Tetratricopeptide repeat domain 16

Overview
NameTetratricopeptide repeat domain 16
Smed IDSMED30006754
Uniprot Best hitTetratricopeptide repeat protein 16 OS=Mus musculus OX=10090 GN=Ttc16 PE=2 SV=1 (E=2.13146e-95)
Length (bp)2750
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetratricopeptide repeat domain 16 (SMED30006754) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetratricopeptide repeat domain 16 (SMED30006754) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetratricopeptide repeat domain 16 (SMED30006754) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetratricopeptide repeat domain 16 (SMED30006754) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006754

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006754SMESG000020147.1 SmedASXL_015924SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30006754SMESG000020147.1 dd_Smed_v6_11894_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30006754SMESG000020147.1 dd_Smed_v4_11894_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30006754SMESG000020147.1 dd_Smed_v4_11894_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30006754SMESG000020147.1 dd_Smed_v4_11894_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30006754SMESG000020147.1 dd_Smed_v4_11894_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Human
Match: TTC16 (tetratricopeptide repeat domain 16 [Source:HGNC Symbol;Acc:HGNC:26536])

HSP 1 Score: 309.686 bits (792), Expect = 5.228e-91
Identity = 168/453 (37.09%), Postives = 259/453 (57.17%), Query Frame = 2
Query:  500 RASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIK 1858
            +  E Y+ G   L+  +W  A+  F+  +HL P+   +Y  RAE +LQL DF SA  N +RA  L   N +   RL F+   Q Q LF+Q  F  AL     A E+ P  P +  R +ACL AL +H  CL L+  ++ ++ +N D ++ RA+L++  +   LCY DL  AL L+  H +A+ +L  M +QA   +  +  LA+  +LQ A+ +I+ AI+ NP+     + RG  YRRL+ F  A++DF+  +D V  D+E D  +QAQRQ +LT+NDFAV C+ +  + + + LLNKA++ E+ E   YINRGDCFF+L    FA ADYQQA +LS +       R+  +   +G  +    QF++AE   S +I++NP  A ++  RAK R +L    GAR+D+   +LL+     +      LFP  S+  VL +++A  AR +L+Q+++
Sbjct:   60 KVREYYSRGQQCLEQADWETAVLLFSRALHLDPQLVDFYALRAEAYLQLCDFSSAAQNLRRAYSLQQDNCKHLERLTFVLYLQGQCLFEQCAFLDALNVFSHAAELQPEKPCFRYRCMACLLALKQHQACLTLITNELKQDTTNADVYIFRARLYNFLQKPHLCYRDLHSALLLNPKHPQARMLLQKMVAQAQQARQDAGILAVQGKLQHALQRINRAIENNPLDPSLFLFRGTMYRRLQEFDGAVEDFLKVLDMVTEDQE-DMVRQAQRQLLLTYNDFAVHCYRQGAYQEGVLLLNKALRDEQQEKGLYINRGDCFFQLGNLAFAEADYQQALALSPQDEGAN-TRMGLLQEKMGFCEQRRKQFQKAENHFSTAIRHNPQKAQYYLYRAKSRQLLQNIFGARQDVATVLLLNPKQPKLSLLMTNLFPGMSVEEVLSTQIAHLARLQLEQMVE 510          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Human
Match: TTC6 (tetratricopeptide repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:19739])

HSP 1 Score: 58.5362 bits (140), Expect = 4.612e-8
Identity = 98/460 (21.30%), Postives = 180/460 (39.13%), Query Frame = 2
Query:  515 YAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGN-EEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLAL----VNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVL----------------------TSMASQANDLKTQSIELALY--NRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTA---AIDDFIMAMDKVDHDEENDTY----------KQAQRQFILTFNDF-----------------AVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDL 1717
            Y +G+  ++ GN   A   FT  +   P     +  R    ++L    S+IL++ RA  L+P + + + +R+AF  +        +G +S A+ +  KAI++ P +    +RA      L  +++   L    +   I  + ++   F  RA  ++  R   +   D    L LD+      N                         ++ S+ N     +  +  +  N  +EA+N  + A+ +NP   D +V RG  Y    +  A   A  DF+ A+        N  Y           QAQ +F   +N F                 AV C +      +++ +N A++   +  +F  NRG     +   Q A+ DYQ A +L+         + +  +F+ G   F   QF +A    S+++K +P        RA    +L +++ A++D 
Sbjct:   88 YNLGLCYMEEGNLQMAFDSFTKAVKANPDFAESFYQRGLCKVKLHK-DSSILDFNRAITLNPKHYQAYLSRVAFYGL--------KGRYSKAILNCNKAIKIYPES----VRAYLYRGVLKYYNKTYKLAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKAL------HINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKIS-TTAEFLTNRGVIHEFMGHKQNAMKDYQDAITLNP--------KYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDF 519          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Human
Match: TTC6 (tetratricopeptide repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:19739])

HSP 1 Score: 58.5362 bits (140), Expect = 6.818e-8
Identity = 98/460 (21.30%), Postives = 180/460 (39.13%), Query Frame = 2
Query:  515 YAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGN-EEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLAL----VNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVL----------------------TSMASQANDLKTQSIELALY--NRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTA---AIDDFIMAMDKVDHDEENDTY----------KQAQRQFILTFNDF-----------------AVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDL 1717
            Y +G+  ++ GN   A   FT  +   P     +  R    ++L    S+IL++ RA  L+P + + + +R+AF  +        +G +S A+ +  KAI++ P +    +RA      L  +++   L    +   I  + ++   F  RA  ++  R   +   D    L LD+      N                         ++ S+ N     +  +  +  N  +EA+N  + A+ +NP   D +V RG  Y    +  A   A  DF+ A+        N  Y           QAQ +F   +N F                 AV C +      +++ +N A++   +  +F  NRG     +   Q A+ DYQ A +L+         + +  +F+ G   F   QF +A    S+++K +P        RA    +L +++ A++D 
Sbjct: 1374 YNLGLCYMEEGNLQMAFDSFTKAVKANPDFAESFYQRGLCKVKLHK-DSSILDFNRAITLNPKHYQAYLSRVAFYGL--------KGRYSKAILNCNKAIKIYPES----VRAYLYRGVLKYYNKTYKLAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKAL------HINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTTA-EFLTNRGVIHEFMGHKQNAMKDYQDAITLN--------PKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDF 1805          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Human
Match: DNAJC7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:HGNC Symbol;Acc:HGNC:12392])

HSP 1 Score: 55.8398 bits (133), Expect = 9.664e-8
Identity = 35/137 (25.55%), Postives = 68/137 (49.64%), Query Frame = 2
Query:  548 NWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFL-YVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRA 955
            ++ +A +++T  I + PK  SYY NRA   + L  F+ A+ + +++  LD     F N  A + Y   ++  F++  F   +  + +A+E  P    + I    CLA L R+ E  ++ +  +  +++N D   +R 
Sbjct:   43 DYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRG 179          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Human
Match: TTC6 (tetratricopeptide repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:19739])

HSP 1 Score: 51.6026 bits (122), Expect = 6.020e-6
Identity = 93/436 (21.33%), Postives = 169/436 (38.76%), Query Frame = 2
Query:  515 YAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGN-EEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLAL----VNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVL----------------------TSMASQANDLKTQSIELALY--NRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTA---AIDDFIMAMDKVDHDEENDTY----------KQAQRQFILTFNDF-----------------AVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAE-IALSESIKNNPF 1642
            Y +G+  ++ GN   A   FT  +   P     +  R    ++L    S+IL++ RA  L+P + + + +R+AF  +        +G +S A+ +  KAI++ P +    +RA      L  +++   L    +   I  + ++   F  RA  ++  R   +   D    L LD+      N                         ++ S+ N     +  +  +  N  +EA+N  + A+ +NP   D +V RG  Y    +  A   A  DF+ A+        N  Y           QAQ +F   +N F                 AV C +      +++ +N A++   +  +F  NRG     +   Q A+ DYQ A +L+         + +  +F+ G   F   QF + E + L+ S+  + F
Sbjct:  105 YNLGLCYMEEGNLQMAFDSFTKAVKANPDFAESFYQRGLCKVKLHK-DSSILDFNRAITLNPKHYQAYLSRVAFYGL--------KGRYSKAILNCNKAIKIYPES----VRAYLYRGVLKYYNKTYKLAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKAL------HINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMK-ISTTAEFLTNRGVIHEFMGHKQNAMKDYQDAITLNP--------KYSLAYFNAGNIYFHHRQFSQEESLGLAWSLSLDSF 512          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0080866)

HSP 1 Score: 56.9954 bits (136), Expect = 6.613e-8
Identity = 61/285 (21.40%), Postives = 107/285 (37.54%), Query Frame = 2
Query:  395 TEENSELSNGINFMPKSWTSKGLHSLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQIL---------------------------------------FDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEA 1132
            T  NSE+   I     +   K    +P     +   A EK  +G    K+ N+ +A+  +T  I L P   +YY NRA  ++ L ++ SA+ + + A  +DPG E+ + R+A   +    I+                                       +D   + + +  +  A+++ P    Y +    CLA L R  E L +    +  + ++ D   +R     +  N          AL LD  H ++K  + S   Q  ++K     L    R +EA
Sbjct:   16 TSSNSEMDVEITTEQPTIDVKAEQIVPKDAATI---AEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATIQANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQ-MRSKCKQLKEMKENGNMLFKSGRYREA 296          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0333487)

HSP 1 Score: 56.9954 bits (136), Expect = 6.613e-8
Identity = 61/285 (21.40%), Postives = 107/285 (37.54%), Query Frame = 2
Query:  395 TEENSELSNGINFMPKSWTSKGLHSLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQIL---------------------------------------FDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEA 1132
            T  NSE+   I     +   K    +P     +   A EK  +G    K+ N+ +A+  +T  I L P   +YY NRA  ++ L ++ SA+ + + A  +DPG E+ + R+A   +    I+                                       +D   + + +  +  A+++ P    Y +    CLA L R  E L +    +  + ++ D   +R     +  N          AL LD  H ++K  + S   Q  ++K     L    R +EA
Sbjct:   16 TSSNSEMDVEITTEQPTIDVKAEQIVPKDAATI---AEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATIQANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQ-MRSKCKQLKEMKENGNMLFKSGRYREA 296          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0333486)

HSP 1 Score: 55.0694 bits (131), Expect = 2.092e-7
Identity = 58/260 (22.31%), Postives = 101/260 (38.85%), Query Frame = 2
Query:  503 ASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQIL---------------------------------------FDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEA--INKISLAID 1159
            A EK  +G    K+ N+ +A+  +T  I L P   +YY NRA  ++ L ++ SA+ + + A  +DPG E+ + R+A   +    I+                                       +D   + + +  +  A+++ P    Y +    CLA L R  E L +    +  + ++ D   +R     +  N          AL LD  H ++K  + S   Q  ++K     L    R +EA  I   +L ID
Sbjct:   19 AEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATIQANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQ-MRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKID 277          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0080867)

HSP 1 Score: 55.0694 bits (131), Expect = 2.263e-7
Identity = 58/260 (22.31%), Postives = 101/260 (38.85%), Query Frame = 2
Query:  503 ASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQIL---------------------------------------FDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEA--INKISLAID 1159
            A EK  +G    K+ N+ +A+  +T  I L P   +YY NRA  ++ L ++ SA+ + + A  +DPG E+ + R+A   +    I+                                       +D   + + +  +  A+++ P    Y +    CLA L R  E L +    +  + ++ D   +R     +  N          AL LD  H ++K  + S   Q  ++K     L    R +EA  I   +L ID
Sbjct:    5 AEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATIQANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQ-MRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKID 263          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0333488)

