CLUMA_CG020736, isoform A

Overview
NameCLUMA_CG020736, isoform A
Smed IDSMED30006749
Length (bp)3019
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CLUMA_CG020736, isoform A (SMED30006749) t-SNE clustered cells

Violin plots show distribution of expression levels for CLUMA_CG020736, isoform A (SMED30006749) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CLUMA_CG020736, isoform A (SMED30006749) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CLUMA_CG020736, isoform A (SMED30006749) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006749

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30006749h1SMcG0003243 dd_Smed_v4_4810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006749h1SMcG0003243 dd_Smed_v4_4810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006749h1SMcG0003243 dd_Smed_v4_4810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30006749h1SMcG0003243 Contig3963newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30006749h1SMcG0003243 Contig3963uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30006749h1SMcG0002679 Contig3963newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30006749h1SMcG0002679 Contig3963uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30006749h1SMcG0015957 Contig3963newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30006749h1SMcG0015957 Contig3963uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30006749h1SMcG0003243 dd_Smed_v4_4810_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Human
Match: PLEKHM3 (pleckstrin homology domain containing M3 [Source:HGNC Symbol;Acc:HGNC:34006])

HSP 1 Score: 103.605 bits (257), Expect = 7.865e-22
Identity = 70/224 (31.25%), Postives = 110/224 (49.11%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINL-ADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQ 2880
            C+ C +   L   K  + +Y G  YC++C      +IP  I++NWD ++  VS   K FL  +   P I++  ++  L+     L+ V +LR +L  L   + SC    ++ +R  +FPR+Y+L  I    LYS+ DL  +  G L   L  VI K A  HV  C +C  K   C+ C +  +++Y  E      C   SC +V H ECK  ++    C RC++
Sbjct:  514 CAGCQRSIGLSNGKAKVCNYSGWYYCSSCHVDDSFLIPARIVHNWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENAMLYHHAEPLAAVLRLRQRLKSLRAYLFSCRAAVAEDLRRRIFPREYLLQQIH---LYSLADLQQVIEGKLAPFLGKVI-KFATSHVYSCSLCSQKGFICEIC-NNGEILYPFEDISTSRCE--SCGAVFHSECKEKSVP---CPRCVR 727          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Human
Match: PLEKHM3 (pleckstrin homology domain containing M3 [Source:HGNC Symbol;Acc:HGNC:34006])

HSP 1 Score: 103.605 bits (257), Expect = 7.865e-22
Identity = 70/224 (31.25%), Postives = 110/224 (49.11%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINL-ADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQ 2880
            C+ C +   L   K  + +Y G  YC++C      +IP  I++NWD ++  VS   K FL  +   P I++  ++  L+     L+ V +LR +L  L   + SC    ++ +R  +FPR+Y+L  I    LYS+ DL  +  G L   L  VI K A  HV  C +C  K   C+ C +  +++Y  E      C   SC +V H ECK  ++    C RC++
Sbjct:  514 CAGCQRSIGLSNGKAKVCNYSGWYYCSSCHVDDSFLIPARIVHNWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENAMLYHHAEPLAAVLRLRQRLKSLRAYLFSCRAAVAEDLRRRIFPREYLLQQIH---LYSLADLQQVIEGKLAPFLGKVI-KFATSHVYSCSLCSQKGFICEIC-NNGEILYPFEDISTSRCE--SCGAVFHSECKEKSVP---CPRCVR 727          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Human
Match: PLEKHM1 (pleckstrin homology and RUN domain containing M1 [Source:HGNC Symbol;Acc:HGNC:29017])

