRQKKLNEWLGIKN-ENTEDQYSMVEDDEDLPHHD-----------------------ERTWKLEKIDRLEAEGLLQGKRDGTFLVRESSKPGCYACSVMVDGEVKHCVINKTPSGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 430          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Medaka
Match: pik3r1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:NCBI gene;Acc:101171597])

HSP 1 Score: 172.94 bits (437), Expect = 6.027e-46
Identity = 136/455 (29.89%), Postives = 215/455 (47.25%), Query Frame = 3
Query: 1848 INNDINSQ------EWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQT---WCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            INN +N+       EWYWG  S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK +       +++ +  N E + R L        E N + D+  E Y    +E+          +E  KI +  +Q QT   +   +I +     N  E    +       ++L  ++++ V   + + E   K   +  E+ +++   +PDL +L + + Q +     + V     +E   ++N +N +    ++E DE+   +D                       +  W +E I+R E+E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:   51 INNGMNNNMALQDAEWYWGEISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKQQQ------DQVVKEDNIEAVGRKLCEYHQQYQEKNKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFE--EQCQTQERYSKDYIERFRKEGNEKE----IQRIMGNYEKLKSRISEIVDSKRRLEEDLRKQAADYREIDKRMNSIKPDLIQLRKTRDQYLTWLTQKGVRQKKLNEWLGIKN-ENTEDQYSMVEDDEDLPHHD-----------------------ERTWKLEKIDRLEAEGLLQGKRDGTFLVRESSKPGCYACSVMVDGEVKHCVINKTPSGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 453          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Medaka
Match: pik3r1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:NCBI gene;Acc:101171597])

HSP 1 Score: 176.407 bits (446), Expect = 2.691e-45
Identity = 159/596 (26.68%), Postives = 267/596 (44.80%), Query Frame = 3
Query: 1413 PEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILD--SLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTN-EGLIRLLHSTMSDITEVNAKVDKNTETYNENQKEL----------DEITKILKGIDQIQT---WCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVP----DEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            P+P++   +   ++ + K+    + C   +  +    SLP      L  L++HF  + +S +K  L  +    IFS       Q  V    +L + + +II+++   +               +    ++  MN N      +AL++        EWYWG  S+EEVN+ +    DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF +P  F SV +LI +Y+   L++YN +L++ L YP SK +       +++ +  N E + R L        E N + D+  E Y    +E+          +E  KI +  +Q QT   +   +I +     N  E    +       ++L  ++++ V   + + E   K   +  E+ +++   +PDL +L + + Q +     + V     +E   ++N +N +    ++E DE+   +D                       +  W +E I+R E+E LL+ ++ GTFL+R S + G YA  V V+G V+HC I      YGF +    + SL++LV  +   SL  HN SL   LAYPV
Sbjct:  195 PQPVVHPALQVQMVHTAKEVANPEECAQLLRRVASTPSLPHQYWLALHCLLRHFARVCQSGSKNLLSPRTLGEIFSPVFFR--QQSVGCEPSLDA-YIKIIEVLVTTEWSESRAAPALPPKPPKPAAVINNGMNNN------MALQDA-------EWYWGEISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR----------------KGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKQQ------QDQVVKEDNIEAVGRKLCEYHQQYQEKNKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFE--EQCQTQERYSKDYIERFRKEGNEKE----IQRIMGNYEKLKSRISEIVDSKRRLEEDLRKQAADYREIDKRMNSIKPDLIQLRKTRDQYLTWLTQKGVRQKKLNEWLGIKN-ENTEDQYSMVEDDEDLPHHD-----------------------ERTWKLEKIDRLEAEGLLQGKRDGTFLVRESSKPGCYACSVMVDGEVKHCVINKTPSGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV 722          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Medaka