HSP 1 Score: 55.0694 bits (131), Expect = 2.263e-7
Identity = 58/260 (22.31%), Postives = 101/260 (38.85%), Query Frame = 2
Query:  503 ASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQIL---------------------------------------FDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEA--INKISLAID 1159
            A EK  +G    K+ N+ +A+  +T  I L P   +YY NRA  ++ L ++ SA+ + + A  +DPG E+ + R+A   +    I+                                       +D   + + +  +  A+++ P    Y +    CLA L R  E L +    +  + ++ D   +R     +  N          AL LD  H ++K  + S   Q  ++K     L    R +EA  I   +L ID
Sbjct:    5 AEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATIQANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQ-MRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKID 263          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Zebrafish
Match: ttc16 (tetratricopeptide repeat domain 16 [Source:ZFIN;Acc:ZDB-GENE-141219-15])

HSP 1 Score: 308.916 bits (790), Expect = 1.727e-95
Identity = 166/426 (38.97%), Postives = 254/426 (59.62%), Query Frame = 2
Query:  488 ILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYK----------QAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILL 1735
            I+  +A + Y  G++++    +  A+S F+  I L+P +  +YV RAE +LQL DFQSA L+YK A  L+P  E +  RLAF++  Q Q LFD G+F  ALES  KA E+ P    Y +R++ACL+AL R+ +CL LVN  ++ +  + D F LRA+LH      +LC +DL  AL++     EA  +L  +   A +    +++ AL   L EA+ KI+ A++  P    Y++ RG  YRRLK+FTAAI+D ++A++    +EE+   K          +AQ Q +LT+NDFA++CF +  + +++ LLNKAI+ ++   + +INRGD FFK  +W FALADYQQA  L  E   + L R+A +H ++G Q +E  +F+EA    S +IK NP    ++  RAK    L + + A+ D I  ++L
Sbjct:   16 IIKEKAEKHYETGIISMAHSQFDKAVSCFSKAIVLQPHKTQFYVQRAEAYLQLCDFQSAALDYKHARRLEPQTEAYHQRLAFIHYLQGQCLFDLGNFLEALESFTKAAELKPDFQPYRMRSLACLSALGRYFDCLRLVNNWLETDGLSADLFTLRARLHHQLNQMTLCCHDLKSALSMKPCCPEALALLGRLKEAAEESHQAAVDKALKGELSEALGKINSAMEFIPNKAQYYLFRGILYRRLKDFTAAIEDLVLAVEFCGIEEESPQGKPQDDSDGLEEEAQTQMVLTYNDFAIQCFSQGLYSEAVILLNKAIEKQRDASELFINRGDSFFKQCEWTFALADYQQAEELDLENTAIWL-RLAVIHNTLGLQSYEDKKFQEAAERFSVAIKYNPGVVQYYENRAKSFNKLGKTEEAKNDAISVLVL 440          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Zebrafish
Match: ttc16 (tetratricopeptide repeat domain 16 [Source:ZFIN;Acc:ZDB-GENE-141219-15])

HSP 1 Score: 309.301 bits (791), Expect = 8.519e-94
Identity = 166/426 (38.97%), Postives = 254/426 (59.62%), Query Frame = 2
Query:  488 ILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYK----------QAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILL 1735
            I+  +A + Y  G++++    +  A+S F+  I L+P +  +YV RAE +LQL DFQSA L+YK A  L+P  E +  RLAF++  Q Q LFD G+F  ALES  KA E+ P    Y +R++ACL+AL R+ +CL LVN  ++ +  + D F LRA+LH      +LC +DL  AL++     EA  +L  +   A +    +++ AL   L EA+ KI+ A++  P    Y++ RG  YRRLK+FTAAI+D ++A++    +EE+   K          +AQ Q +LT+NDFA++CF +  + +++ LLNKAI+ ++   + +INRGD FFK  +W FALADYQQA  L  E   + L R+A +H ++G Q +E  +F+EA    S +IK NP    ++  RAK    L + + A+ D I  ++L
Sbjct:   24 IIKEKAEKHYETGIISMAHSQFDKAVSCFSKAIVLQPHKTQFYVQRAEAYLQLCDFQSAALDYKHARRLEPQTEAYHQRLAFIHYLQGQCLFDLGNFLEALESFTKAAELKPDFQPYRMRSLACLSALGRYFDCLRLVNNWLETDGLSADLFTLRARLHHQLNQMTLCCHDLKSALSMKPCCPEALALLGRLKEAAEESHQAAVDKALKGELSEALGKINSAMEFIPNKAQYYLFRGILYRRLKDFTAAIEDLVLAVEFCGIEEESPQGKPQDDSDGLEEEAQTQMVLTYNDFAIQCFSQGLYSEAVILLNKAIEKQRDASELFINRGDSFFKQCEWTFALADYQQAEELDLENTAIWL-RLAVIHNTLGLQSYEDKKFQEAAERFSVAIKYNPGVVQYYENRAKSFNKLGKTEEAKNDAISVLVL 448          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Zebrafish
Match: CABZ01060936.1 (tetratricopeptide repeat protein 16-like [Source:NCBI gene;Acc:100330990])

HSP 1 Score: 122.479 bits (306), Expect = 2.301e-31
Identity = 61/129 (47.29%), Postives = 83/129 (64.34%), Query Frame = 2
Query:  578 HCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLH 964
            H +H    +  +YV RAE +LQL DFQSA L+YK A  L+P  E +  RLAF++  Q Q LFD G+F  ALES  KA E+ P    Y +R++ACL+AL R+ +CL LVN  ++ +  + D F LRA+LH
Sbjct:   25 HILHSHYPQTQFYVQRAEAYLQLCDFQSAALDYKHARRLEPQTEAYHQRLAFIHYLQGQCLFDLGNFLEALESFTKAAELKPDFQPYRMRSLACLSALGRYFDCLRLVNNWLETDGLSADLFTLRARLH 153          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Xenopus
Match: cdh18 (cadherin 18 [Source:Xenbase;Acc:XB-GENE-982900])

HSP 1 Score: 320.857 bits (821), Expect = 1.200e-95
Identity = 174/519 (33.53%), Postives = 307/519 (59.15%), Query Frame = 2
Query:  464 HSLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDE--ENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNP-FPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIKEREQFIDIERDH---FRKSKINENKMENV-AKVRSCILEEKLLSDSIDQYR 1999
            H   S   ++  + ++ +  G+  + +  + +A+  F+  I+L P++   Y+ R+E FLQL DFQSA LN ++AC +    EE+   LAF++  Q Q LF++  +  ALE   ++ E+ P N   H+ +I+CLAAL R++E + LV K ++E   NPD +++RA+L+ +    S+CY DL  AL LD  H  A  +   + ++A + K ++I+ A+     +A+ KI +A++ +P   +YH+ RG  YRRLK+F++A+DD +MA++  D  +  +   + +A+ Q   T+NDFAV C+ K  + + + LLNKA++GE+++ + Y+NRGDCFF+L +  FALADY+QA  L      +   RIA +   +G +  +S Q+++AE   SE+IK+ P  P +F + R++ R+ + +   A+ D +  I+L         T  + FP KS+  +L SKLA +A+  L + ++E        R+H   F K +++    +N+ AK+ +C+ +++L+++ I  +R
Sbjct:  268 HQPISFNDVVQEKVTQHHERGLKFMSTQEYENAVVSFSKAINLNPEKAELYIKRSEAFLQLCDFQSAALNVQKACSITQPREEYTKLLAFIFYLQGQCLFERECYLDALEYFTRSSELQPLNKQCHLCSISCLAALGRYAESIRLVTKWLEEEQGNPDLYIVRARLYDYLNQASVCYQDLQSALLLDPQHPVACTMQEKLMAKAEEAKVKAIKHAVQGHFHKALKKICIALEYSPSSAEYHLFRGTMYRRLKDFSSAVDDLVMAINLCDAQDPLQMQLHCEAELQLHFTYNDFAVHCYTKGFYHEGVLLLNKALKGEQNKKELYVNRGDCFFQLGELSFALADYEQALELDSTNWGIQ-TRIAKLLNELGLKAQQSRQYQQAEFHFSEAIKHQPLLPQLFLH-RSQVRHYMQKTTDAQMDAVISIILHPNSNEALLTVMKFFPGKSLEEILRSKLADAAQCVLHRSLRELPMGW---REHIYSFGKPEVDITGTKNLEAKINTCLSDQQLMAELIQSWR 781          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Mouse
Match: Ttc16 (tetratricopeptide repeat domain 16 [Source:MGI Symbol;Acc:MGI:2443048])

HSP 1 Score: 322.013 bits (824), Expect = 9.827e-97
Identity = 176/453 (38.85%), Postives = 268/453 (59.16%), Query Frame = 2
Query:  500 RASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIK 1858
            +  E Y  G   L   +W  ++  F+  +HL PK   +YV RAE F+QL DF SA+ N +RA   DPGN ++ NRLAF+   Q Q L++   F  AL    +A ++ P N  +  R +ACL AL R+ +CLAL+ +++ +  ++ D ++LRA+L++ F+   LCY DL  AL LD LHA+AK +L  M  QA      +  LA+  ++  A+  I+ AI+ NP+  ++   RG   RRL+ F  A++DF+ AMD V  D +++  KQAQRQ +LT+NDFAV C+    + + + LLNKAI+ E++E   YINRGDCFF+L    FA ADY+QA +LS       L R+  +   +G  Q +  QF+ AE   SE+I+++P    ++  RAKCR  L    GAR D+   +LL+     M +    LFP+ ++ +VL S++A  A+ +L ++I+
Sbjct:   17 KVREYYNQGHQCLLQEDWEMSVLFFSRALHLDPKLVDFYVFRAEAFIQLCDFSSALQNLRRAYSYDPGNNKYLNRLAFVLYLQGQCLYELCDFQEALCVFLQASDLQPQNASFSYRCMACLLALKRYHDCLALITREVKQGRASADVYILRARLYNFFQKAKLCYQDLRSALLLDPLHAQAKGLLQKMVDQAKQSLQDASTLAVQGKVHRALKCINCAIENNPLDPNFFFFRGTLRRRLQQFDHAVEDFLKAMDMVT-DTQDNLVKQAQRQLLLTYNDFAVHCYNHGAYQEGVLLLNKAIRDEQNEKGLYINRGDCFFQLGNLAFAEADYKQALALSPLDEGANL-RMGVLQEKLGFCQQKHRQFQTAEEHFSEAIRHSPQKPQYYLHRAKCRQFLQNTLGARLDVATVLLLNPEYPKMAAVMNTLFPSMTVENVLKSQVAELAKLQLSRMIE 467          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Mouse
Match: Ttc16 (tetratricopeptide repeat domain 16 [Source:MGI Symbol;Acc:MGI:2443048])

