Degenerin unc-8

Overview
NameDegenerin unc-8
Smed IDSMED30006756
Length (bp)1786
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Degenerin unc-8 (SMED30006756) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Degenerin unc-8 (SMED30006756) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006756

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006756SMESG000022995.1 SmedASXL_011122SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30006756SMESG000022995.1 dd_Smed_v6_23965_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Degenerin unc-8 vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 59.6918 bits (143), Expect = 4.366e-9
Identity = 48/205 (23.41%), Postives = 86/205 (41.95%), Query Frame = 2
Query:  977 SSTYLYEG---EYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKGETGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFT 1582
            ++T++Y G     + C +  +QK+ V  C C  P  P+ +M  N  K C   ++   E +      +  +Y K  K + I         Y    C + +Y+V+               Y   +W      K+          L++ R+N A + +     + +   E   Y+ + +++D+GGL GLW+G SVV L EI  ++ F 
Sbjct:  480 AATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSK-GKEAIIP------DCYCHQPCQETNYEVT---------------YSSARW-PSGSAKVMECLPGDFLCLEKYRKNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLIVFA 661          
BLAST of Degenerin unc-8 vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 59.6918 bits (143), Expect = 4.366e-9
Identity = 48/205 (23.41%), Postives = 86/205 (41.95%), Query Frame = 2
Query:  977 SSTYLYEG---EYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKGETGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFT 1582
            ++T++Y G     + C +  +QK+ V  C C  P  P+ +M  N  K C   ++   E +      +  +Y K  K + I         Y    C + +Y+V+               Y   +W      K+          L++ R+N A + +     + +   E   Y+ + +++D+GGL GLW+G SVV L EI  ++ F 
Sbjct:  480 AATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSK-GKEAIIP------DCYCHQPCQETNYEVT---------------YSSARW-PSGSAKVMECLPGDFLCLEKYRKNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLIVFA 661          
BLAST of Degenerin unc-8 vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 59.6918 bits (143), Expect = 4.885e-9
Identity = 47/205 (22.93%), Postives = 85/205 (41.46%), Query Frame = 2
Query:  977 SSTYLYEG---EYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKGETGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFT 1582
            ++T++Y G     + C +  +QK+ V  C C  P  P+ +M  N  K C   ++   E +      +  +Y K         E  +   Y    C + +Y+V+               Y   +W      K+          L++ R+N A + +     + +   E   Y+ + +++D+GGL GLW+G SVV L EI  ++ F 
Sbjct:  500 AATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSK-------GKEAIIPDCYCHQPCQETNYEVT---------------YSSARW-PSGSAKVMECLPGDFLCLEKYRKNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLIVFA 681          
BLAST of Degenerin unc-8 vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 59.6918 bits (143), Expect = 4.885e-9
Identity = 47/205 (22.93%), Postives = 85/205 (41.46%), Query Frame = 2
Query:  977 SSTYLYEG---EYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKGETGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFT 1582
            ++T++Y G     + C +  +QK+ V  C C  P  P+ +M  N  K C   ++   E +      +  +Y K         E  +   Y    C + +Y+V+               Y   +W      K+          L++ R+N A + +     + +   E   Y+ + +++D+GGL GLW+G SVV L EI  ++ F 
Sbjct:  500 AATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSK-------GKEAIIPDCYCHQPCQETNYEVT---------------YSSARW-PSGSAKVMECLPGDFLCLEKYRKNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLIVFA 681          