Match: pik3r3b (phosphoinositide-3-kinase regulatory subunit 3 [Source:NCBI gene;Acc:101170665])

HSP 1 Score: 167.162 bits (422), Expect = 5.964e-44
Identity = 139/446 (31.17%), Postives = 212/446 (47.53%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEI----TKILKGIDQIQTWC---NKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHR---KLQMD--------RPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNI-DAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            +   EWYWG+ S+EEVND +  + DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF EP  F SV  LI +Y+   L++YN +L++ L YP S+ + +         Q   E           +I  V  K+ +    Y +  K+ D +    TK  + I   +T     N+ I       ++ ER     +S+D +++ +++ ND       MN   EKL +   E+H    +L+ D        R   K++N L+  +I+L   R++ D+     N   +           +NE+ ++ S    +  N+           ++ +WF+ N+ R E+EELL  +  G FLIR S + G YA  V V+G V+HC I+     +GF +    + SL+DLV  +   SL  HN SL   LAYPV
Sbjct:   57 LQEAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLR----------------KGGNNKLIKIYHRDGKYGFSEPLTFNSVVDLISHYRHESLAQYNTKLDVKLMYPVSRFQQD---------QLVKE----------DNIDAVGKKLQEYHNQYQDKSKDYDRLYEDYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQER-----YSKDYIERFHREGNDKEIERIMMN--YEKLKSRLGEIHDSKVRLEQDLKTQAMDNRETDKKMNSLKPDLIQL---RKIRDQYLVWLNHKGVRQKRINDWLGLKNENTDESSFVSEEEENLPH--------YDEKSWFVGNLNRMEAEELLIGKSDGVFLIRESSKKGCYACSVVVDGEVKHCVIYSTPRGFGFAEPYNLYSSLKDLVLHYQQTSLVQHNDSLNVRLAYPV 449          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Medaka
Match: pik3r3b (phosphoinositide-3-kinase regulatory subunit 3 [Source:NCBI gene;Acc:101170665])

HSP 1 Score: 167.162 bits (422), Expect = 7.611e-44
Identity = 139/446 (31.17%), Postives = 212/446 (47.53%), Query Frame = 3
Query: 1860 INSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEI----TKILKGIDQIQTWC---NKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHR---KLQMD--------RPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNI-DAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPV 3140
            +   EWYWG+ S+EEVND +  + DG FLVRD+S K  G YTLT+R                K G NKL++I  RDG YGF EP  F SV  LI +Y+   L++YN +L++ L YP S+ + +         Q   E           +I  V  K+ +    Y +  K+ D +    TK  + I   +T     N+ I       ++ ER     +S+D +++ +++ ND       MN   EKL +   E+H    +L+ D        R   K++N L+  +I+L   R++ D+     N   +           +NE+ ++ S    +  N+           ++ +WF+ N+ R E+EELL  +  G FLIR S + G YA  V V+G V+HC I+     +GF +    + SL+DLV  +   SL  HN SL   LAYPV
Sbjct:   68 LQEAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLR----------------KGGNNKLIKIYHRDGKYGFSEPLTFNSVVDLISHYRHESLAQYNTKLDVKLMYPVSRFQQD---------QLVKE----------DNIDAVGKKLQEYHNQYQDKSKDYDRLYEDYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQER-----YSKDYIERFHREGNDKEIERIMMN--YEKLKSRLGEIHDSKVRLEQDLKTQAMDNRETDKKMNSLKPDLIQL---RKIRDQYLVWLNHKGVRQKRINDWLGLKNENTDESSFVSEEEENLPH--------YDEKSWFVGNLNRMEAEELLIGKSDGVFLIRESSKKGCYACSVVVDGEVKHCVIYSTPRGFGFAEPYNLYSSLKDLVLHYQQTSLVQHNDSLNVRLAYPV 460          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Planmine SMEST
Match: SMESG000078199.1 (SMESG000078199.1)

HSP 1 Score: 2017.28 bits (5225), Expect = 0.000e+0
Identity = 1009/1025 (98.44%), Postives = 1009/1025 (98.44%), Query Frame = 3