HSP 1 Score: 322.013 bits (824), Expect = 9.827e-97
Identity = 176/453 (38.85%), Postives = 268/453 (59.16%), Query Frame = 2
Query:  500 RASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIK 1858
            +  E Y  G   L   +W  ++  F+  +HL PK   +YV RAE F+QL DF SA+ N +RA   DPGN ++ NRLAF+   Q Q L++   F  AL    +A ++ P N  +  R +ACL AL R+ +CLAL+ +++ +  ++ D ++LRA+L++ F+   LCY DL  AL LD LHA+AK +L  M  QA      +  LA+  ++  A+  I+ AI+ NP+  ++   RG   RRL+ F  A++DF+ AMD V  D +++  KQAQRQ +LT+NDFAV C+    + + + LLNKAI+ E++E   YINRGDCFF+L    FA ADY+QA +LS       L R+  +   +G  Q +  QF+ AE   SE+I+++P    ++  RAKCR  L    GAR D+   +LL+     M +    LFP+ ++ +VL S++A  A+ +L ++I+
Sbjct:   17 KVREYYNQGHQCLLQEDWEMSVLFFSRALHLDPKLVDFYVFRAEAFIQLCDFSSALQNLRRAYSYDPGNNKYLNRLAFVLYLQGQCLYELCDFQEALCVFLQASDLQPQNASFSYRCMACLLALKRYHDCLALITREVKQGRASADVYILRARLYNFFQKAKLCYQDLRSALLLDPLHAQAKGLLQKMVDQAKQSLQDASTLAVQGKVHRALKCINCAIENNPLDPNFFFFRGTLRRRLQQFDHAVEDFLKAMDMVT-DTQDNLVKQAQRQLLLTYNDFAVHCYNHGAYQEGVLLLNKAIRDEQNEKGLYINRGDCFFQLGNLAFAEADYKQALALSPLDEGANL-RMGVLQEKLGFCQQKHRQFQTAEEHFSEAIRHSPQKPQYYLHRAKCRQFLQNTLGARLDVATVLLLNPEYPKMAAVMNTLFPSMTVENVLKSQVAELAKLQLSRMIE 467          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Mouse
Match: Ttc16 (tetratricopeptide repeat domain 16 [Source:MGI Symbol;Acc:MGI:2443048])

HSP 1 Score: 322.013 bits (824), Expect = 9.827e-97
Identity = 176/453 (38.85%), Postives = 268/453 (59.16%), Query Frame = 2
Query:  500 RASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIK 1858
            +  E Y  G   L   +W  ++  F+  +HL PK   +YV RAE F+QL DF SA+ N +RA   DPGN ++ NRLAF+   Q Q L++   F  AL    +A ++ P N  +  R +ACL AL R+ +CLAL+ +++ +  ++ D ++LRA+L++ F+   LCY DL  AL LD LHA+AK +L  M  QA      +  LA+  ++  A+  I+ AI+ NP+  ++   RG   RRL+ F  A++DF+ AMD V  D +++  KQAQRQ +LT+NDFAV C+    + + + LLNKAI+ E++E   YINRGDCFF+L    FA ADY+QA +LS       L R+  +   +G  Q +  QF+ AE   SE+I+++P    ++  RAKCR  L    GAR D+   +LL+     M +    LFP+ ++ +VL S++A  A+ +L ++I+
Sbjct:   17 KVREYYNQGHQCLLQEDWEMSVLFFSRALHLDPKLVDFYVFRAEAFIQLCDFSSALQNLRRAYSYDPGNNKYLNRLAFVLYLQGQCLYELCDFQEALCVFLQASDLQPQNASFSYRCMACLLALKRYHDCLALITREVKQGRASADVYILRARLYNFFQKAKLCYQDLRSALLLDPLHAQAKGLLQKMVDQAKQSLQDASTLAVQGKVHRALKCINCAIENNPLDPNFFFFRGTLRRRLQQFDHAVEDFLKAMDMVT-DTQDNLVKQAQRQLLLTYNDFAVHCYNHGAYQEGVLLLNKAIRDEQNEKGLYINRGDCFFQLGNLAFAEADYKQALALSPLDEGANL-RMGVLQEKLGFCQQKHRQFQTAEEHFSEAIRHSPQKPQYYLHRAKCRQFLQNTLGARLDVATVLLLNPEYPKMAAVMNTLFPSMTVENVLKSQVAELAKLQLSRMIE 467          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Mouse
Match: Ttc16 (tetratricopeptide repeat domain 16 [Source:MGI Symbol;Acc:MGI:2443048])

HSP 1 Score: 319.316 bits (817), Expect = 2.771e-96
Identity = 176/453 (38.85%), Postives = 268/453 (59.16%), Query Frame = 2
Query:  500 RASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIK 1858
            +  E Y  G   L   +W  ++  F+  +HL PK   +YV RAE F+QL DF SA+ N +RA   DPGN ++ NRLAF+   Q Q L++   F  AL    +A ++ P N  +  R +ACL AL R+ +CLAL+ +++ +  ++ D ++LRA+L++ F+   LCY DL  AL LD LHA+AK +L  M  QA      +  LA+  ++  A+  I+ AI+ NP+  ++   RG   RRL+ F  A++DF+ AMD V  D +++  KQAQRQ +LT+NDFAV C+    + + + LLNKAI+ E++E   YINRGDCFF+L    FA ADY+QA +LS       L R+  +   +G  Q +  QF+ AE   SE+I+++P    ++  RAKCR  L    GAR D+   +LL+     M +    LFP+ ++ +VL S++A  A+ +L ++I+
Sbjct:   74 KVREYYNQGHQCLLQEDWEMSVLFFSRALHLDPKLVDFYVFRAEAFIQLCDFSSALQNLRRAYSYDPGNNKYLNRLAFVLYLQGQCLYELCDFQEALCVFLQASDLQPQNASFSYRCMACLLALKRYHDCLALITREVKQGRASADVYILRARLYNFFQKAKLCYQDLRSALLLDPLHAQAKGLLQKMVDQAKQSLQDASTLAVQGKVHRALKCINCAIENNPLDPNFFFFRGTLRRRLQQFDHAVEDFLKAMDMVT-DTQDNLVKQAQRQLLLTYNDFAVHCYNHGAYQEGVLLLNKAIRDEQNEKGLYINRGDCFFQLGNLAFAEADYKQALALSPLDEGANL-RMGVLQEKLGFCQQKHRQFQTAEEHFSEAIRHSPQKPQYYLHRAKCRQFLQNTLGARLDVATVLLLNPEYPKMAAVMNTLFPSMTVENVLKSQVAELAKLQLSRMIE 524          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Mouse
Match: Ttc16 (tetratricopeptide repeat domain 16 [Source:MGI Symbol;Acc:MGI:2443048])

HSP 1 Score: 321.627 bits (823), Expect = 4.962e-96
Identity = 176/453 (38.85%), Postives = 268/453 (59.16%), Query Frame = 2
Query:  500 RASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIK 1858
            +  E Y  G   L   +W  ++  F+  +HL PK   +YV RAE F+QL DF SA+ N +RA   DPGN ++ NRLAF+   Q Q L++   F  AL    +A ++ P N  +  R +ACL AL R+ +CLAL+ +++ +  ++ D ++LRA+L++ F+   LCY DL  AL LD LHA+AK +L  M  QA      +  LA+  ++  A+  I+ AI+ NP+  ++   RG   RRL+ F  A++DF+ AMD V  D +++  KQAQRQ +LT+NDFAV C+    + + + LLNKAI+ E++E   YINRGDCFF+L    FA ADY+QA +LS       L R+  +   +G  Q +  QF+ AE   SE+I+++P    ++  RAKCR  L    GAR D+   +LL+     M +    LFP+ ++ +VL S++A  A+ +L ++I+
Sbjct:   74 KVREYYNQGHQCLLQEDWEMSVLFFSRALHLDPKLVDFYVFRAEAFIQLCDFSSALQNLRRAYSYDPGNNKYLNRLAFVLYLQGQCLYELCDFQEALCVFLQASDLQPQNASFSYRCMACLLALKRYHDCLALITREVKQGRASADVYILRARLYNFFQKAKLCYQDLRSALLLDPLHAQAKGLLQKMVDQAKQSLQDASTLAVQGKVHRALKCINCAIENNPLDPNFFFFRGTLRRRLQQFDHAVEDFLKAMDMVT-DTQDNLVKQAQRQLLLTYNDFAVHCYNHGAYQEGVLLLNKAIRDEQNEKGLYINRGDCFFQLGNLAFAEADYKQALALSPLDEGANL-RMGVLQEKLGFCQQKHRQFQTAEEHFSEAIRHSPQKPQYYLHRAKCRQFLQNTLGARLDVATVLLLNPEYPKMAAVMNTLFPSMTVENVLKSQVAELAKLQLSRMIE 524          
BLAST of Tetratricopeptide repeat domain 16 vs. UniProt
Match: sp|Q8C1F5|TTC16_MOUSE (Tetratricopeptide repeat protein 16 OS=Mus musculus OX=10090 GN=Ttc16 PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 2.131e-95
Identity = 175/453 (38.63%), Postives = 268/453 (59.16%), Query Frame = 2
Query:  500 RASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIK 1858
            +  E Y  G   L   +W  ++  F+  +HL PK   +YV RAE F+QL DF SA+ N +RA   DPGN ++ NRLAF+   Q Q L++   F  AL    +A ++ P N  +  R +ACL AL R+ +CLAL+ +++ +  ++ D ++LRA+L++ F+   LCY DL  AL LD LHA+AK +L  M  QA      +  LA+  ++  A+  I+ AI+ NP+  ++   RG   RRL+ F  A++DF+ AMD V  D +++  KQAQRQ +LT+NDFAV C+    + + + LLNKAI+ E++E   YINRGDCFF+L    FA ADY+QA +LS       L R+  +   +G  Q +  QF+ AE   SE+I+++P    ++  RAKCR  L    GAR D+   +L++     M +    LFP+ ++ +VL S++A  A+ +L ++I+
Sbjct:   17 KVREYYNQGHQCLLQEDWEMSVLFFSRALHLDPKLVDFYVFRAEAFIQLCDFSSALQNLRRAYSYDPGNNKYLNRLAFVLYLQGQCLYELCDFQEALCVFLQASDLQPQNASFSYRCMACLLALKRYHDCLALITREVKQGRASADVYILRARLYNFFQKAKLCYQDLRSALLLDPLHAQAKGLLQKMVDQAKQSLQDASTLAVQGKVHRALKCINCAIENNPLDPNFFFFRGTLRRRLQQFDHAVEDFLKAMDMVT-DTQDNLVKQAQRQLLLTYNDFAVHCYNHGAYQEGVLLLNKAIRDEQNEKGLYINRGDCFFQLGNLAFAEADYKQALALSPLDEGANL-RMGVLQEKLGFCQQKHRQFQTAEEHFSEAIRHSPQKPQYYLHRAKCRQFLQNTLGARLDVATVLLVNPEYPKMAAVMNTLFPSMTVENVLKSQVAELAKLQLSRMIE 467          
BLAST of Tetratricopeptide repeat domain 16 vs. UniProt
Match: sp|Q95LZ5|TTC16_MACFA (Tetratricopeptide repeat protein 16 OS=Macaca fascicularis OX=9541 GN=TTC16 PE=2 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 1.425e-90
Identity = 168/453 (37.09%), Postives = 263/453 (58.06%), Query Frame = 2
Query:  500 RASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIK 1858
            +  E Y+ G   L+  +W  A+  F+  +HL P+   +Y  RAE +LQL DF SA  N +RA  L   N +   RL F+   Q Q LF+Q  F  AL     A E+ P    +  R +ACL AL +H  CL+L+ +++ ++ +N D ++LRA+L++  +   LCY DL  AL L+  H +A+ +L  M +QA   +  +  LA+  RLQ A+ +I+ AI+ NP+   + + RG  YRRL+ F  A++DF+  +D V  D+E D  +QAQRQ +LT+NDFAV C+ +  + + + LLNKA++ E+ E   YINRGDCFF+L    FA ADYQQA +LS +       R+  +   +G  + +  QF++AE   S +I++NP  A ++  RAK R +L    GAR+D+   +LL+     +      LFP  S+  VL +++A  AR +L+++++
Sbjct:   60 KVREYYSRGQQCLEQADWETAVLFFSRALHLDPQLVDFYALRAEAYLQLCDFSSAAQNLRRAYSLQQDNCKHLERLTFVLYLQGQCLFEQCAFLDALNVFSHAAELQPEKACFRYRCMACLLALEQHPACLSLITEELKQDTTNADVYILRARLYNFLQKPHLCYRDLHGALLLNPKHPQARMLLQKMVAQAQQARQDAGILAVQGRLQHALQRINCAIENNPLDPSFFLFRGTMYRRLQEFDGAVEDFLKVLDMVTEDQE-DIMRQAQRQLLLTYNDFAVHCYRQGAYQEGVLLLNKALRDEQQEKGLYINRGDCFFQLGNLAFAEADYQQALALSPQDEGAN-TRMGLLQEKMGFCEQKHRQFQKAEDHFSTAIRHNPQKAQYYLYRAKSRQLLQNIFGARQDVATVLLLNPKQPKLSLLMTNLFPGMSVEEVLSTQIAHLARLQLERMVE 510          
BLAST of Tetratricopeptide repeat domain 16 vs. UniProt
Match: sp|Q8NEE8|TTC16_HUMAN (Tetratricopeptide repeat protein 16 OS=Homo sapiens OX=9606 GN=TTC16 PE=2 SV=2)