BLAST of Degenerin unc-8 vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 59.6918 bits (143), Expect = 5.408e-9
Identity = 47/205 (22.93%), Postives = 85/205 (41.46%), Query Frame = 2
Query:  977 SSTYLYEG---EYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKGETGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFT 1582
            ++T++Y G     + C +  +QK+ V  C C  P  P+ +M  N  K C   ++   E +      +  +Y K         E  +   Y    C + +Y+V+               Y   +W      K+          L++ R+N A + +     + +   E   Y+ + +++D+GGL GLW+G SVV L EI  ++ F 
Sbjct:  538 AATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSK-------GKEAIIPDCYCHQPCQETNYEVT---------------YSSARW-PSGSAKVMECLPGDFLCLEKYRKNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLIVFA 719          
BLAST of Degenerin unc-8 vs. UniProt/SwissProt
Match: sp|Q09274|UN105_CAEEL (Degenerin-like protein unc-105 OS=Caenorhabditis elegans OX=6239 GN=unc-105 PE=1 SV=3)

HSP 1 Score: 59.6918 bits (143), Expect = 6.879e-8
Identity = 47/205 (22.93%), Postives = 85/205 (41.46%), Query Frame = 2
Query:  977 SSTYLYEG---EYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKGETGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFT 1582
            ++T++Y G     + C +  +QK+ V  C C  P  P+ +M  N  K C   ++   E +      +  +Y K         E  +   Y    C + +Y+V+               Y   +W      K+          L++ R+N A + +     + +   E   Y+ + +++D+GGL GLW+G SVV L EI  ++ F 
Sbjct:  538 AATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSK-------GKEAIIPDCYCHQPCQETNYEVT---------------YSSARW-PSGSAKVMECLPGDFLCLEKYRKNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLIVFA 719          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: S5W2R2 (Asic OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 2.620e-127
Identity = 199/500 (39.80%), Postives = 312/500 (62.40%), Query Frame = 2
Query:   80 LIELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNLIHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPELYYWQSTMSKSKDSIDILYNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGTQRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFVQFRNNIPCHTFQIEKSKIFNSSSIHTLFFFINLNYPSYQVFNSSYISRSSIFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVELYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKGE-TGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVY 1576
            +I+L++++TIHG+ H+++A  K  K LW ++F +G+     N++ I  +++SNP++I++  E+EPF WPD+TFCNPT P+          +W  T++K+K     +   + + Q++++  ++  EL E+++ MS+ DPA L    F+ ++   G+ K+H  +Y ++E++   T      L  +  +LFT+Q VQ RNNIPCHTF ++KS+I     I +L F   LN  SY++FNSSY  +S   Y++ K  +PQ +  I+ PG+ + V ++Q R  +   +  CR   F+ ELYD+ L ST  Y G YDDC+K+VSQ+ YV  CNCY+ FLPI+K  + FP+LC NASIFS  ++L+NA CM N + KY+++   +      C  Y+ + CN   YK+   KEI+V+L S   N R  + +K  Y K F       +++++ ++NI  L + R + SGDLY E+ EY  S+L+SD+GGLMGLWLGLSV+GLFEI + VY
Sbjct:    1 MIDLIQSSTIHGIGHIFSATNKIFKVLWCILFLVGVIAIIVNIVFISMKFLSNPVIISYTFEHEPFIWPDITFCNPTDPYAFTINSQPYLHWIETLNKTKRVAGKVARQTSMSQLIHSRRENDYELEERTIAMSSADPAKLQATAFQNYLYRIGYIKAHKGLYFSKEFQSSST-----KLNEDWKSLFTSQIVQMRNNIPCHTFHLDKSRIVKQKFIKSLLFRFKLNEESYKIFNSSYTFQSMFLYISNKDEIPQSNEIILTPGYNNVVQLTQNRHSYTGLRRTCRNEKFEAELYDSLLQSTEKYSGSYDDCKKIVSQQKYVKYCNCYNSFLPIFKNSSGFPRLCLNASIFSEAEVLKNAKCMINTFRKYAESDKARRRFYNRCKMYRPIPCNKVLYKIDHRKEILVDLWSKSTNDRRREIIKTLYLKTFQTNETSLDFVEKVKDNIMQLIINRDNESGDLYKEEREYPFSELLSDVGGLMGLWLGLSVIGLFEIVEFVY 495          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: A0A5J4NUF1 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0013022 PE=3 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 6.575e-85
Identity = 173/541 (31.98%), Postives = 279/541 (51.57%), Query Frame = 2