Query:   75 MFIVLKCVIDFDRPYCDNFQYLNSIKDDIIICDSLCHIKSDVFGFGKNVTQNTYGLFSFNNFVMIDRTMYVSEELLLAVVEYTDPVIKKDVPVRYHRVFKKSVGTISLCFICGENMMGLGLDFIYCTSCNQVFHSICHKNHKTFKSCQKFLKNTNKDSVELFQSTEMSLSDWSNEQVLQWLCSVNFFRLVDLFENKNINGKDILSQMPQDSKELDNLEHNNATFWGQIADPFYRQTLYYALHALIDTKITGTLECKTRDILDLNDLKQTAHDNSGSKIKEKYIIELANHKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPVKCD 3149
            MFIVLKCVIDFDRPYCDNFQYLNSIKDDIIICDSLCHIKSDVFGFGKNVTQNTYGLFSFNNFVMIDRTMYVSEELLLAVVEYTDPVIKKDVPVRYHRVFKKSVGTISLCFICGENMMGLGLDFIYCTSCNQVFHSICHKNHKTFKSCQKFLKNTNKDSVELFQSTEMSLSDWSNEQVLQWLCSVNFFRLVDLFENKNINGKDILSQMPQDSKELDNLEHNNATFWGQIADPFYRQTLYYALHALIDTKITGTLECKTRDILDLNDLKQTAHDNSGSKIKEKYIIELANHKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDIYLAKLIKLYLKELPEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTI                RKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPNLNNPINNKSNWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPVKCD
Sbjct:    1 MFIVLKCVIDFDRPYCDNFQYLNSIKDDIIICDSLCHIKSDVFGFGKNVTQNTYGLFSFNNFVMIDRTMYVSEELLLAVVEYTDPVIKKDVPVRYHRVFKKSVGTISLCFICGENMMGLGLDFIYCTSCNQVFHSICHKNHKTFKSCQKFLKNTNKDSVELFQSTEMSLSDWSNEQVLQWLCSVNFFRLVDLFENKNINGKDILSQMPQDSKELDNLEHNNATFWGQIADPFYRQTLYYALHALIDTKITGTLECKTRDILDLNDLKQTAHDNSGSKIKEKYIIELANHKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDIYLAKLIKLYLKELPEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTI----------------RKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPNLNNPINNKSNWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPVKCD 1009          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Planmine SMEST
Match: SMESG000078199.1 (SMESG000078199.1)

HSP 1 Score: 1965.27 bits (5090), Expect = 0.000e+0
Identity = 988/1025 (96.39%), Postives = 988/1025 (96.39%), Query Frame = 3
Query:   75 MFIVLKCVIDFDRPYCDNFQYLNSIKDDIIICDSLCHIKSDVFGFGKNVTQNTYGLFSFNNFVMIDRTMYVSEELLLAVVEYTDPVIKKDVPVRYHRVFKKSVGTISLCFICGENMMGLGLDFIYCTSCNQVFHSICHKNHKTFKSCQKFLKNTNKDSVELFQSTEMSLSDWSNEQVLQWLCSVNFFRLVDLFENKNINGKDILSQMPQDSKELDNLEHNNATFWGQIADPFYRQTLYYALHALIDTKITGTLECKTRDILDLNDLKQTAHDNSGSKIKEKYIIELANHKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFHGNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEILESDENEDKNDYSLYQIKSTNMRQAPXXXXXXXXXXXWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPVKCD 3149
            MFIVLKCVIDFDRPYCDNFQYLNSIKDDIIICDSLCHIKSDVFGFGKNVTQNTYGLFSFNNFVMIDRTMYVSEELLLAVVEYTDPVIKKDVPVRYHRVFKKSVGTISLCFICGENMMGLGLDFIYCTSCNQVFHSICHKNHKTFKSCQKFLKNTNKDSVELFQSTEMSLSDWSNEQVLQWLCSVNFFRLVDLFENKNINGKDILSQMPQDSKELDNLEHNNATFWGQIADPFYRQTLYYALHALIDTKITGTLECKTRDILDLNDLKQTAHDNSGSKIKEKYIIELANHKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDIYLAKLIKLYLKELPEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTI                RKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEI                     MRQAPNLNNPINNKSNWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPVKCD
Sbjct:    1 MFIVLKCVIDFDRPYCDNFQYLNSIKDDIIICDSLCHIKSDVFGFGKNVTQNTYGLFSFNNFVMIDRTMYVSEELLLAVVEYTDPVIKKDVPVRYHRVFKKSVGTISLCFICGENMMGLGLDFIYCTSCNQVFHSICHKNHKTFKSCQKFLKNTNKDSVELFQSTEMSLSDWSNEQVLQWLCSVNFFRLVDLFENKNINGKDILSQMPQDSKELDNLEHNNATFWGQIADPFYRQTLYYALHALIDTKITGTLECKTRDILDLNDLKQTAHDNSGSKIKEKYIIELANHKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNLDLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDIYLAKLIKLYLKELPEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFEYKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQEWYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTI----------------RKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEYNDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNAKVDKNTETYNENQKELDEITKILKGIDQIQTWCNKHIFQIMNIINSNERTDWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRPDLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEI---------------------MRQAPNLNNPINNKSNWFIENIERTESEELLKNRQHGTFLIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVKTFHMRSLASHNPSLTTVLAYPVKCD 988          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Planmine SMEST
Match: SMESG000057671.1 (SMESG000057671.1)

HSP 1 Score: 71.633 bits (174), Expect = 1.917e-12
Identity = 87/348 (25.00%), Postives = 152/348 (43.68%), Query Frame = 3
Query:  687 SQMPQDSKELDNLEHNNATFWGQIADPFYRQTLYYALHALIDTKITGTLECKTRDILDLNDLKQTA-------HDNSG-SKIK--EKYIIELAN--------HKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNL-DLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAAT----NDTIYLKELFAHPRFDEESNLVGIKDINDXXXXXXXXXXXXXXPEPLIAYGIYHSLIESVKKDFEDKMCCS--QIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLIWPP 1655
            SQ P  S  L++   NN+T   Q+    + + ++   + L+D  ++ ++   T    +  DL Q++        + SG S+I      +IE  N        H  ++ +F G   CD+C   M GL  QGV C  CG   HK C+ ++      +  P +  +    +FG+ L  L K+ +  +PL  +  I  L+ R LN+    ++              N  I   +    PRF +   L G+  +           +L++LP PLI   +Y +LI S++K  EDK+     Q  + +  L S +  TL + ++H + + +      + S   ++IF+ TLI  P
Sbjct:  258 SQRP--SLILESPSSNNSTLSSQMTTGSHYEQIFDCRNNLLDDSMSISVFDSTELPNNTKDLSQSSPGSDRKSSNRSGLSRILSLRTPVIEQQNSFKQLEKSHNFKQHTFVGPQWCDFCAHFMWGLVAQGVQCFDCGFQAHKKCSDKV----AADCFPVMKRM--KRVFGIELTSLAKMENRAIPLVFEKLIQALEDRDLNSQGLYRISGNIDLIEEVRIDLNKDIESVDFKGDPRFRDIETLTGLIKL-----------FLRQLPIPLITSELYTNLI-SIRK-AEDKIPIRYYQFRNTMSILNSVHYATLEFFIRHLNKVSQFHRTNFMTSSNLAIIFAPTLICKP 584          
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Planmine SMEST
Match: SMESG000066507.1 (SMESG000066507.1)

HSP 1 Score: 63.929 bits (154), Expect = 4.689e-10
Identity = 63/250 (25.20%), Postives = 113/250 (45.20%), Query Frame = 3
Query:  918 YIIELANHKMRETSFTGKIICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVFNSSIFGVNL-DLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYTAATNDTIYLKELFAHPRFDEESNLVGIKDINDXXX------XXXXXXXXXXXPEPLIAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHLIWESCNKQKLQSKKWSLIFSKTLI 1646
            Y  +   H  +  +F G   CD+C   M GL  QGV C  CG   H+ C+ ++      + +P++  +    +FG+ L  L K+   GVP+ I   ++E++ R      G ++   Y  +  +       EL    + D + ++  I    D  L      + LIKL+ ++LP PL+   +   L++ +K     K+   Q    L  LP  +  TL+YL+ H + +       K+  +  ++IF+ +LI
Sbjct:  356 YAEQEKQHNFKTHTFKGPHWCDFCTHFMWGLVAQGVKCQDCGFQAHRKCSDRV----PSDCLPDMKRL--KRVFGIELTSLGKVEKRGVPMIIMRLVEEVEAR------GMEIEGIYRVSGNS-------ELIDEVKADLDKDIDSIDMEKDGRLCEIHNISSLIKLFFRQLPIPLVTLEVSSMLMDIIKTQENQKVRLEQFTDCLLRLPLVHYATLKYLMAHLYKLSSFSEINKMTVENLAIIFAPSLI 586          
The following BLAST results are available for this feature:
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIK3R13.781e-4927.10phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