HSP 1 Score: 309.686 bits (792), Expect = 2.511e-90
Identity = 168/453 (37.09%), Postives = 259/453 (57.17%), Query Frame = 2
Query:  500 RASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIK 1858
            +  E Y+ G   L+  +W  A+  F+  +HL P+   +Y  RAE +LQL DF SA  N +RA  L   N +   RL F+   Q Q LF+Q  F  AL     A E+ P  P +  R +ACL AL +H  CL L+  ++ ++ +N D ++ RA+L++  +   LCY DL  AL L+  H +A+ +L  M +QA   +  +  LA+  +LQ A+ +I+ AI+ NP+     + RG  YRRL+ F  A++DF+  +D V  D+E D  +QAQRQ +LT+NDFAV C+ +  + + + LLNKA++ E+ E   YINRGDCFF+L    FA ADYQQA +LS +       R+  +   +G  +    QF++AE   S +I++NP  A ++  RAK R +L    GAR+D+   +LL+     +      LFP  S+  VL +++A  AR +L+Q+++
Sbjct:   60 KVREYYSRGQQCLEQADWETAVLLFSRALHLDPQLVDFYALRAEAYLQLCDFSSAAQNLRRAYSLQQDNCKHLERLTFVLYLQGQCLFEQCAFLDALNVFSHAAELQPEKPCFRYRCMACLLALKQHQACLTLITNELKQDTTNADVYIFRARLYNFLQKPHLCYRDLHSALLLNPKHPQARMLLQKMVAQAQQARQDAGILAVQGKLQHALQRINRAIENNPLDPSLFLFRGTMYRRLQEFDGAVEDFLKVLDMVTEDQE-DMVRQAQRQLLLTYNDFAVHCYRQGAYQEGVLLLNKALRDEQQEKGLYINRGDCFFQLGNLAFAEADYQQALALSPQDEGAN-TRMGLLQEKMGFCEQRRKQFQKAENHFSTAIRHNPQKAQYYLYRAKSRQLLQNIFGARQDVATVLLLNPKQPKLSLLMTNLFPGMSVEEVLSTQIAHLARLQLEQMVE 510          
BLAST of Tetratricopeptide repeat domain 16 vs. UniProt
Match: sp|P0CT30|SGT2_USTMA (Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=UMAG_10205 PE=3 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.379e-7
Identity = 34/110 (30.91%), Postives = 54/110 (49.09%), Query Frame = 2
Query:  500 RASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGN 829
            +A +  A G  A+ + ++  AI  +   I L P  P Y+ NRA  F Q+    SAI + K+A  +DP   + ++RL          LF  G +  A+E+  K +E+ P N
Sbjct:  104 KAEQLKAEGNKAMSAKDYGAAIEAYGKAIELNPNSPVYFSNRAAAFSQIGQHDSAIDDAKQASKIDPKFGKAYSRLG-------HALFSSGRYQEAVEAYQKGVEVDPSN 206          
BLAST of Tetratricopeptide repeat domain 16 vs. UniProt
Match: sp|Q9M8Y0|SEC_ARATH (Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.671e-6
Identity = 63/269 (23.42%), Postives = 109/269 (40.52%), Query Frame = 2
Query:  536 LKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIA-----------CLAALNRHSECLA-LVNKQIDENNSNPDFFVLRAK------LHSHFRNFSLC------YYDLI----DALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAM 1258
            ++SG+   A+ ++   + LKP  P  Y+N   ++  L     AI+ Y+ A  + P +   F  +A +Y  Q Q+     H+  AL    + +E    N G  ++ I            CLA    H + +A L N  ++ N   P   + +A       L + F N ++       Y D I    + L +D L A+A      + ++ N  K          R+ EAI     AI+  P + + H    + Y+   +  AAI  +  A+
Sbjct:  234 MESGDLNRALQYYKEAVKLKPAFPDAYLNLGNVYKALGRPTEAIMCYQHALQMRPNSAMAFGNIASIYYEQGQLDLAIRHYKQALSRDPRFLEAY-NNLGNALKDIGRVDEAVRCYNQCLALQPNHPQAMANLGNIYMEWNMMGPASSLFKATLAVTTGLSAPFNNLAIIYKQQGNYSDAISCYNEVLRIDPLAADA------LVNRGNTYKE-------IGRVTEAIQDYMHAINFRPTMAEAHANLASAYKDSGHVEAAITSYKQAL 488          
BLAST of Tetratricopeptide repeat domain 16 vs. TrEMBL
Match: gnl|BL_ORD_ID|17222078 (tr|A0A3S1A987|A0A3S1A987_ELYCH TPR_REGION domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_006310 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 1.233e-148
Identity = 231/545 (42.39%), Postives = 348/545 (63.85%), Query Frame = 2
Query:  248 DKYSLLGDNSENIENENFDNKLIENQKEPNEENNAN---------QSTVFSTELSSGVTEENSELSNGINFMPKSWTSKGLHSLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQII 1855
            + +S +G+  +  E E+ D+   EN +  +E+              + VF+T +     +   + S+   F  ++W   G      + QI+  RA E Y   M   K  + +  I+     I+LK  +P +YV RAE ++QL DFQSAILNYK+AC+L+  N+ +++RLAFLY FQ Q LFDQ  +  ALE+  +A EMVP N GYHIR+I CLAAL RH ECLALVNK+++ ++ NPD +++RA+LH  FRN +LCYYD+ DA+ LD  H EAK ++ ++  +AN  K QS++L +  + +EA+ KIS+AI+ NP + D+HV RGA  R+L +F AAIDDF++A+DK DH E++  Y  +QRQ +LT+NDFAVECF K  F+++I LLNKAI+GEKSE   Y+NRGDCFFK  +  FAL DY QA  L  +   V  ARI+ VH   G +Q++   ++EAE   + +++ NP    ++  R++ RY++++  GAR DL+ G++L+  ++ + S   RLFP KS++ V+ S  A +A+ +L+ ++
Sbjct:  139 ESFSGVGEEQDTPETEDADDNEDENGERQDEDRTTTAEGTTLSEQSAGVFATAVDEEAIDAARQRSHKSLFSTENWQGGGRLRKVGLVQIVTKRAYEHYERAMEVKKENDLLGIITCLNKAINLKTDDPIFYVERAEAYIQLCDFQSAILNYKKACLLESQNQTYYSRLAFLYYFQGQTLFDQRLYPEALEAFSRASEMVPDNVGYHIRSITCLAALQRHGECLALVNKRLETDHHNPDLYIMRARLHEMFRNTTLCYYDVKDAIALDPEHEEAKAIMAAIVKRANASKLQSMQLNIAGKHREALQKISIAIETNPSVADFHVLRGALQRKLHDFNAAIDDFLLALDKCDHQEDDPVYINSQRQLLLTYNDFAVECFGKGFFEEAIILLNKAIKGEKSEKSLYVNRGDCFFKQSELTFALQDYHQALELDPQDSAVK-ARISVVHNEFGVEQYQDKNYKEAEAKFTLALQYNPQVGQYYISRSRSRYMMEDTSGARDDLLMGLILAPTNEDVLSIVSRLFPGKSIADVINSPAARAAQMKLNHLV 682          
BLAST of Tetratricopeptide repeat domain 16 vs. TrEMBL
Match: gnl|BL_ORD_ID|23899973 (tr|K1PP71|K1PP71_CRAGI Tetratricopeptide repeat protein 16 OS=Crassostrea gigas OX=29159 GN=CGI_10012902 PE=4 SV=1)