Query:   68 YDLALIELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNLIHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPELYYWQSTMSKSKDSIDILYNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGTQRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFVQFRNNIPCHTFQIEKS-KIFNSSSIHTLFFFINLNYPSYQVFNSSYISRSSIFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVELYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPI-----YKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKG--ETGVCSKYKAVKCNDYSYKVSS-NKEIMVELNSGGLNYRMDQWMKKAYTKLFNR-----------------TRVKSN-----YLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFTIFKVL 1597
            + + +  LLE++T+HGL+HV TA  K  +  W  +   GIAGF  NL  II RY++ P+L ++  E E F WPD+T CN  AP+ L      +  WQ+  +++      L  +S +F  +++   D++E+A +++M ST+ P   G    E+ + F      +  + LT E     T     +L   +   F TQ +Q R N+PC+T Q+  S     S+ ++++   +  N  SY++ NSSY S     +++  G+ P DD   +LPG+T  + +  +R + E  +  CR   +  E++D  L +     G    C ++VSQ +Y++ C+CYSPFLP      +K+ +    LCFN S FS  ++  NA CM  +YE+Y  +S      E   C +++   C+D  YK+S   +  MVEL S   N     ++  ++  LF+                     K N      L+  R+N   L+V R S  G+L  E++EY  S+L+SD+GGLMGLW+G+SV+GLFEI ++  F I   +
Sbjct:   23 FHVGVERLLEHSTVHGLSHVSTAATKLGRITWFCLLLAGIAGFFTNLSFIIDRYLTRPVLTSYISEYEGFIWPDITLCNAMAPYSLHL-HGRIPKWQALRNQASAFAQKL--NSSLFASIDS--QDQNEIAIQALMYSTLSPPEYGVGEPEEFIQFVATDVGYQGIILTVEISGNMT-----HLNPPLKKYFHTQVLQKRYNVPCYTLQLRHSLTAVQSNQVNSIGLGVKFNVESYRIINSSYASPYIDLFISHPGHAPHDDPIEMLPGYTLSLSLRMSRLRREPARLSCRTDFYTTEVFDPDLVTKRRVNGSATFCHRIVSQHLYLNSCHCYSPFLPYPVVYNHKLFSKMAILCFNMSRFSVAQINRNADCMLRIYERYQLSSVYNSVPEARACEQFRKPLCDDVEYKLSDIRRTAMVELWSNSYNEARIAFLTSSFQNLFSSDIPPEQLVSWLDSDTKDDNTKDNDSMPKILKYMRDNFGLLSVNRKSELGELVREELEYPLSELMSDVGGLMGLWIGISVIGLFEIVELCGFAIMTAV 553          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: A0A4S2L913 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009406 PE=3 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 8.044e-84
Identity = 178/551 (32.30%), Postives = 287/551 (52.09%), Query Frame = 2
Query:   86 ELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNLIHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPELYYWQSTMSKSKDSIDIL--YNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGTQRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFVQFRNNIPCHTFQIEKSKIFNSSS-IHTLFFFINLNYPSYQVFNSSYISRSSIFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVELYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPIYKME-----NNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKG--ETGVCSKYKAV-KCNDYSYK-VSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQES--------------RENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFTIFKVLFLCFNAICKEEEPHPQDQNIA 1660
             LLE++T+HGL+HV +A     +  W V+F  GI GF  NL  I+ RY+S P+L + F +++ F WPD+T CNP+AP+++      LY       + +D    +  Y  S++F  ++    DK E+  +++M ST+ P+  G     + V F      H  + LT E      D     L   +   F T  +Q R NIPC+T QIE+    +    +  +   +  N  S+ + N+SY+S +  F +++ G++P D+   +LPG+ H + ++  RF+ E +K PCR   F VE++DA L++ Y   G    C +++SQ +Y+  C CYSPFLP   +      ++ P LCFN S F  E++ +NA CM+N+ EKY    T     E   C    +V  C D  ++ + + +  + EL S   N     ++K A+  +F    +  N L +S              REN A +T+ R    G+L  E +EY  ++L+SDIGGLMGLW+G+SV+GLFE+ +++      V+     A  + + P  Q++N A
Sbjct:   71 RLLEHSTVHGLSHVSSASSHVGRITWFVLFVAGITGFCINLSLIVSRYVSRPVLTSIFNDHDDFVWPDITICNPSAPYVVH-----LYDRHEKWLRLRDWAKNVAQYIPSELFAAID--EADKVEIKTQALMHSTMSPSDFGVGIPNETVNFVAADTGHYGIVLTVEL-----DGNLTYLSAPMEQYFRTHILQKRYNIPCYTLQIEQGMPEDERKRVRKVALGLKFNIESHMIINTSYVSPTLDFIISRPGHMPHDEPIELLPGYMHYIGLNFQRFKREPSKRPCRNNVFDVEVFDANLATKYPVHGSATLCHRILSQNLYIKYCGCYSPFLPYPVIPSHPDFDDSPVLCFNMSRFKIEQLNQNAKCMFNLLEKYRDPVTYMNIPEARECEYLGSVPPCEDIEHQLIQTRRTPLWELWSEKYNDARLSFLKAAFQLVFE-VDIVQNRLGKSFHINNDSEPALRYLRENFALITIERKVEKGELIREDLEYPLAELLSDIGGLMGLWIGISVIGLFEVLELLGLMSVTVVEW-LTAHLRSKLPIRQNRNTA 607          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: A0A183A5V1 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2336 PE=3 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 3.408e-83