PIK3R13.781e-4927.10phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
PIK3R15.238e-4729.27phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
PIK3R11.321e-4629.11phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
PIK3R36.290e-4428.80phosphoinositide-3-kinase regulatory subunit 3 [So... [more]
back to top
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aap-15.127e-1028.46Phosphoinositide 3-kinase adapter subunit; Phospho... [more]
aap-15.127e-1028.46Phosphoinositide 3-kinase adapter subunit; Phospho... [more]
chin-11.428e-825.00CHImaeriN (Rac-GTPase-activating protein) homolog ... [more]
spv-14.656e-727.20Spermathecal Physiology Variant [Source:UniProtKB... [more]
spv-15.060e-727.20Spermathecal Physiology Variant [Source:UniProtKB... [more]
back to top
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi3K21B1.537e-2626.61gene:FBgn0020622 transcript:FBtr0331208[more]
Pi3K21B1.537e-2626.61gene:FBgn0020622 transcript:FBtr0331205[more]
Pi3K21B6.763e-1638.95gene:FBgn0020622 transcript:FBtr0331206[more]
Pi3K21B6.763e-1638.95gene:FBgn0020622 transcript:FBtr0331207[more]
RhoGAP5A3.451e-823.67gene:FBgn0029778 transcript:FBtr0070785[more]
back to top
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pik3r17.175e-4927.33phosphoinositide-3-kinase, regulatory subunit 1 (a... [more]
pik3r17.175e-4927.33phosphoinositide-3-kinase, regulatory subunit 1 (a... [more]
pik3r16.140e-4729.89phosphoinositide-3-kinase, regulatory subunit 1 (a... [more]
pik3r3b9.477e-4630.75phosphoinositide-3-kinase, regulatory subunit 3b (... [more]
pik3r3b9.477e-4630.75phosphoinositide-3-kinase, regulatory subunit 3b (... [more]
back to top
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIK3R11.394e-4426.49phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
hvcn11.534e-4428.28hydrogen voltage gated channel 1 [Source:Xenbase;A... [more]
hvcn12.031e-4428.28hydrogen voltage gated channel 1 [Source:Xenbase;A... [more]
hvcn12.057e-4428.28hydrogen voltage gated channel 1 [Source:Xenbase;A... [more]
hvcn12.227e-4428.28hydrogen voltage gated channel 1 [Source:Xenbase;A... [more]
back to top
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pik3r13.770e-5027.44phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
Pik3r12.467e-4629.09phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
Pik3r35.763e-4529.73phosphoinositide-3-kinase regulatory subunit 3 [So... [more]
Gm493371.876e-4429.64predicted gene, 49337 [Source:MGI Symbol;Acc:MGI:6... [more]
Pik3r25.204e-4228.64phosphoinositide-3-kinase regulatory subunit 2 [So... [more]
back to top
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26450|P85A_MOUSE2.637e-4927.44Phosphatidylinositol 3-kinase regulatory subunit a... [more]
sp|Q5R685|P85A_PONAB1.380e-4827.10Phosphatidylinositol 3-kinase regulatory subunit a... [more]
sp|P27986|P85A_HUMAN1.816e-4827.10Phosphatidylinositol 3-kinase regulatory subunit a... [more]
sp|Q63787|P85A_RAT6.302e-4726.60Phosphatidylinositol 3-kinase regulatory subunit a... [more]
sp|P23727|P85A_BOVIN7.094e-4727.10Phosphatidylinositol 3-kinase regulatory subunit a... [more]
back to top
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3YA443.110e-6926.91Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A2P6K8578.089e-6827.23Phosphatidylinositol 3-kinase regulatory subunit a... [more]