HSP 1 Score: 456.447 bits (1173), Expect = 6.581e-144
Identity = 222/497 (44.67%), Postives = 325/497 (65.39%), Query Frame = 2
Query:  365 VFSTELSSGVTEENSELSNGINFMPKSWTSKGLHSLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQII 1855
            +FST +S    ++  +    I F  + W +   +S P M +I+D RA E +   M A + G +   +   +  + L+  +  YYV RAE  +QL DFQSAILNYK+AC+++P N E++ RLAFLY F  Q LFDQ  +  ALES  +A EM P N GYHIR++ CLAAL RH ECLALVNK+++ +N NPD +++RA+LH  FRN +LCYYD+ DAL +D  H EAK ++  M  +A D K ++++L L  + +EA+ KIS+AID +PII D+HV RG+ +RRL ++ AAIDDF++A+DK +H+EE+  Y  +QRQ +LT+NDFAVECF K+ ++++I LLNKAI+GEK E   YINRGDCFF+   + FAL DY QA  L  +   +  ARI+ ++   G   ++   F EA+  L+++I+ NP    ++  R++CRY+++    AR DLI G+LL   ++ + S   RLFP KS+  V+ S+ A  A+  +  I+
Sbjct:  150 LFSTAVSEETIQKAKQKGKSI-FQTEEWGAVAQYS-PGMQEIVDQRALEHFNEAMKAKEEGKFEQVLKSLSKAMGLR-TDSLYYVERAEALIQLCDFQSAILNYKKACLMEPDNAEYYARLAFLYYFMGQTLFDQRLYPEALESFARAAEMNPDNTGYHIRSMTCLAALQRHGECLALVNKRLETDNENPDLYIMRARLHEMFRNTTLCYYDIKDALQVDPDHQEAKAMMVKMEKRAQDNKREAMQLNLMGKHREALQKISIAIDTDPIIADFHVLRGSLHRRLGDYNAAIDDFLLALDKCEHNEESPVYIDSQRQLLLTYNDFAVECFTKDFYEEAIILLNKAIKGEKREKGLYINRGDCFFRQNDFNFALQDYSQALELDPDDENIK-ARISVIYNEFGVNAYQDKNFPEADTKLTQAIQYNPKVGQYYITRSRCRYMMENIHSARLDLIMGLLLDPTNEDVISILSRLFPGKSIGDVVNSRAADPAKLAVRAIL 642          
BLAST of Tetratricopeptide repeat domain 16 vs. TrEMBL
Match: gnl|BL_ORD_ID|18300452 (tr|A0A1I8J5W5|A0A1I8J5W5_9PLAT TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 8.228e-142
Identity = 238/587 (40.55%), Postives = 345/587 (58.77%), Query Frame = 2
Query:  140 SSNFDNL----EVARAKAAESVVNLNQFFPDIQTEIKVYSDKYSLLGDNSENIENENFDN------------KLIENQKEPNE--ENNANQSTVFSTELSSGVTEENSELSNGINFMPKS---------WTSKGLHSLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDP---GNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSG-FDKAMESTFCRLFPNKSMSHVL 1807
            SS++ NL    + AR KA + ++N+NQFFP + +EI+VY DK S LGDNS       F N             + E +  P E  +     ST+F+TEL      E  +        PKS         WT+     + +M Q ++   +  Y   M+ALK G+ + A+     CI L+P +  +Y +RAE+F++  DF+SAI NY++   L P   G+  +++RLAFLY+F  Q LFDQG+++ ALE+  KA EM P N  Y  R+IACL AL RHSECLALVNK+++ NNSNPD +V+RA+LH  F++++L YYD  DAL +   H+ A  +   +   A +   Q++ELA+  RL+EA  K SLAID++P + ++HV+R A  RRL +F AA++D +MAMDK DHD  +  +  AQRQ +LTFNDFAVEC+ K  +++S+ LL KAI+ EK E   YINRGDCF++L + QFA  DY+QA  L      + L R++ VH  +G+  F+   F ++   L+ +I+ NP     W  R + RY   + K A+ DL   +LL    D+AM +   RLFP+     +L
Sbjct:    5 SSDWSNLGSDYDEARRKANQVIINVNQFFPLLDSEIRVYKDKMSYLGDNSVGKPLRPFPNVEGAIEKSGTLPSIKEEEVPPAEAPDTQTEDSTLFATELDG----EQQQRQRQATSTPKSAATGSHDDEWTADRKRKILTMKQTVEEAVARHYRDAMLALKQGDDLTAMRKLHRCIALRPDDADFYHHRAELFVRQCDFRSAIANYRKCMRLQPEAAGSAGYWDRLAFLYLFYGQTLFDQGYYAEALENFAKASEMQPDNVAYQTRSIACLTALGRHSECLALVNKRLETNNSNPDLYVMRARLHFIFKSYTLAYYDAKDALAISPGHSGAAQMRDYLFESARNYGRQAVELAINGRLREAHKKASLAIDMDPSVAEFHVRRAALNRRLGDFNAAVEDCLMAMDKCDHDPASKPFTDAQRQLLLTFNDFAVECYMKGFYEESVGLLEKAIKAEKGEKALYINRGDCFYRLGRLQFAQLDYEQAWDLDPNDSSIGL-RLSLVHHRMGQAAFQEKDFAKSVDCLTRAIERNPLCHHLWTARGRSRYFQTDLKNAQVDLAVALLLKAELDEAMRTLLTRLFPSVPTDKIL 586          
BLAST of Tetratricopeptide repeat domain 16 vs. TrEMBL
Match: gnl|BL_ORD_ID|18307400 (tr|A0A1I8H2Z4|A0A1I8H2Z4_9PLAT TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 9.823e-142
Identity = 238/587 (40.55%), Postives = 345/587 (58.77%), Query Frame = 2
Query:  140 SSNFDNL----EVARAKAAESVVNLNQFFPDIQTEIKVYSDKYSLLGDNSENIENENFDN------------KLIENQKEPNE--ENNANQSTVFSTELSSGVTEENSELSNGINFMPKS---------WTSKGLHSLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDP---GNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSG-FDKAMESTFCRLFPNKSMSHVL 1807
            SS++ NL    + AR KA + ++N+NQFFP + +EI+VY DK S LGDNS       F N             + E +  P E  +     ST+F+TEL      E  +        PKS         WT+     + +M Q ++   +  Y   M+ALK G+ + A+     CI L+P +  +Y +RAE+F++  DF+SAI NY++   L P   G+  +++RLAFLY+F  Q LFDQG+++ ALE+  KA EM P N  Y  R+IACL AL RHSECLALVNK+++ NNSNPD +V+RA+LH  F++++L YYD  DAL +   H+ A  +   +   A +   Q++ELA+  RL+EA  K SLAID++P + ++HV+R A  RRL +F AA++D +MAMDK DHD  +  +  AQRQ +LTFNDFAVEC+ K  +++S+ LL KAI+ EK E   YINRGDCF++L + QFA  DY+QA  L      + L R++ VH  +G+  F+   F ++   L+ +I+ NP     W  R + RY   + K A+ DL   +LL    D+AM +   RLFP+     +L
Sbjct:    5 SSDWSNLGSDYDEARRKANQVIINVNQFFPLLDSEIRVYKDKMSYLGDNSVGKPLRPFPNVEGAIEKSGTLPSIKEEEVPPAEAPDTQTEDSTLFATELDG----EQQQRQRQATSTPKSAATGSHDDEWTADRKRKILTMKQTVEEAVARHYRDAMLALKQGDDLTAMRKLHRCIALRPDDADFYHHRAELFVRQCDFRSAIANYRKCMRLQPEAAGSAGYWDRLAFLYLFYGQTLFDQGYYAEALENFAKASEMQPDNVAYQTRSIACLTALGRHSECLALVNKRLETNNSNPDLYVMRARLHFIFKSYTLAYYDAKDALAISPGHSGAAQMRDYLFESARNYGRQAVELAINGRLREAHKKASLAIDMDPSVAEFHVRRAALNRRLGDFNAAVEDCLMAMDKCDHDPASKPFTDAQRQLLLTFNDFAVECYMKGFYEESVGLLEKAIKAEKEEKALYINRGDCFYRLGRLQFAQLDYEQAWDLDPNDSSIGL-RLSLVHHRMGQAAFQEKDFAKSVDCLTRAIERNPLCHHLWTARGRSRYFQTDLKNAQVDLAVALLLKAELDEAMRTLLTRLFPSVPTDKIL 586          
BLAST of Tetratricopeptide repeat domain 16 vs. TrEMBL
Match: gnl|BL_ORD_ID|18337236 (tr|A0A267GYZ9|A0A267GYZ9_9PLAT TPR_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034392g1 PE=4 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 2.636e-141
Identity = 238/587 (40.55%), Postives = 345/587 (58.77%), Query Frame = 2
Query:  140 SSNFDNL----EVARAKAAESVVNLNQFFPDIQTEIKVYSDKYSLLGDNSENIENENFDN------------KLIENQKEPNE--ENNANQSTVFSTELSSGVTEENSELSNGINFMPKS---------WTSKGLHSLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDP---GNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSG-FDKAMESTFCRLFPNKSMSHVL 1807
            SS++ NL    + AR KA + ++N+NQFFP + +EI+VY DK S LGDNS       F N             + E +  P E  +     ST+F+TEL      E  +        PKS         WT+     + +M Q ++   +  Y   M+ALK G+ + A+     CI L+P +  +Y +RAE+F++  DF+SAI NY++   L P   G+  +++RLAFLY+F  Q LFDQG+++ ALE+  KA EM P N  Y  R+IACL AL RHSECLALVNK+++ NNSNPD +V+RA+LH  F++++L YYD  DAL +   H+ A  +   +   A +   Q++ELA+  RL+EA  K SLAID++P + ++HV+R A  RRL +F AA++D +MAMDK DHD  +  +  AQRQ +LTFNDFAVEC+ K  +++S+ LL KAI+ EK E   YINRGDCF++L + QFA  DY+QA  L      + L R++ VH  +G+  F+   F ++   L+ +I+ NP     W  R + RY   + K A+ DL   +LL    D+AM +   RLFP+     +L
Sbjct:    9 SSDWSNLGSDYDEARRKANQVIINVNQFFPLLDSEIRVYKDKMSYLGDNSVGKPLRPFPNVEGAIEKAGTLPSIKEEEVPPAEAPDTQTEDSTLFATELDG----EQQQRQRQATSTPKSAATGSHDDEWTADRKRKILTMKQTVEEAVARHYRDAMLALKQGDDLTAMRKLHRCIALRPDDADFYHHRAELFVRQCDFRSAIANYRKCMRLQPEAAGSAGYWDRLAFLYLFYGQTLFDQGYYAEALENFAKASEMQPDNVAYQTRSIACLTALGRHSECLALVNKRLETNNSNPDLYVMRARLHFIFKSYTLAYYDAKDALAISPGHSGAAQMRDYLFESARNYGRQAVELAINGRLREAHKKASLAIDMDPSVAEFHVRRAALNRRLGDFNAAVEDCLMAMDKCDHDPASKPFTDAQRQLLLTFNDFAVECYMKGFYEESVGLLEKAIKAEKEEKALYINRGDCFYRLGRLQFAQLDYEQAWDLDPNDSSIGL-RLSLVHHRMGQAAFQEKDFAKSVDCLTRAIERNPLCHHLWTARGRSRYFQTDLKNAQVDLAVALLLKAELDEAMRTLLTRLFPSVPTDKIL 590          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Cavefish
Match: ttc16 (tetratricopeptide repeat domain 16 [Source:ZFIN;Acc:ZDB-GENE-141219-15])

HSP 1 Score: 332.798 bits (852), Expect = 2.834e-102
Identity = 179/462 (38.74%), Postives = 262/462 (56.71%), Query Frame = 2
Query:  488 ILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMD------KVDHDEENDTYK----QAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQEL 1843
            I+ N+AS  Y  GM A+   +   A++ F+  I L+P++   YV RAE++LQL DF SA L+YK AC L+P  E +F+RLAF+Y  Q Q L DQG F  ALE   KA E+ P    Y  R++ACL AL R+++CL LV   ++ +  + D F LRA+LH        CYYDL  AL LD   A A ++L  +   A     Q++  A+   L  A+ KIS A++ NP    Y++ RG  YRRLK+F AA++D  +A D      K    ++ + YK     AQ Q +LT+NDFAV CF +   +++  LL KA+Q +++E + +INRGDCF K ++W FALADYQQA  L  +       R+A +H  +G Q  +   FREA    S +IK NP  A ++  RAK    ++  + A++D    ++L      + +   +LFP  S+S V+ S  A + + +L
Sbjct:   52 IIQNKASSHYEAGMEAVLKLHLEKAVTCFSKAITLRPEQTQLYVERAEVYLQLCDFNSASLDYKHACYLEPQTEAYFHRLAFIYYMQGQCLCDQGMFMEALEYFAKAAELKPNYKPYQTRSLACLTALGRYTDCLRLVTNLLEADTPSADLFTLRARLHHQLNQDVQCYYDLKAALRLDPSAAGALSLLGELDEAAEHFHQQAVSKAVEGELSSAVVKISTALEKNPEKAQYYLFRGTLYRRLKDFIAAVEDLALAADLRDAGAKCPEGQKPEDYKGLEDDAQVQLVLTYNDFAVHCFSQGFHNEAAMLLTKAMQEQRNESRLFINRGDCFLKQEEWHFALADYQQAEELDPQ-NLCIWCRLAMIHSILGLQSLDKLMFREAADKFSVAIKYNPEVAQYYGNRAKAYIRMNSLEEAKQDAFRALILEPTSDELVALLLKLFPGCSLSDVMSSATAKTVKAQL 512          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Cavefish
Match: ttc16 (tetratricopeptide repeat domain 16 [Source:ZFIN;Acc:ZDB-GENE-141219-15])