Identity = 165/537 (30.73%), Postives = 284/537 (52.89%), Query Frame = 2
Query:   62 RKYDLALIELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNLIHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPELYYWQSTMSKSKDSIDILYNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGTQRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFVQFRNNIPCHTFQIEKSKIFNSS---SIHTLFFFINLNYPSYQVFNSSYISRSSIFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVELYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNF-----PKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKG--ETGVCSKYKAV-KCNDYSYKVSS-NKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQES-------------RENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFTIFKVL 1597
            +K+ L +  LLE++T+HGL+HV TA  +  + +WL+++  G+AGF  NL  I+ RYM+ P+L ++  ++E F WPD+T CNP AP+ +        + +  +  ++ + +I   S  +F  ++    ++ E+A ++++ ST+ P   G    ++ + F    K    ++LT E     TD     L    +  F  Q +Q R+NIPC+T Q+  + + +     S + +   +  N+ S+ + NSSY  R+   +++  G+ P+D+   +L G+TH+V +S TRF  E  + PCR   F  +++DA L +     G  D C K+VSQ++Y++ C CYSPFLP   ++ +      P LCFN S F+   + +NA CMY+VY +Y  +S      E   C  +++   C   SY   S  +  ++EL S  +N     ++   +  +F     +    Q               R N   +T+ R    G L  E++EY  S+L+SD+GGLMGLW+G+SV+GLFE+ +++ F    ++
Sbjct:   24 QKFYLGVRRLLEHSTVHGLSHVSTASSRIGRSIWLILWLAGVAGFFTNLSFIVSRYMTRPVLTSYKHDHESFIWPDITLCNPMAPYPVHLRNRTEKWNELRLRATRVAKNI---SEDLFAAIDDA--EQLEIAIQALLYSTISPEQFGVGEPQELIQFVAADKGRSGIHLTVEMYSTFTD-----LDAPKTQYFHAQMLQKRHNIPCYTLQL--AHVLSQEDCLSTNQVSLGLKFNHDSFLIINSSYAPRNIDLFISLPGHFPEDESMELLSGYTHKVSVSMTRFIREPNRLPCRTDEFVAQMFDANLKTRREIVGSADFCHKLVSQRLYINNCGCYSPFLPYPVVDEHLLVHGQPVLCFNMSHFNITSIDQNAKCMYDVYTQYHDHSVYMNLPEAQYCETFRSTPPCESTSYMPESLRRTPIIELWSDTINEGRTAFLTSTFESVFGPDLPEERIRQLLNNSGNNSNMFTYMRNNFGMVTISRKFPRGTLTHEELEYPLSELLSDLGGLMGLWIGISVIGLFEVVELLAFVSLSMI 548          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: A0A4E0RSD9 (Degenerin unc-8 OS=Fasciola hepatica OX=6192 GN=D915_000009 PE=3 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 8.398e-80
Identity = 167/542 (30.81%), Postives = 281/542 (51.85%), Query Frame = 2
Query:   62 RKYDLALIELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNLIHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPE-----LYYWQSTMSKSKDSIDILYNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGTQRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFVQFRNNIPCHTFQIEKSKIFNS---SSIHTLFFFINLNYPSYQVFNSSYISRSSIFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVELYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNF-----PKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKG--ETGVCSKYKAV-KCNDYSYKVSSNKEI-MVELNSGGLNYRMDQWMKKAYTKLFNRT----RVK---------SNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFTIFKVL 1597
            RK+ L +  LLE++T+HGL+HV TA  +  + +WL+++  G+AGF  NL  I+ RYM+ P+L ++  ++E F WPD+T CNP AP+ +           L+   + +S++         S  +F  ++    ++ E+  ++++ STV P   G     + V F    K    ++LT E      D    NL       F  Q +Q R NIPC+T ++++  + N    +S   +   +  N+ S  + NSSY   +   +++  G++P+D+   IL G++H+V ++  RF  E T+ PCR   F  +++DA L +     G  D C K++SQ++Y+  C CYSPFLP   M  +      P LCFN S F+A  +  NA CMY+VY ++ ++       E G C  ++A   C   +Y + S +   ++E  +  +N     ++   +  +F +     R+K         S+ L   R N   + + R    G L  E++EY  S+L+SD+GGLMGLW+G+SV+GLFE+ ++  F    V+