A0A4Y2HHT66.166e-6726.47Phosphatidylinositol 3-kinase regulatory subunit a... [more]
A0A0M3TCH62.966e-6527.00PI3K21B OS=Leptinotarsa decemlineata OX=7539 PE=2 ... [more]
A0A1Y1KD311.412e-6426.30Uncharacterized protein OS=Photinus pyralis OX=705... [more]
back to top
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pik3r12.885e-4526.17phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
pik3r11.306e-4225.84phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
ENSAMXT00000043367.13.585e-3828.64pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
pik3r3b8.797e-3627.43phosphoinositide-3-kinase, regulatory subunit 3b (... [more]
ENSAMXT00000040806.12.377e-2443.97phosphatidylinositol 3-kinase regulatory subunit g... [more]
back to top
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pik3r11.640e-4628.73phosphoinositide-3-kinase, regulatory subunit 1 (a... [more]
chn23.669e-1428.19chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
chn26.106e-1026.87chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
ENSPMAT00000002350.11.570e-936.46pep scaffold:Pmarinus_7.0:GL490795:1252:4138:-1 ge... [more]
si:ch1073-416j23.13.677e-825.10si:ch1073-416j23.1 [Source:ZFIN;Acc:ZDB-GENE-10092... [more]
back to top
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481089.265e-2331.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421764.170e-1829.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474412.961e-826.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412413.405e-729.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490862.495e-626.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pik3r15.032e-4629.89phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
pik3r16.027e-4629.89phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
pik3r12.691e-4526.68phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
pik3r3b5.964e-4431.17phosphoinositide-3-kinase regulatory subunit 3 [So... [more]
pik3r3b7.611e-4431.17phosphoinositide-3-kinase regulatory subunit 3 [So... [more]
back to top
BLAST of Phosphatidylinositol 3-kinase regulatory subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000078199.10.000e+098.44SMESG000078199.1[more]
SMESG000078199.10.000e+096.39SMESG000078199.1[more]
SMESG000057671.11.917e-1225.00SMESG000057671.1[more]
SMESG000066507.14.689e-1025.20SMESG000066507.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006764 ID=SMED30006764|Name=Phosphatidylinositol 3-kinase regulatory subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=3287bp
TTTCAAAATAGGAATTAACTTTTTTTGTGATAATTTATTGTTTTTTTCTA
TTACTATCTGGCAAAATAAATGAAATGTTTATTGTATTGAAATGTGTTAT
CGACTTCGATCGACCATATTGTGATAATTTTCAATATTTAAATTCCATAA
AAGATGATATTATAATTTGTGATTCTCTTTGCCATATTAAAAGTGATGTT
TTTGGATTCGGCAAGAATGTTACACAAAACACATATGGATTATTTTCATT
CAATAATTTTGTTATGATTGATAGGACAATGTATGTAAGTGAAGAACTTC
TTTTAGCAGTTGTGGAATATACAGATCCAGTTATAAAAAAAGACGTTCCA
GTCAGATATCATCGAGTGTTTAAAAAAAGTGTTGGTACAATTTCTCTATG
CTTTATCTGCGGAGAAAACATGATGGGATTGGGATTAGACTTCATTTACT
GCACTAGTTGTAATCAAGTATTTCACAGTATTTGCCATAAAAACCACAAA
ACTTTCAAAAGTTGCCAGAAATTTCTAAAAAATACAAATAAAGATTCTGT
AGAACTATTTCAATCGACTGAAATGTCTTTATCCGATTGGTCCAATGAAC
AAGTTTTACAGTGGCTTTGTTCTGTGAATTTCTTTCGATTGGTTGATTTA
TTTGAAAACAAAAATATAAACGGAAAGGATATTTTATCTCAGATGCCTCA
AGATTCCAAAGAGCTTGACAATTTAGAGCATAATAATGCTACGTTTTGGG