HSP 1 Score: 95.5153 bits (236), Expect = 3.323e-19
Identity = 71/244 (29.10%), Postives = 119/244 (48.77%), Query Frame = 1
Query: 2191 GLNSVFGGLCSTCSQPLETNKVI--IDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITFA 2913
            GL+S  G  C+ CS+ +  + V   +  + G  YC  C     SVIP  II+NWD  ++ +     +FL++I + P INL   + +L++ +  +  + + R +L LL   +  C     K + + +  R+Y+L S      +S+ DL  +  GV E  L  +I + A  HV  C +C  +   C  C+    +I+  E D    C+   CK+V H+ C++  +V   C RC +  K Q+   FA
Sbjct:  823 GLDSQ-GCFCAGCSRQIGFSFVRPKLCAFSGLYYCDICHQDDASVIPARIIHNWDLTKRPICRQALKFLTQIRAQPLINLQMVNASLYEHVERMHLIGRRREQLKLLGDYLGLCRSGALKELSKRLNHRNYLLESPHR---FSVADLQQIADGVYEGFLKALI-EFASQHVYHCDLCTQRGFICQICQ-HHDIIFPFEFDTTVRCA--ECKTVFHQSCQA--VVKKGCPRCARRRKYQEQNIFA 1056          

HSP 2 Score: 41.9726 bits (97), Expect = 9.537e-8
Identity = 31/114 (27.19%), Postives = 55/114 (48.25%), Query Frame = 1
Query:   22 VDKNIILDVLKK----SIHNLLQSNELIDLVEIEDSIYTQNLCSAIEALFIQGQLKNQSFKLLSKISRRKHSYEYD-----FWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW 336
            +D    + V+KK    S+  L +    +D V   +      +CSA+EA+FI G L  +  +  +   R+K +++       FW  +K +  K+++  LE+ +F  T VG  R W
Sbjct:    9 LDPQAAIPVIKKKLVGSVKALQKQYVSLDTVVTSEDGDANTMCSALEAVFIHG-LHAKHIRAEAGGKRKKSAHQKPLPQPVFWPLLKAVTHKHIISELEHLTFVNTDVGRCRAW 121          

HSP 3 Score: 35.8094 bits (81), Expect = 9.537e-8
Identity = 15/43 (34.88%), Postives = 25/43 (58.14%), Query Frame = 2
Query:  380 VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKME 508
             WLR ALN+  +  Y+  +  +  RL ++Y   +L+RD E+ E
Sbjct:  120 AWLRLALNDGLMECYLKLLLQEQARLHEYYQPTALLRDAEEGE 162          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Human
Match: PLEKHM1 (pleckstrin homology and RUN domain containing M1 [Source:HGNC Symbol;Acc:HGNC:29017])

HSP 1 Score: 95.5153 bits (236), Expect = 3.323e-19
Identity = 71/244 (29.10%), Postives = 119/244 (48.77%), Query Frame = 1
Query: 2191 GLNSVFGGLCSTCSQPLETNKVI--IDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITFA 2913
            GL+S  G  C+ CS+ +  + V   +  + G  YC  C     SVIP  II+NWD  ++ +     +FL++I + P INL   + +L++ +  +  + + R +L LL   +  C     K + + +  R+Y+L S      +S+ DL  +  GV E  L  +I + A  HV  C +C  +   C  C+    +I+  E D    C+   CK+V H+ C++  +V   C RC +  K Q+   FA
Sbjct:  823 GLDSQ-GCFCAGCSRQIGFSFVRPKLCAFSGLYYCDICHQDDASVIPARIIHNWDLTKRPICRQALKFLTQIRAQPLINLQMVNASLYEHVERMHLIGRRREQLKLLGDYLGLCRSGALKELSKRLNHRNYLLESPHR---FSVADLQQIADGVYEGFLKALI-EFASQHVYHCDLCTQRGFICQICQ-HHDIIFPFEFDTTVRCA--ECKTVFHQSCQA--VVKKGCPRCARRRKYQEQNIFA 1056          

HSP 2 Score: 41.9726 bits (97), Expect = 9.537e-8
Identity = 31/114 (27.19%), Postives = 55/114 (48.25%), Query Frame = 1
Query:   22 VDKNIILDVLKK----SIHNLLQSNELIDLVEIEDSIYTQNLCSAIEALFIQGQLKNQSFKLLSKISRRKHSYEYD-----FWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW 336
            +D    + V+KK    S+  L +    +D V   +      +CSA+EA+FI G L  +  +  +   R+K +++       FW  +K +  K+++  LE+ +F  T VG  R W
Sbjct:    9 LDPQAAIPVIKKKLVGSVKALQKQYVSLDTVVTSEDGDANTMCSALEAVFIHG-LHAKHIRAEAGGKRKKSAHQKPLPQPVFWPLLKAVTHKHIISELEHLTFVNTDVGRCRAW 121          