Sbjct:   25 RKFYLGVRRLLEHSTVHGLSHVSTAGTRIGRSVWLILWMAGVAGFFTNLSFIVSRYMTRPVLTSYKHDHELFIWPDITLCNPMAPYPVHLNNRSEKWNLLHQLATAVSRNI--------SGNLFATID--EAEQEEVTVQALIHSTVSPMEFGANDPHELVHFVAVDKGQTGIHLTIEM-----DATFTNLDIPKHRYFHVQVLQKRYNIPCYTLRLDQ--VLNEEECASTKQVSLGLKFNHDSNLIINSSYAPFNIDLFISLPGHMPEDEPMEILSGYSHKVTVTMGRFTRERTRLPCRTEQFVTQVFDADLKTQREVVGSADFCLKLLSQRLYIDHCGCYSPFLPYPVMGQDHPLYQQPVLCFNMSHFNASGIDRNARCMYDVYTQFKEDFVYMNLPEAGYCETFRATPPCESINYVLESPRRTPIIEFWADTVNEARSAFVTSTFESVFGQDLPEERLKQMVNNSGNTSSLLFYMRNNFGLVKITRKLPRGTLTHEELEYPLSELLSDVGGLMGLWVGISVIGLFEVVELFAFVGLTVI 549          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000022995.1 (SMESG000022995.1)

HSP 1 Score: 1125.15 bits (2909), Expect = 0.000e+0
Identity = 540/540 (100.00%), Postives = 540/540 (100.00%), Query Frame = 2
Query:   59 MRKYDLALIELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNLIHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPELYYWQSTMSKSKDSIDILYNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGTQRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFVQFRNNIPCHTFQIEKSKIFNSSSIHTLFFFINLNYPSYQVFNSSYISRSSIFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVELYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKGETGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFTIFKVLFLCFNAICKEEEPHPQDQNIALNEDNL 1678
            MRKYDLALIELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNLIHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPELYYWQSTMSKSKDSIDILYNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGTQRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFVQFRNNIPCHTFQIEKSKIFNSSSIHTLFFFINLNYPSYQVFNSSYISRSSIFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVELYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKGETGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFTIFKVLFLCFNAICKEEEPHPQDQNIALNEDNL
Sbjct:    1 MRKYDLALIELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNLIHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPELYYWQSTMSKSKDSIDILYNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGTQRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFVQFRNNIPCHTFQIEKSKIFNSSSIHTLFFFINLNYPSYQVFNSSYISRSSIFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVELYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKGETGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFTIFKVLFLCFNAICKEEEPHPQDQNIALNEDNL 540          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000022997.1 (SMESG000022997.1)

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 260/514 (50.58%), Postives = 357/514 (69.46%), Query Frame = 2
Query:   59 MRKYDLALIELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNLIHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPELYYWQSTMSKSKDSIDILYNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGTQRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFVQFRNNIPCHTFQIEKSKIFNSSSIHTLFFFINLNYPSYQVFNSSYISRSSIFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVELYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNST-IKGETGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFTIFKVL 1597
            M  YD  L+ELL+NTTIHGLNHVYTA+ + +K LW  +F +G+ GF  NL+ II+RY+SNPIL+++F++NE F WPDLTFCNP+APF L+     L +++S +  S ++I  L N S +FQ  N F     E  E SV+MS++D A L  + + K + F+G+SKSH ++YL ++Y R+ TD V E + N    LF+TQFVQ RNN+PCHTFQI +SK+ + ++IH+L FFIN+N+PSY++FNSSY+SRS   Y+T+K  LPQ+   II PG+  EV ++QTRF   + KN CR   FQVELYD     T LYEG Y+DCRK++SQ++YV  CNCY+PFLPI+K    FPKLCFN SIFS   +L NA CM+ V + +S +S  +      C +Y  +KCND  Y     +E+ VEL    +N R ++W++ AY KLF R     +Y++E +ENI  +T++R S  G L  E++EYS+SDL+SDIGGLMG WLGLSVVGLFEIG ++YF + ++L