GTCAGATTGCTGATCCTTTTTATCGGCAGACACTCTACTATGCATTGCAT
GCATTAATCGATACGAAAATTACAGGAACACTTGAATGTAAAACGAGGGA
TATTCTTGATCTCAATGACTTGAAACAGACTGCACATGACAATTCTGGTT
CGAAAATAAAAGAAAAATACATTATAGAATTGGCTAATCACAAAATGAGA
GAAACCTCATTCACAGGAAAAATAATTTGTGATTATTGTAATCGAATAAT
GATAGGGTTACAAAAACAAGGAGTTCACTGCATTAAATGCGGCAACAATT
TTCATAAAGTTTGTGCATTTCAAATTAATTTACAATTGTGTGAGGAAAAT
ATCCCAAACGTGATAAATGTGTTCAACAGTTCAATATTTGGTGTCAACCT
TGATCTACAGAAATTACATTCTAATGGAGTGCCATTGTTTATCAAATGTT
GTATTGATGAATTACAACATAGATGTCTTAATAATAGTAATGGACAGAAA
TTAATGGATGCATACAGTTATACTGCTGCTACAAATGACACTATTTACCT
GAAGGAATTATTTGCCCACCCAAGATTTGATGAAGAATCCAATTTAGTCG
GGATCAAAGATATTAATGATATATATTTGGCGAAATTGATTAAATTGTAT
TTAAAAGAGCTTCCAGAGCCATTGATTGCCTATGGTATCTACCATAGTTT
AATAGAAAGTGTTAAGAAAGATTTTGAAGATAAGATGTGCTGTTCACAAA
TTTATTCAATACTCGACAGTCTTCCGTCGCCGAACATCGAGACTCTTCGT
TATCTAGTTCAACATTTTCATTTGATTTGGGAAAGTTGCAATAAGCAAAA
GTTACAATCCAAAAAATGGTCTCTTATATTTTCTAAAACTCTCATTTGGC
CTCCACAAATTATGGTCAAGGAATTTACTGCCCTTAAATCCAGACATCAG
AGAATTATACAGCTTATATTTGAATACAAATTGGTGTTGATTGATAAATT
TACTTGGCCACTGGTATCAGTTTCTGAAGAACAAATGTCTCTGTCGCAAT
CGATGAATAAAAACCAGTTGGGTTGTTTACAGATAGCTTTGGAAGAAATT
AATAACGACATCAATTCCCAAGAATGGTATTGGGGTAATACTTCAAAAGA
AGAGGTCAATGACTACATGACGGGCTTGCAAGATGGATATTTTTTGGTTA
GAGACTCATCAGATAAAGCTTTGGGAATTTATACTTTGACAATTAGGGTT
TTAGTAAATACTGTCGAATTTCATGGCAATCAATTTAGTCAGCGAAAAGA
AGGAGAAAATAAATTAGTACGAATAATTTGTCGAGATGGGTTCTATGGAT
TCCAAGAACCGTGTAAATTTGAGTCTGTACCGAAATTGATAAAATATTAT
CAAACCCATAAACTTTCTGAATACAATGACCAACTAAATATCATGCTACG
ATATCCATGTTCGAAATTAAAACCTGAAGTTAAAGGTCATGTCAATGAAT
TGTATCAGTATACAAACGAAGGATTGATAAGATTACTTCATTCTACGATG
AGTGATATTACAGAAGTCAATGCCAAAGTTGATAAAAATACTGAAACGTA
CAATGAAAATCAAAAAGAATTAGATGAAATAACAAAAATTCTGAAAGGCA
TTGATCAAATCCAAACGTGGTGCAATAAGCATATTTTTCAAATAATGAAC
ATTATAAATTCAAATGAAAGAACTGATTGGGTGTCCCATTCAAGAGATTG
TCTTCAACAACTTAATAAAAAATTAAATGACTGTGTACAAGTGGCCAAGG
AAATGAACGAACGACGTGAGAAGCTGATCACCGAATCCGATGAGTTACAT
CGAAAATTACAAATGGATAGGCCGGATTTAAAAAGATTAAACCGACTGCA
GGCTCAAATTATCAGATTATTCAAAGACAGGGAAGTTCCAGATGAAATGT
TCAGTTTAGAAAATGTTGATAACATTGACGCAATGTGTGAAATACTGGAA
TCGGATGAGAATGAAGATAAAAATGATTATAGTCTTTATCAAATAAAGTC
AACAAACATGAGGCAAGCTCCAAATTTAAATAACCCTATAAATAATAAAT
CCAATTGGTTTATTGAGAACATCGAAAGAACCGAATCAGAAGAACTGTTA
AAAAACCGACAACATGGTACCTTTCTAATTAGACGAAGCCGTGAACTAGG
AAATTACGCTTTGGATGTGAATGTCAATGGAGTTGTTCAGCATTGCAAAA
TCTTTTGTCAAAATGGAAAATATGGATTTATCAAAAACGTTTGTTCTTTT
CAAAGTCTGGAAGATCTTGTCAAAACGTTTCATATGCGTAGTTTAGCCTC
ACACAATCCTTCTTTAACTACAGTTTTAGCATACCCTGTTAAATGTGATT
GAAATTGTTTGACAATTTAGTAGATTATGAGAACTATTAGGCAGTTGTAT
ATATTTATTTTTCTATGCGCTGCTGTATTTATTCTAAATCAAACAGAGAG
CGTTTGCTAATTTAATCGTGCTGTATTCTGCTTTGGA
back to top

protein sequence of SMED30006764-orf-1

>SMED30006764-orf-1 ID=SMED30006764-orf-1|Name=SMED30006764-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1026bp
MFIVLKCVIDFDRPYCDNFQYLNSIKDDIIICDSLCHIKSDVFGFGKNVT
QNTYGLFSFNNFVMIDRTMYVSEELLLAVVEYTDPVIKKDVPVRYHRVFK
KSVGTISLCFICGENMMGLGLDFIYCTSCNQVFHSICHKNHKTFKSCQKF
LKNTNKDSVELFQSTEMSLSDWSNEQVLQWLCSVNFFRLVDLFENKNING
KDILSQMPQDSKELDNLEHNNATFWGQIADPFYRQTLYYALHALIDTKIT
GTLECKTRDILDLNDLKQTAHDNSGSKIKEKYIIELANHKMRETSFTGKI
ICDYCNRIMIGLQKQGVHCIKCGNNFHKVCAFQINLQLCEENIPNVINVF
NSSIFGVNLDLQKLHSNGVPLFIKCCIDELQHRCLNNSNGQKLMDAYSYT
AATNDTIYLKELFAHPRFDEESNLVGIKDINDIYLAKLIKLYLKELPEPL
IAYGIYHSLIESVKKDFEDKMCCSQIYSILDSLPSPNIETLRYLVQHFHL