HSP 1 Score: 333.183 bits (853), Expect = 3.419e-102
Identity = 179/462 (38.74%), Postives = 262/462 (56.71%), Query Frame = 2
Query:  488 ILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMD------KVDHDEENDTYK----QAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQEL 1843
            I+ N+AS  Y  GM A+   +   A++ F+  I L+P++   YV RAE++LQL DF SA L+YK AC L+P  E +F+RLAF+Y  Q Q L DQG F  ALE   KA E+ P    Y  R++ACL AL R+++CL LV   ++ +  + D F LRA+LH        CYYDL  AL LD   A A ++L  +   A     Q++  A+   L  A+ KIS A++ NP    Y++ RG  YRRLK+F AA++D  +A D      K    ++ + YK     AQ Q +LT+NDFAV CF +   +++  LL KA+Q +++E + +INRGDCF K ++W FALADYQQA  L  +       R+A +H  +G Q  +   FREA    S +IK NP  A ++  RAK    ++  + A++D    ++L      + +   +LFP  S+S V+ S  A + + +L
Sbjct:   52 IIQNKASSHYEAGMEAVLKLHLEKAVTCFSKAITLRPEQTQLYVERAEVYLQLCDFNSASLDYKHACYLEPQTEAYFHRLAFIYYMQGQCLCDQGMFMEALEYFAKAAELKPNYKPYQTRSLACLTALGRYTDCLRLVTNLLEADTPSADLFTLRARLHHQLNQDVQCYYDLKAALRLDPSAAGALSLLGELDEAAEHFHQQAVSKAVEGELSSAVVKISTALEKNPEKAQYYLFRGTLYRRLKDFIAAVEDLALAADLRDAGAKCPEGQKPEDYKGLEDDAQVQLVLTYNDFAVHCFSQGFHNEAAMLLTKAMQEQRNESRLFINRGDCFLKQEEWHFALADYQQAEELDPQ-NLCIWCRLAMIHSILGLQSLDKLMFREAADKFSVAIKYNPEVAQYYGNRAKAYIRMNSLEEAKQDAFRALILEPTSDELVALLLKLFPGCSLSDVMSSATAKTVKAQL 512          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Cavefish
Match: ttc6 (tetratricopeptide repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-090429-2])

HSP 1 Score: 50.447 bits (119), Expect = 9.289e-6
Identity = 62/252 (24.60%), Postives = 102/252 (40.48%), Query Frame = 2
Query: 1130 AINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFIL--TFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGR-QQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDL---------------ICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSA 1831
            A++  SL +   P        RG  + +L  F  AI+DF +A+    H +  D      R  +L     D A+        D S+ +L   I G       ++ RG  + + QQWQ A+AD++    +   V        AA H ++G     + NQ ++A    S +IK +P     +  RA+  + +++ K A KDL               + G  L   ++   +TFC  + +  M   LG  L   A
Sbjct:  897 ALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAV----HLDPRDWLAFYHRGCLLRRILPDVALR-------DLSVSVL---INGSSENLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTV--------AAAHINLGLIYMLKMNQSQKAIRRFSNAIKADPTNIKGYVCRARAYHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQY-SAEMKKALGLTLVQQA 1125          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Cavefish
Match: ttc6 (tetratricopeptide repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-090429-2])

HSP 1 Score: 50.447 bits (119), Expect = 9.334e-6
Identity = 62/252 (24.60%), Postives = 102/252 (40.48%), Query Frame = 2
Query: 1130 AINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFIL--TFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGR-QQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDL---------------ICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSA 1831
            A++  SL +   P        RG  + +L  F  AI+DF +A+    H +  D      R  +L     D A+        D S+ +L   I G       ++ RG  + + QQWQ A+AD++    +   V        AA H ++G     + NQ ++A    S +IK +P     +  RA+  + +++ K A KDL               + G  L   ++   +TFC  + +  M   LG  L   A
Sbjct:  931 ALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAV----HLDPRDWLAFYHRGCLLRRILPDVALR-------DLSVSVL---INGSSENLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTV--------AAAHINLGLIYMLKMNQSQKAIRRFSNAIKADPTNIKGYVCRARAYHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQY-SAEMKKALGLTLVQQA 1159          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Sea Lamprey
Match: ttc16 (tetratricopeptide repeat domain 16 [Source:ZFIN;Acc:ZDB-GENE-141219-15])

HSP 1 Score: 262.692 bits (670), Expect = 4.176e-80
Identity = 137/351 (39.03%), Postives = 202/351 (57.55%), Query Frame = 2
Query:  515 YAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIG 1567
            Y  G+     G +  A+  FT  I+L P++   YV RAE +L+L DFQSAIL YK+A  +  G      RL F+   Q Q LF+   +  ALE+  +A E+ P +    +R +ACLAAL R+ +CL LV++ +     N D +VLRA+LH  F N S C+ D  +A  L    AEA+ +L S+  +A D + Q++  AL  R +EA+ KISLA++ +P   ++ V R A  R+L++F  A ++ +  M+   HD E+   + AQRQ ++ +ND AV C  +  F +++ LLN+AI+ EK     Y NRGDCF+K+ +  FALADYQQA  L +        RIA VH  + 
Sbjct:    1 YMKGLEEFNHGEYEKAVLCFTKAINLTPQQTDLYVKRAEAYLELCDFQSAILGYKQALSVSRGQAPIHGRLTFVLYEQGQGLFEHKLYLDALEAFTRATELKPSSLPIEMRCVACLAALGRYGDCLELVDRWLLAETDNADLYVLRARLHHRFNNPSRCHEDAREAARLAPGRAEAEALLESLRRRAQDARAQAVAGALRGRPREALAKISLAVESDPGAPEHRVLRAALLRQLQDFAGATEELLAGMEAAGHDPESTAQRAAQRQLLIAYNDLAVHCCRRGLFQEAVVLLNRAIRAEKGAKSLYRNRGDCFYKMDELGFALADYQQAYEL-DPGDSCLRERIALVHHDLA 350          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Sea Lamprey
Match: sgta (small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha [Source:ZFIN;Acc:ZDB-GENE-030131-8811])

HSP 1 Score: 53.5286 bits (127), Expect = 9.533e-8
Identity = 30/113 (26.55%), Postives = 57/113 (50.44%), Query Frame = 2
Query:  506 SEKYAI-GMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYH 841
            SE++ + G   ++   + +A+  +TH I L  +   Y+ NRA  + +LS++  A+ + +RA ++DP   + + R+          L   G    A+E   +A+E+ P N GY 
Sbjct:   93 SEQFKVHGNQYMREERYSEAVECYTHAIELHQQNAVYFCNRAAAYSKLSNYVGAVQDCERAIVIDPNYSKAYGRMGL-------ALTSLGKHEEAVEFYRRAVELDPDNEGYR 198          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Nematostella
Match: EDO34517 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP56])

HSP 1 Score: 378.252 bits (970), Expect = 1.589e-123
Identity = 178/318 (55.97%), Postives = 235/318 (73.90%), Query Frame = 2
Query:  545 GNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQA 1498
            G    AI+ F   I LKP+   YY  R E FLQ+ DFQSAILN+K+ACILDP N+E+++RLAF+Y FQ Q LFD+  +  ALES  +A EM P   GYH R++ACL+AL RH ECLALVNK+++E ++N D +++RA+LH  FRN +LCYYD+ DAL L   + EAK ++ S+  +AND K Q+ +L L  +++EA+ KIS+AI+ NP I +YHV RGA +R+  +F AAIDDF++ MDK DHDE + TYK AQRQ +L++NDFAVECF K  +D++I LLNKA+QGEK+E   YINRGDCFF+  +  FALADYQQA
Sbjct:    3 GQHYKAIACFNKAISLKPELIKYYTARGESFLQICDFQSAILNFKKACILDPENDEYYSRLAFIYFFQGQCLFDEKLYKEALESFSRAAEMKPEVIGYHTRSVACLSALQRHGECLALVNKRLEEESTNTDLYIMRARLHELFRNSTLCYYDVKDALVLSPDNEEAKTLMNSLHKRANDSKLQAEQLFLVGKVKEALTKISIAIETNPSIPEYHVFRGALHRKHADFNAAIDDFLLVMDKTDHDESHPTYKHAQRQLLLSYNDFAVECFGKGYYDEAIVLLNKAVQGEKNEKGLYINRGDCFFRANELHFALADYQQA 320          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Nematostella
Match: EDO27418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9A9])

HSP 1 Score: 174.096 bits (440), Expect = 1.705e-50
Identity = 79/141 (56.03%), Postives = 104/141 (73.76%), Query Frame = 2
Query:  563 ISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFS 985
            I+ F   I LKP+   YY  R E FLQ+ DFQSAILN+K+ACILDP N+E+++RLAF+Y FQ Q LFD+  +  ALES  +A EM P   GYH R++ACL+AL RH ECLALVNK+++E ++N D +++RA+LH  FRN S
Sbjct:    2 IACFNKAISLKPELIKYYTARGESFLQICDFQSAILNFKKACILDPENDEYYSRLAFIYFFQGQCLFDEKLYKEALESFSRAAEMKPEVIGYHTRSVACLSALQRHGECLALVNKRLEEESTNTDLYIMRARLHELFRNVS 142          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Nematostella
Match: EDO40344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7J9])

HSP 1 Score: 57.3806 bits (137), Expect = 2.363e-8
Identity = 106/445 (23.82%), Postives = 166/445 (37.30%), Query Frame = 2
Query:  539 KSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFL---------------------------YVFQSQILFDQGHFSHALESIGKAIEMVPGNP------GYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLD-SLHAEAKNV-LTSMASQANDLK-----TQSIEL------ALYNR---------LQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSL--SEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKG 1702
            + G+   AI +++  I L P +   Y  RA +F    D   A+ +YK A  L P   E    +                              Y ++  +    G FS AL  +   +   P N       G  +R I    AL   S  L L     D++  N   F+ R  L++  + +     D   A+ LD SL +   N+ L  +   +N  K     T +I +      AL  R         LQEAI   + AI + P + DYH+ RG      K    A    +    +++        +QA            V  F KN FD +I +L +A +  K   Q ++  G    K ++++ A++ + +A  +      R       A V+F IG  Q E +    A  A +E+IK NP  A  +  R   +  L   KG
Sbjct:   80 QEGDATMAIVNYSQAIKLNPNDVETYYQRAAMFKMRGDMLLALEDYKIASRLLPSKTEAMFEIGMYRFNNENWTGAVNDFTEILEQDPQDSRAYTYRGTVFAKMGQFSKALPDLAAGVHYNPDNAVAFYQRGCILRKIHPRRALQDFSVSLLL-----DDSEENVMAFMHRGILYTDLKRWEDAIPDFEAAIRLDPSLASAYVNIGLIYIIKHSNYQKAIRQYTSAIRVDPTYVRALICRAEAFQKMGMLQEAILDYARAIHMRPDVSDYHMARGKLLLEQKKLDLA-SFHVKQAAQLNQGLGASATQQA-----------VVHSFLKN-FDQAIDVLERATR-VKPSAQIFVLLGKTNMKAKRFEDAISSFLKAIEILTPWNSRNPMPLEAAGVYFLIGMCQSEVHNDSGALDAYNEAIKVNPDYAEAFYQRGLTKMKLSHTKG 505          
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Nematostella
Match: EDO32703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUB0])

HSP 1 Score: 51.2174 bits (121), Expect = 1.246e-6
Identity = 54/256 (21.09%), Postives = 101/256 (39.45%), Query Frame = 2
Query:  518 AIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFL-----YVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDL----NPIIGDY-------HVKRGAFYRRLKNFTAAI 1237
            A  ++AL  G    AI      + L+P+     V R  +FL+   F  A ++Y+      P N++   +L  +      V +++   ++G    A+E +  AIE+ P +P   +    C        + ++ +       N N   F+  +KLH           ++ + L LD  H +       M  + N   + + +L    +  EAI+K+  A+       P++G         H+K G     +K   AA+
Sbjct:   36 ATVLIAL--GRSRSAIPDLDKVLELRPEFYQARVQRGNVFLKQGRFDEAHIDYEGVLRYSPENKDALQQLGVIEPIKRTVMEAKYAMERGDCHSAIEQLTHAIEVAPWDPELRMMRADCYERQGDLIKAISDIKPTTKLINDNTQAFLRMSKLHYEIGELEEALREVRECLKLDQDHKQCHPFYKKM-KKLNKQLSAAQDLINKEQYHEAIDKLKKALRTESKNKPLVGKARRQLCHCHLKLGFSQEAIKECNAAL 288          
BLAST of Tetratricopeptide repeat domain 16 vs. Planmine SMEST
Match: SMESG000020147.1 (SMESG000020147.1)