Sbjct:    1 MLNYDEILVELLQNTTIHGLNHVYTARIRTSKILWFFLFLIGLCGFFINLVGIIQRYLSNPILVSNFVDNENFSWPDLTFCNPSAPFSLDNSSIALMHYKSVLKNSTNTIKKLLNESLLFQ--NVFKIIDEEFEELSVVMSSMDYATLKVEDYNKTIKFHGYSKSHSDIYLYKQYNRHATDIVME-MENY---LFSTQFVQMRNNVPCHTFQIGRSKLIDFNTIHSLLFFININHPSYKIFNSSYLSRSVFLYITRKDNLPQNGEIIISPGYNTEVSVTQTRFIINKLKNSCRHKIFQVELYDVLFQKTNLYEGNYEDCRKILSQELYVKHCNCYNPFLPIFKSNLGFPKLCFNTSIFSELDILGNAQCMFMVMKNFSNSSIYLSLVERRCGQYYPMKCNDTLYTSEYQRELWVELLQKHVNERTNKWLQMAYIKLFGRDWNGRDYVKEIQENIGIVTIKRMSRFGGLVKEELEYSYSDLLSDIGGLMGFWLGLSVVGLFEIGGMIYFLLLRIL 508          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000022999.1 (SMESG000022999.1)

HSP 1 Score: 514.612 bits (1324), Expect = 9.119e-178
Identity = 250/507 (49.31%), Postives = 347/507 (68.44%), Query Frame = 2
Query:   80 LIELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNLIHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPELYYWQSTMSKSKDSIDILYNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGTQRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFVQFRNNIPCHTFQIEKSKIFNSSSIHTLFFFINLNYPSYQVFNSSYISRSSIFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVELYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNST-IKGETGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFTIFKVL 1597
            L+ELL+NTTIHGLNHVYTA+ + +K LW  +F +G+ GF  NL+ II+RY+SNPIL+++F++NE F WPDLTFCNP+APF L+     L +++S +  S + I+IL N S +F+    F   + E  E SV+MS++D A L  + + K + F+G+SKS  ++Y  +++ +Y T+ +  N     + LF+TQFVQ RNNIPCHTFQ+ KSK  + +SIH+L F++NLN+PSY++FNSSYI RS   Y+T+K  LPQ    II PG + EV ++QTRF   + K PCR   FQVELYD     T LYEG Y+DCRK++SQ++YV  CNCY+PFLPI+K    FPKLCFN SIFS   +L NA CM+ V + +S +S  +      C +Y  +KCND  Y   S KE+ VEL    +N RM  W+K+ Y ++F++     +Y+++ ++NI F+T+ R S  G    E+ EYS SDL+SDIGGLMG WLGLSVVGLFEIG ++YF + K+L
Sbjct:   24 LVELLQNTTIHGLNHVYTARIRTSKILWFFLFLIGLCGFFINLVGIIQRYLSNPILVSNFVDNENFSWPDLTFCNPSAPFSLDNSSIALMHYKSVLENSSNIINILTNRSPLFK--RGFRTIRGEFEELSVVMSSMDYATLKVEDYNKTINFHGYSKSSSDIYFYKDFSQYSTNLITTNE----NQLFSTQFVQMRNNIPCHTFQLGKSKSLDFNSIHSLSFYVNLNHPSYRIFNSSYIQRSIFLYITRKDNLPQKGEIIISPGHSTEVSVTQTRFIINKLKKPCRHKIFQVELYDVLFQKTNLYEGNYEDCRKILSQELYVKHCNCYNPFLPIFKNNLGFPKLCFNTSIFSELDILGNAQCMFMVMKNFSNSSIYLSLVERRCGQYYPMKCNDTIYTCKSRKELWVELVQKHMNDRMKDWLKRVYMQIFHQHWSGRDYMRDIQQNIGFVTITRMSKFGGFVKEESEYSCSDLLSDIGGLMGFWLGLSVVGLFEIGGMIYFLLLKIL 524          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000022994.1 (SMESG000022994.1)

HSP 1 Score: 487.649 bits (1254), Expect = 2.253e-166
Identity = 260/522 (49.81%), Postives = 358/522 (68.58%), Query Frame = 2
Query:   38 IQKRNIFMRKYDLALIELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNLIHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPELYYWQSTMSKSKDSIDILYNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGTQRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFVQFRNNIPCHTFQIEKSKIFNSSSIHTLFFFINLNYPSYQVFNSSYISRSSIFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVELYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTI-KGETGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFTIFKVLF 1600
            + +++I M KY+  L  LL+++TIHGLNHVYTA  + +K LWL +F LG  GF FNL+ I++RY+SNPILI+H ++NEPF WPDLTFCNPTAPF L +      +W++T+ KSKD + +L + S++F+I+  F+   +EL E +V MST DP  L +  F+ +V+FYG++  H  VYL +EY    T    E   N++   F+TQ+VQ RNNIPCHTFQI+KSK      ++++ F I  NYPSY +FNSSYI RS   Y+T    LPQ D  +ILPGF +E+ I QTR+ H   K  CR   +QVELYDA L+ST ++EG+++DCRK+ SQK+YV+KC CYSPFLPIYK E +FPKLC N SIF+ E++L NA CM +V+E Y +     K E   C+KYK VKCN+  YK    KE+ +EL S   N R   +++  Y  LFNR     ++++E R+++A L ++R+S  GD Y E+ EY  S+LISD+GGLMGLWLGLSVVG+FEI + +Y  +F++ F