IWESCNKQKLQSKKWSLIFSKTLIWPPQIMVKEFTALKSRHQRIIQLIFE
YKLVLIDKFTWPLVSVSEEQMSLSQSMNKNQLGCLQIALEEINNDINSQE
WYWGNTSKEEVNDYMTGLQDGYFLVRDSSDKALGIYTLTIRVLVNTVEFH
GNQFSQRKEGENKLVRIICRDGFYGFQEPCKFESVPKLIKYYQTHKLSEY
NDQLNIMLRYPCSKLKPEVKGHVNELYQYTNEGLIRLLHSTMSDITEVNA
KVDKNTETYNENQKELDEITKILKGIDQIQTWCNKHIFQIMNIINSNERT
DWVSHSRDCLQQLNKKLNDCVQVAKEMNERREKLITESDELHRKLQMDRP
DLKRLNRLQAQIIRLFKDREVPDEMFSLENVDNIDAMCEILESDENEDKN
DYSLYQIKSTNMRQAPNLNNPINNKSNWFIENIERTESEELLKNRQHGTF
LIRRSRELGNYALDVNVNGVVQHCKIFCQNGKYGFIKNVCSFQSLEDLVK
TFHMRSLASHNPSLTTVLAYPVKCD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR000980SH2
IPR000198RhoGAP_dom
IPR013761SAM/pointed_sf
IPR002219PE/DAG-bd
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0007165signal transduction
GO:0043551regulation of phosphatidylinositol 3-kinase activity
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0035014phosphatidylinositol 3-kinase regulator activity
GO:0016301kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005942phosphatidylinositol 3-kinase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 810..844
NoneNo IPR availableGENE3DG3DSA:3.30.60.20coord: 272..346
e-value: 1.8E-12
score: 48.7
NoneNo IPR availablePANTHERPTHR10155:SF10PI3K21B, ISOFORM Bcoord: 370..1023
NoneNo IPR availablePANTHERPTHR10155PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY SUBUNITcoord: 370..1023
NoneNo IPR availableCDDcd00159RhoGAPcoord: 370..551
e-value: 2.14677E-18
score: 81.5792
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 83..143
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 275..335
IPR000980SH2 domainPRINTSPR00401SH2DOMAINcoord: 991..1005
score: 29.63
coord: 947..957
score: 51.74
coord: 928..942
score: 39.75
coord: 958..969
score: 31.12
IPR000980SH2 domainSMARTSM00252SH2_5coord: 926..1008
e-value: 2.2E-17
score: 73.7
coord: 599..698
e-value: 2.6E-18
score: 76.8
IPR000980SH2 domainPFAMPF00017SH2coord: 928..1001
e-value: 3.5E-16
score: 59.0
coord: 601..692
e-value: 8.0E-9
score: 35.5
IPR000980SH2 domainPROSITEPS50001SH2coord: 928..1022
score: 16.989
IPR000980SH2 domainPROSITEPS50001SH2coord: 601..712
score: 15.669
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 367..553
e-value: 7.5E-12
score: 55.4
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 370..528
e-value: 6.8E-19
score: 68.2
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 359..556
score: 23.223
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 168..223
e-value: 2.5E-6
score: 29.7
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 169..205
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 920..1024
e-value: 3.1E-25
score: 90.1
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 582..721
e-value: 1.1E-26
score: 95.0
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 925..1022
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 595..714
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 348..557
e-value: 7.0E-27
score: 95.9
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 353..551
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS00479ZF_DAG_PE_1coord: 289..339
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS00479ZF_DAG_PE_1coord: 96..147
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 95..147
score: 8.776
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 288..339
score: 11.201