HSP 1 Score: 1474.53 bits (3816), Expect = 0.000e+0
Identity = 712/717 (99.30%), Postives = 715/717 (99.72%), Query Frame = 2
Query:   83 MTNKSESLYSTDAQSVSFISSNFDNLEVARAKAAESVVNLNQFFPDIQTEIKVYSDKYSLLGDNSENIENENFDNKLIENQKEPNEENNANQSTVFSTELSSGVTEENSELSNGINFMPKSWTSKGLHSLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIKEREQFIDIERDHFRKSKINENKMENVAKVRSCILEEKLLSDSIDQYRELDCRFKQCSENKGSIGKSVGNVTGLPDLQISKSDESNILGIVGNREGNKFYMDKRGVIIRASEPHGWRKFKSGIEMK 2233
            MTNKSESLYSTDAQSVSFISSNFDNLEVARAKAAESVVNLNQFFPDIQTEIKVYSDKYSLLGDNSENIENENFDNKLIENQKEPNEENNANQSTVFSTELSSGVTEENSELSNGINFMPKSWTSKGLHSLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMA+QANDLK QSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFS+GRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILL+GFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIKEREQFIDIERDHFRKSKINENKMENVAKVRSCILEEKLLSDSI QYRELDCRFKQCSENKGSIGKSVGNVTGLPDLQISKSDESNILGIVGNREGNKFYMDKRGVIIRASEPHGWRKFKSGIEMK
Sbjct:    1 MTNKSESLYSTDAQSVSFISSNFDNLEVARAKAAESVVNLNQFFPDIQTEIKVYSDKYSLLGDNSENIENENFDNKLIENQKEPNEENNANQSTVFSTELSSGVTEENSELSNGINFMPKSWTSKGLHSLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMANQANDLKNQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSMGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGILLNGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIKEREQFIDIERDHFRKSKINENKMENVAKVRSCILEEKLLSDSIGQYRELDCRFKQCSENKGSIGKSVGNVTGLPDLQISKSDESNILGIVGNREGNKFYMDKRGVIIRASEPHGWRKFKSGIEMK 717          
BLAST of Tetratricopeptide repeat domain 16 vs. Planmine SMEST
Match: SMESG000071973.1 (SMESG000071973.1)

HSP 1 Score: 55.0694 bits (131), Expect = 3.012e-7
Identity = 90/431 (20.88%), Postives = 171/431 (39.68%), Query Frame = 2
Query:  467 SLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRA-KLHSHFR---NFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQ---EAINKISLAIDLNPIIGDYHVKRGAFYRRL-----KNFTAAIDDFIMAMDKVDHDEENDT--YKQAQRQFILTFNDF-----------------AVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQA---GSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFW 1657
            +  +  +I  N A   Y  G   L+ G     I      + + P+    Y+ RA +F   + +  AILN      ++P       R    Y+++  + +    +S A++   +AI+         I A   LA  NR + C     K  ++   +    +L +  LH H++   N  L Y +L D  N  +LH    + + + A Q NDL    +    +++L+   EAI   +  +D +P      V RG  +        ++  A   + ++ +D    D   +    +QAQ +F   ++ F                 A+ C + +  + ++K LN+AI+ +      YINRG  +  ++    A+ DY +A   G L          +    +F+ G     + Q  +A     ++++++P     W
Sbjct: 1383 AFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEP-------RCLRAYLYRGVLKYKIKAYSLAIKDFTEAIK---------IDANCILAFFNR-AVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQN--ALH----DFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGL----------KCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGW 1780          

HSP 2 Score: 51.6026 bits (122), Expect = 3.247e-6
Identity = 92/474 (19.41%), Postives = 180/474 (37.97%), Query Frame = 2
Query:  452 SKGLHSLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNR------AEIFLQLSDF---------QSAILNYKRACILDPGNEEF------------FNR-LAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLA----ALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECF-EKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFESNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGI------LLSGFDKAM 1756
            S  L   PS T+   +R       G    K   W DA++ F+  IHL P     Y  R      AE +L + DF         +  I++Y    IL    ++F            FN+ + F +V    I F++G F  +++ +   +     +P Y IRA  C A     +N++ + +  +N+ I       +F++LR   +       +    +  A       AE  + L     Q      Q++  +      +AI+ + +A    P +   ++  G    + K +  AI  F   ++++    +   +           N     C+ E   +  S    +  ++   +  + Y ++G C  +L + +  + D  +A +++  + +  LAR     F         NQ+ +A +  +E +   P     +  R   +Y +  +  A KD    I      +L+ F++A+
Sbjct: 1069 SSVLRHYPSNTEAWLHR-------GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSISLLLESSEENIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGL---AADPTY-IRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQA-------AEISHNLGQSPVQ------QALVHSFLQHYDQAIDALLVATRGKPSVALLNL-LGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGA----ANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGF--------KNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAV 1505          

HSP 3 Score: 50.8322 bits (120), Expect = 6.125e-6
Identity = 74/344 (21.51%), Postives = 130/344 (37.79%), Query Frame = 2
Query:  542 SGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQI--DENNSNPDF----FVLRAKLHSHFRNFSLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVH 1555
            +G+   AIS+ +  I L P +   Y  RAE++ Q  + + A+ +Y +   L P N     +    Y+   Q       FS  L          P N    +      A L +  + L   +  I  D NN    F     + +A+ +   R+FS+             L +  +N+++ M         + I  A   +  EAI    + I  N  +   HV  G  Y    +F  ++      +              A   +I  +   A   F+ N ++D+IK +N+AI        FY+ RGD +  + + + A    +QA  +S  + +  + + A VH
Sbjct:  990 TGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRH-------YPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSISLL----------LESSEENIMSYM--------YRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGL-------------AADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQ-ALVH 1294          
BLAST of Tetratricopeptide repeat domain 16 vs. Planmine SMEST
Match: SMESG000002813.1 (SMESG000002813.1)

HSP 1 Score: 50.8322 bits (120), Expect = 6.061e-6
Identity = 74/352 (21.02%), Postives = 130/352 (36.93%), Query Frame = 2
Query:  440 KSWTSKGLHSLPSMTQILDNRASEKYAIGMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNFSLCYYDLIDALNLDS--LHAEAKNVLTSMASQANDLKTQSIELALYNRLQEAINKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEENDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYINRGDCFFKLQQWQFALADY 1489
            KS   K + + P+      N       +G +    G+   AI HF   + L P     +VN   +F +   F  A+  Y +A  LD  N      LA +Y       ++QG +  A++S  KAIE+ P  P  +      L       E     N  +  N ++ D     A +                 LN ++  L+ +A  +    A   ++L +    L L   LQ A+N    AI ++P   D +   G  ++ L++   A+  +  A+      +   T+  A       + D           +++I     A++ + + P+ + N   C   +  W    ADY
Sbjct:  167 KSCYLKAIETYPAFAVAWSN-------VGCIFNAQGDIWLAIHHFEKAVTLDPNFLDAHVNLGHVFKEAKIFDRAVAAYTKALTLDSDNPILHGNLACVY-------YEQGLYDLAIDSYRKAIELQPNFPDAYCNLANALKEKGNVLEAEKCYNTALRLNPNHADSLNNLANIKRE------------QGLNEEAMNLYKKALEIYPEFAVAHSNLASM---LQLQGHLQSALNHYREAIKISPNFADAYSNMGNTFKELQDLPNAVQCYQRAI------QIKPTFADAHSNLASVYKD-------TGNINEAIGSYTTALKIKPNYPEAFCNLTHCLQIVCDW----ADY 472          
BLAST of Tetratricopeptide repeat domain 16 vs. Planmine SMEST
Match: SMESG000020957.1 (SMESG000020957.1)

HSP 1 Score: 49.2914 bits (116), Expect = 8.184e-6
Identity = 31/116 (26.72%), Postives = 55/116 (47.41%), Query Frame = 2
Query:  494 DNRASEKYAI-GMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGY 838
            D +A+E+    G + +    + DA+S ++  I L P+   YY NRA  + +L+  ++AI +   A  +D    + ++R+   Y          G F  A+    +AIE+ P N  Y
Sbjct:   75 DKKAAERLKTQGNICMGENLFSDAVSCYSKAIELDPRNAVYYCNRAAAYSKLNKNENAIEDCHSALKIDAKYGKAYSRMGLAYT-------GMGKFDEAIVCYKRAIEIEPDNQNY 183          
BLAST of Tetratricopeptide repeat domain 16 vs. Planmine SMEST
Match: SMESG000020957.1 (SMESG000020957.1)