Sbjct:    1 MNEKDIIMEKYNKTLSGLLKHSTIHGLNHVYTANSRISKILWLFLFLLGFCGFFFNLVFIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSNSAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTMSTADPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGT----EVDSNDLKQFFSTQYVQIRNNIPCHTFQIDKSKTLKKVDLNSVMFVIRFNYPSYVIFNSSYIFRSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKF 518          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000017678.1 (SMESG000017678.1)

HSP 1 Score: 424.091 bits (1089), Expect = 1.194e-142
Identity = 209/528 (39.58%), Postives = 319/528 (60.42%), Query Frame = 2
Query:   80 LIELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNLIHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPELYYWQSTMSKSKDSIDILYNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGTQRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFVQFRNNIPCHTFQIEKSKIFNSSSIHTLFFFINLNYPSYQVFNSSYISRSSIFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVELYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKGETGV-CSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFTIFKVLFLCFNAICKEEEPHPQDQNIA 1660
            +IE+L+++TIHG++H++ AK + TK LW+ +F  GI G   N++ +I +Y SNP+LI+H +++EPF WPD+TFC PTAP+   +      +W     +++  ++ L N +++F+I+N   +   EL E+++ MS+ DP  L T  F  H+M   F+K    +Y   +          E+L+     LFT   VQ RNNIPC TF I+KSK  N + I ++ F++  N  SY +FNSSY+ RS   Y+T +  +P  +  ++ PGF + V +SQ+R+++      CR   F+ ELYD  L ST  +EG YDDC+KV SQK++V  C CYSPFLPIYK E   P++C NA+ +S ++++ NA CM +VY K+      +    + C  Y+ +KCN+  YK+  +KE+ VE  SG  N R ++ +KK    L  +  +K NY +  R+N   +T+ R    GDLY E+ EY  S+L+SDIGGLMGLWLG+SVVGLFEI +++Y  +     LC+    ++      +QN A
Sbjct:    1 MIEILQSSTIHGVSHIHGAKSQITKVLWIFLFIFGIIGIFVNIVFVIIKYFSNPVLISHKLDHEPFIWPDVTFCKPTAPYYFGENSQAYTHWSHVFWRTRRIVERLANETEVFKIINGKRNTDYELEERTIAMSSADPYKLKTNDFRYHIMAIYFNKMQRGIYYHIDNSGIAVTSFAEDLKP----LFTAPLVQIRNNIPCFTFHIDKSKFLNQNQIKSISFYLKFNLESYLLFNSSYLHRSVFLYITNRNGIPHKNEILLAPGFNNIVSLSQSRYEYRGVLRKCRNKIFETELYDGLLQSTSTFEGHYDDCKKVESQKLFVGICKCYSPFLPIYKNETGPPRICLNATFYSEDEIVRNAKCMTDVYTKFQSYKAFRNHYRLKCQDYRFIKCNEVKYKIEKDKELFVEFWSGLTNQRRNELLKKVSYYLMEKFDIK-NYFERMRDNFIGITINREFQKGDLYKEEYEYPFSELLSDIGGLMGLWLGMSVVGLFEIFELMYLYLKN---LCYQTSKQQSNMEKFEQNAA 520          
The following BLAST results are available for this feature:
BLAST of Degenerin unc-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1054.366e-923.41Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1054.366e-923.41Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1054.885e-922.93Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1054.885e-922.93Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1055.408e-922.93Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
back to top
BLAST of Degenerin unc-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q09274|UN105_CAEEL6.879e-822.93Degenerin-like protein unc-105 OS=Caenorhabditis e... [more]
back to top
BLAST of Degenerin unc-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S5W2R22.620e-12739.80Asic OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A5J4NUF16.575e-8531.98Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A4S2L9138.044e-8432.30Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A183A5V13.408e-8330.73Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4E0RSD98.398e-8030.81Degenerin unc-8 OS=Fasciola hepatica OX=6192 GN=D9... [more]
back to top
BLAST of Degenerin unc-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022995.10.000e+0100.00SMESG000022995.1[more]
SMESG000022997.10.000e+050.58SMESG000022997.1[more]
SMESG000022999.19.119e-17849.31SMESG000022999.1[more]
SMESG000022994.12.253e-16649.81SMESG000022994.1[more]
SMESG000017678.11.194e-14239.58SMESG000017678.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006756 ID=SMED30006756|Name=Degenerin unc-8|organism=Schmidtea mediterranea sexual|type=transcript|length=1786bp