HSP 1 Score: 49.2914 bits (116), Expect = 8.665e-6
Identity = 31/116 (26.72%), Postives = 55/116 (47.41%), Query Frame = 2
Query:  494 DNRASEKYAI-GMVALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKRACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNPGY 838
            D +A+E+    G + +    + DA+S ++  I L P+   YY NRA  + +L+  ++AI +   A  +D    + ++R+   Y          G F  A+    +AIE+ P N  Y
Sbjct:   54 DKKAAERLKTQGNICMGENLFSDAVSCYSKAIELDPRNAVYYCNRAAAYSKLNKNENAIEDCHSALKIDAKYGKAYSRMGLAYT-------GMGKFDEAIVCYKRAIEIEPDNQNY 162          
The following BLAST results are available for this feature:
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTC165.228e-9137.09tetratricopeptide repeat domain 16 [Source:HGNC Sy... [more]
TTC64.612e-821.30tetratricopeptide repeat domain 6 [Source:HGNC Sym... [more]
TTC66.818e-821.30tetratricopeptide repeat domain 6 [Source:HGNC Sym... [more]
DNAJC79.664e-825.55DnaJ heat shock protein family (Hsp40) member C7 [... [more]
TTC66.020e-621.33tetratricopeptide repeat domain 6 [Source:HGNC Sym... [more]
back to top
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tpr26.613e-821.40gene:FBgn0032586 transcript:FBtr0080866[more]
Tpr26.613e-821.40gene:FBgn0032586 transcript:FBtr0333487[more]
Tpr22.092e-722.31gene:FBgn0032586 transcript:FBtr0333486[more]
Tpr22.263e-722.31gene:FBgn0032586 transcript:FBtr0080867[more]
Tpr22.263e-722.31gene:FBgn0032586 transcript:FBtr0333488[more]
back to top
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ttc161.727e-9538.97tetratricopeptide repeat domain 16 [Source:ZFIN;Ac... [more]
ttc168.519e-9438.97tetratricopeptide repeat domain 16 [Source:ZFIN;Ac... [more]
CABZ01060936.12.301e-3147.29tetratricopeptide repeat protein 16-like [Source:N... [more]
back to top
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cdh181.200e-9533.53cadherin 18 [Source:Xenbase;Acc:XB-GENE-982900][more]
back to top
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttc169.827e-9738.85tetratricopeptide repeat domain 16 [Source:MGI Sym... [more]
Ttc169.827e-9738.85tetratricopeptide repeat domain 16 [Source:MGI Sym... [more]
Ttc169.827e-9738.85tetratricopeptide repeat domain 16 [Source:MGI Sym... [more]
Ttc162.771e-9638.85tetratricopeptide repeat domain 16 [Source:MGI Sym... [more]
Ttc164.962e-9638.85tetratricopeptide repeat domain 16 [Source:MGI Sym... [more]
back to top
BLAST of Tetratricopeptide repeat domain 16 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8C1F5|TTC16_MOUSE2.131e-9538.63Tetratricopeptide repeat protein 16 OS=Mus musculu... [more]
sp|Q95LZ5|TTC16_MACFA1.425e-9037.09Tetratricopeptide repeat protein 16 OS=Macaca fasc... [more]
sp|Q8NEE8|TTC16_HUMAN2.511e-9037.09Tetratricopeptide repeat protein 16 OS=Homo sapien... [more]
sp|P0CT30|SGT2_USTMA2.379e-730.91Small glutamine-rich tetratricopeptide repeat-cont... [more]
sp|Q9M8Y0|SEC_ARATH1.671e-623.42Probable UDP-N-acetylglucosamine--peptide N-acetyl... [more]
back to top
BLAST of Tetratricopeptide repeat domain 16 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|172220781.233e-14842.39tr|A0A3S1A987|A0A3S1A987_ELYCH TPR_REGION domain-c... [more]
gnl|BL_ORD_ID|238999736.581e-14444.67tr|K1PP71|K1PP71_CRAGI Tetratricopeptide repeat pr... [more]
gnl|BL_ORD_ID|183004528.228e-14240.55tr|A0A1I8J5W5|A0A1I8J5W5_9PLAT TPR_REGION domain-c... [more]
gnl|BL_ORD_ID|183074009.823e-14240.55tr|A0A1I8H2Z4|A0A1I8H2Z4_9PLAT TPR_REGION domain-c... [more]
gnl|BL_ORD_ID|183372362.636e-14140.55tr|A0A267GYZ9|A0A267GYZ9_9PLAT TPR_REGION domain-c... [more]
back to top
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ttc162.834e-10238.74tetratricopeptide repeat domain 16 [Source:ZFIN;Ac... [more]
ttc163.419e-10238.74tetratricopeptide repeat domain 16 [Source:ZFIN;Ac... [more]
ttc69.289e-624.60tetratricopeptide repeat domain 6 [Source:ZFIN;Acc... [more]
ttc69.334e-624.60tetratricopeptide repeat domain 6 [Source:ZFIN;Acc... [more]
back to top
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ttc164.176e-8039.03tetratricopeptide repeat domain 16 [Source:ZFIN;Ac... [more]
sgta9.533e-826.55small glutamine-rich tetratricopeptide repeat (TPR... [more]
back to top
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO345171.589e-12355.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274181.705e-5056.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403442.363e-823.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327031.246e-621.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetratricopeptide repeat domain 16 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat domain 16 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020147.10.000e+099.30SMESG000020147.1[more]
SMESG000071973.13.012e-720.88SMESG000071973.1[more]
SMESG000002813.16.061e-621.02SMESG000002813.1[more]
SMESG000020957.18.184e-626.72SMESG000020957.1[more]
SMESG000020957.18.665e-626.72SMESG000020957.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006754 ID=SMED30006754|Name=Tetratricopeptide repeat domain 16|organism=Schmidtea mediterranea sexual|type=transcript|length=2750bp
TATTAAATTATGATAATTTTATTTAATTATTTATAATTATAAATATTTTT
ATGAATATATTTCTTTAAAAAAACTTGATCAAATGACAAATAAATCCGAA
TCATTGTATTCAACAGACGCTCAATCAGTGTCGTTTATTTCTTCTAATTT
TGACAATTTGGAAGTAGCTCGTGCAAAAGCTGCTGAATCAGTCGTTAATC
TAAACCAGTTTTTTCCTGATATTCAAACTGAAATCAAAGTATATTCAGAT
AAATATTCTTTACTTGGTGACAATTCGGAAAATATTGAGAATGAGAATTT
TGATAATAAATTGATCGAAAATCAAAAAGAACCTAATGAAGAAAATAATG
CCAATCAATCTACTGTCTTTTCCACTGAATTAAGTTCGGGGGTAACTGAA
GAAAATTCTGAGCTGTCTAATGGAATTAACTTCATGCCAAAATCATGGAC
TAGCAAAGGTCTTCATTCTCTTCCGTCTATGACTCAAATACTCGACAACC
GTGCCAGTGAAAAATACGCAATTGGAATGGTTGCTTTGAAATCTGGCAAC
TGGATTGATGCCATTTCTCATTTTACTCATTGCATTCATCTCAAGCCTAA
AGAGCCTTCCTATTATGTTAACAGAGCCGAAATCTTTCTCCAATTATCTG
ATTTCCAATCAGCTATTCTCAATTACAAACGAGCCTGCATTCTCGATCCT
GGTAATGAAGAATTCTTTAACCGACTCGCCTTTCTCTACGTCTTTCAAAG
TCAAATTCTTTTCGATCAAGGCCATTTCTCTCACGCTCTCGAATCTATCG
GCAAAGCCATCGAAATGGTTCCCGGGAATCCCGGTTACCACATTCGAGCA
ATCGCATGCTTGGCGGCATTAAATCGCCATTCCGAATGTCTTGCTCTTGT
TAACAAACAAATCGACGAGAACAATTCCAATCCGGATTTTTTCGTACTTC
GTGCCAAACTCCACTCTCATTTCCGGAACTTTTCTCTTTGTTATTACGAC
TTAATTGACGCTTTGAATTTGGACTCGTTGCACGCGGAAGCAAAAAACGT
ACTGACGAGCATGGCAAGTCAAGCGAACGATTTAAAAACCCAATCGATTG
AACTCGCGCTTTACAATCGATTGCAAGAAGCAATCAATAAAATCTCTCTT
GCAATCGATTTGAATCCGATTATCGGCGATTATCACGTGAAACGGGGCGC
TTTTTATCGACGATTAAAAAATTTCACTGCCGCAATTGACGATTTCATAA
TGGCAATGGACAAAGTCGATCACGATGAAGAGAATGACACCTACAAACAA
GCACAACGGCAATTCATTTTGACTTTCAATGATTTCGCTGTCGAATGCTT
CGAGAAAAATTGTTTCGATGACTCCATCAAACTGTTGAACAAAGCGATTC
AAGGCGAAAAATCCGAGCCGCAATTCTACATCAATCGAGGCGACTGTTTT
TTCAAATTGCAACAATGGCAATTCGCTCTCGCCGATTATCAACAAGCCGG
CAGTTTGAGTGAAGAGGTTCGTCGAGTGACTTTAGCGAGAATTGCAGCCG
TTCATTTTTCAATCGGTCGACAGCAATTTGAATCGAATCAATTTCGAGAG
GCAGAAATTGCTCTCAGTGAATCCATCAAAAATAATCCATTTCCGGCAAT
GTTTTGGAATGTGCGAGCGAAATGTCGATATGTTCTCGACGAGTTTAAAG
GCGCAAGAAAGGATTTGATTTGTGGAATTCTGCTAAGTGGTTTCGATAAA
GCAATGGAATCGACATTTTGTCGATTGTTTCCCAACAAAAGCATGTCTCA
TGTTCTCGGTAGTAAATTGGCGGGGTCAGCCAGACAGGAATTGGATCAGA
TTATAAAGGAGCGAGAACAGTTTATTGACATTGAGAGAGATCACTTTCGT
AAGTCAAAAATCAATGAAAATAAGATGGAGAATGTAGCGAAAGTTAGAAG
CTGTATTTTGGAGGAGAAACTTCTATCGGATTCCATCGATCAATATCGGG
AGTTGGATTGTCGGTTTAAACAGTGTTCGGAAAATAAAGGCTCCATTGGA
AAGTCTGTGGGCAATGTTACCGGGTTACCTGATCTTCAAATATCGAAATC
GGACGAATCGAATATTCTTGGGATTGTTGGAAATCGAGAAGGGAACAAGT
TTTATATGGATAAACGGGGGGTCATCATAAGGGCATCTGAACCACATGGG
TGGAGAAAATTTAAAAGTGGAATAGAAATGAAATAATGTCTTATCTTTCA
ATTTGTATATTTACAAAGAATTTATTAAATCCAAAGAACAATTTTGTTAA
CAATAAAACACCAAGAATGAATTTATCAGGTCACCTCAATTAAACAAACC
AGTTTATTCTTATCTCTCTGGGTCAATATTTAATTTTGTATTTAAGAAGA
AATTTTTGCGTCTGTTTTTAATTATTAATTGATTAAAAATATTAATCTAA
AGTCTGAAAAGAAATGAAATAATTAGTTTTACATTTTTGTTTAGTTTAAG
GTTATTAACGAACAAAATTATCTATAATTATTATTAGGCTCGATGACTTT
ACATTGCGGAAGGATTTTATAAATAGTAATTCCCGGAAAATCGAATTTTT
GTAATATTTTCTGTAGTTTTATTTCCACGATTTTCTTTTGTGTAATTTAC
TCGTCACCTCACGCAAATAAGTATGTTGGACAAAAACTAAGAAAAAAACA
TACGCTTTTTTGATCTGTACGGTAATTAAAACTAAAAAAACTATCGGAAA
back to top

protein sequence of SMED30006754-orf-1

>SMED30006754-orf-1 ID=SMED30006754-orf-1|Name=SMED30006754-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=718bp
MTNKSESLYSTDAQSVSFISSNFDNLEVARAKAAESVVNLNQFFPDIQTE
IKVYSDKYSLLGDNSENIENENFDNKLIENQKEPNEENNANQSTVFSTEL
SSGVTEENSELSNGINFMPKSWTSKGLHSLPSMTQILDNRASEKYAIGMV
ALKSGNWIDAISHFTHCIHLKPKEPSYYVNRAEIFLQLSDFQSAILNYKR
ACILDPGNEEFFNRLAFLYVFQSQILFDQGHFSHALESIGKAIEMVPGNP
GYHIRAIACLAALNRHSECLALVNKQIDENNSNPDFFVLRAKLHSHFRNF
SLCYYDLIDALNLDSLHAEAKNVLTSMASQANDLKTQSIELALYNRLQEA
INKISLAIDLNPIIGDYHVKRGAFYRRLKNFTAAIDDFIMAMDKVDHDEE
NDTYKQAQRQFILTFNDFAVECFEKNCFDDSIKLLNKAIQGEKSEPQFYI
NRGDCFFKLQQWQFALADYQQAGSLSEEVRRVTLARIAAVHFSIGRQQFE
SNQFREAEIALSESIKNNPFPAMFWNVRAKCRYVLDEFKGARKDLICGIL
LSGFDKAMESTFCRLFPNKSMSHVLGSKLAGSARQELDQIIKEREQFIDI
ERDHFRKSKINENKMENVAKVRSCILEEKLLSDSIDQYRELDCRFKQCSE
NKGSIGKSVGNVTGLPDLQISKSDESNILGIVGNREGNKFYMDKRGVIIR
ASEPHGWRKFKSGIEMK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 317..337
NoneNo IPR availablePFAMPF13432TPR_16coord: 145..208
e-value: 0.0085
score: 16.7
coord: 494..545
e-value: 0.0061
score: 17.2
NoneNo IPR availablePANTHERPTHR45153FAMILY NOT NAMEDcoord: 115..599
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 331..364
e-value: 160.0
score: 4.4
coord: 522..555
e-value: 84.0
score: 6.9
coord: 250..283
e-value: 460.0
score: 0.4
coord: 141..174
e-value: 6.5
score: 15.7
coord: 216..249
e-value: 20.0
score: 12.4
coord: 488..521
e-value: 11.0
score: 14.6
coord: 175..208
e-value: 9.3E-4
score: 28.5
coord: 446..479
e-value: 0.11
score: 21.6
coord: 412..445
e-value: 340.0
score: 1.5
coord: 365..398
e-value: 3.4
score: 16.7
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 488..521
score: 6.933
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 446..479
score: 7.375
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 175..208
score: 9.529
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 141..174
score: 8.437
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 216..249
score: 8.172
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 365..398
score: 6.077
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 412..560
e-value: 4.7E-14
score: 54.3
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 328..411
e-value: 6.9E-8
score: 34.4
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 128..223
e-value: 1.0E-16
score: 63.0
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 224..327
e-value: 6.6E-11
score: 44.0
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 126..529
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 141..521
score: 22.128