ATTATTTCATCCAATTTGTTGAATATTTGTATTTATTATACAAAAAAGGA
ATATATTCATGAGAAAATACGATCTAGCGTTAATCGAACTACTAGAAAAT
ACGACTATCCATGGTCTTAACCATGTTTATACGGCCAAGTTTAAAGCTAC
CAAATGCCTTTGGTTGGTCATGTTTACACTTGGTATTGCCGGATTTTCTT
TCAACCTTATTCACATAATCAAACGCTACATGTCGAATCCAATTCTTATC
ACTCATTTCATTGAAAATGAGCCTTTTTATTGGCCAGATCTAACATTTTG
CAACCCGACGGCTCCATTTATCCTTGAAAAAGGTCAGCCGGAATTATACT
ATTGGCAAAGTACAATGTCAAAATCAAAAGATTCCATTGATATTCTGTAT
AATTCAAGTCAAATATTTCAAATACTTAACACTTTTCACGATGACAAGTC
CGAATTGGCTGAGAAGTCCGTCATGATGTCTACAGTTGATCCTGCCGTAT
TGGGTACCCAGCGTTTTGAGAAACATGTCATGTTCTATGGGTTTTCTAAA
TCCCACCCCGAAGTCTATTTGACTCAAGAATATAAACGATATCCTACAGA
TTTTGTCCATGAAAACTTACGAAATGAAATCTCGAATTTATTTACCACCC
AATTCGTTCAATTTAGAAATAACATCCCATGTCATACTTTTCAAATAGAA
AAGTCTAAGATATTCAACTCTAGCTCCATACATACTCTGTTTTTCTTCAT
CAATCTTAATTATCCTAGTTATCAAGTATTTAACTCAAGCTACATTTCAA
GATCATCAATATTTTATGTAACGAAAAAAGGTTATCTACCCCAAGATGAT
GTGACCATAATTTTGCCAGGATTCACTCATGAAGTCTTGATTTCCCAGAC
TCGGTTTCAACACGAGGAAACAAAAAACCCATGTCGAAAAACCGCTTTTC
AAGTTGAACTTTACGACGCGACTTTGTCTTCAACTTACCTCTACGAAGGC
GAATATGATGATTGCCGAAAAGTCGTGAGTCAAAAGATGTACGTCAGTAA
ATGTAACTGCTACAGCCCATTCCTGCCAATTTACAAAATGGAAAACAATT
TCCCGAAACTTTGTTTTAACGCTTCAATATTTTCTGCAGAAAAGATGTTA
GAAAATGCTTTCTGCATGTATAACGTATATGAAAAATATTCGAAGAATTC
GACAATCAAAGGTGAAACCGGGGTCTGTAGCAAATATAAAGCAGTCAAAT
GCAATGATTATAGTTACAAGGTTTCCTCAAACAAGGAAATAATGGTGGAG
TTGAATTCGGGAGGATTAAATTACAGAATGGACCAGTGGATGAAAAAAGC
GTACACCAAACTATTTAACAGAACACGGGTTAAGAGTAATTATTTACAAG
AATCAAGGGAAAATATAGCCTTTTTAACCGTTAGGCGAGCATCAAGTTCA
GGGGATCTCTATGTAGAGAAAATGGAATACTCTCATTCTGATTTAATATC
CGATATTGGAGGTTTAATGGGACTTTGGTTGGGATTGAGTGTTGTTGGAT
TATTTGAAATTGGGCAAATTGTTTACTTCACCATATTTAAAGTGCTATTT
CTTTGTTTCAATGCGATCTGTAAAGAGGAAGAACCTCATCCTCAAGACCA
AAATATTGCACTGAATGAAGATAACTTGTGAGATTAGTGACATCTATTAA
ACCCATTAGGATGATTTTTAAAATTTATTCGTGTTGTCCAAATTTTTCTT
GTATTTTTCTTTTAATTTGATTTGTGTTGTTTCGTT
back to top

protein sequence of SMED30006756-orf-1

>SMED30006756-orf-1 ID=SMED30006756-orf-1|Name=SMED30006756-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=541bp
MRKYDLALIELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNL
IHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPELYYWQ
STMSKSKDSIDILYNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGT
QRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFV
QFRNNIPCHTFQIEKSKIFNSSSIHTLFFFINLNYPSYQVFNSSYISRSS
IFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVE
LYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPK
LCFNASIFSAEKMLENAFCMYNVYEKYSKNSTIKGETGVCSKYKAVKCND
YSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESR
ENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFE
IGQIVYFTIFKVLFLCFNAICKEEEPHPQDQNIALNEDNL*
back to top
Aliases
The feature 'Degenerin unc-8' has the following synonyms
Synonym
asic
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0035725sodium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 325..342
score: 30.0
coord: 470..484
score: 32.8
coord: 484..500
score: 49.88
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 13..501
e-value: 9.1E-39
score: 133.6
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 13..521
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 285..398
e-value: 2.6E-23
score: 84.6
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 32..501
e-value: 2.6E-23
score: 84.6
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 62..472
e-value: 2.6E-23
score: 84.6
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 84..249
e-value: 2.6E-23
score: 84.6
NoneNo IPR availablePANTHERPTHR11690:SF222PICKPOCKET 6-RELATEDcoord: 13..521
NoneNo IPR availableTMHMMTMhelixcoord: 33..54
NoneNo IPR availableTMHMMTMhelixcoord: 488..510