HSP 3 Score: 35.8094 bits (81), Expect = 9.537e-8
Identity = 15/43 (34.88%), Postives = 25/43 (58.14%), Query Frame = 2
Query:  380 VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKME 508
             WLR ALN+  +  Y+  +  +  RL ++Y   +L+RD E+ E
Sbjct:  120 AWLRLALNDGLMECYLKLLLQEQARLHEYYQPTALLRDAEEGE 162          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Human
Match: PLEKHM1 (pleckstrin homology and RUN domain containing M1 [Source:HGNC Symbol;Acc:HGNC:29017])

HSP 1 Score: 95.5153 bits (236), Expect = 3.323e-19
Identity = 71/244 (29.10%), Postives = 119/244 (48.77%), Query Frame = 1
Query: 2191 GLNSVFGGLCSTCSQPLETNKVI--IDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITFA 2913
            GL+S  G  C+ CS+ +  + V   +  + G  YC  C     SVIP  II+NWD  ++ +     +FL++I + P INL   + +L++ +  +  + + R +L LL   +  C     K + + +  R+Y+L S      +S+ DL  +  GV E  L  +I + A  HV  C +C  +   C  C+    +I+  E D    C+   CK+V H+ C++  +V   C RC +  K Q+   FA
Sbjct:  823 GLDSQ-GCFCAGCSRQIGFSFVRPKLCAFSGLYYCDICHQDDASVIPARIIHNWDLTKRPICRQALKFLTQIRAQPLINLQMVNASLYEHVERMHLIGRRREQLKLLGDYLGLCRSGALKELSKRLNHRNYLLESPHR---FSVADLQQIADGVYEGFLKALI-EFASQHVYHCDLCTQRGFICQICQ-HHDIIFPFEFDTTVRCA--ECKTVFHQSCQA--VVKKGCPRCARRRKYQEQNIFA 1056          

HSP 2 Score: 41.9726 bits (97), Expect = 9.537e-8
Identity = 31/114 (27.19%), Postives = 55/114 (48.25%), Query Frame = 1
Query:   22 VDKNIILDVLKK----SIHNLLQSNELIDLVEIEDSIYTQNLCSAIEALFIQGQLKNQSFKLLSKISRRKHSYEYD-----FWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW 336
            +D    + V+KK    S+  L +    +D V   +      +CSA+EA+FI G L  +  +  +   R+K +++       FW  +K +  K+++  LE+ +F  T VG  R W
Sbjct:    9 LDPQAAIPVIKKKLVGSVKALQKQYVSLDTVVTSEDGDANTMCSALEAVFIHG-LHAKHIRAEAGGKRKKSAHQKPLPQPVFWPLLKAVTHKHIISELEHLTFVNTDVGRCRAW 121          

HSP 3 Score: 35.8094 bits (81), Expect = 9.537e-8
Identity = 15/43 (34.88%), Postives = 25/43 (58.14%), Query Frame = 2
Query:  380 VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKME 508
             WLR ALN+  +  Y+  +  +  RL ++Y   +L+RD E+ E
Sbjct:  120 AWLRLALNDGLMECYLKLLLQEQARLHEYYQPTALLRDAEEGE 162          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Celegans
Match: cup-14 (pep chromosome:WBcel235:II:13855788:13860058:-1 gene:WBGene00013093.1 transcript:Y51H1A.2e.5 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cup-14)

HSP 1 Score: 90.1225 bits (222), Expect = 4.159e-19
Identity = 63/206 (30.58%), Postives = 101/206 (49.03%), Query Frame = 1
Query: 2272 DGKLYCTNC-QSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINL-ADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQH 2883
            D K YCT C +SG K  IP  ++ +WD+ ++ VS   + +         IN+   +  L+   P L   R+LR KL L+ + + +C    S+  R  ++P++Y+   I   D+YS  DLI + SG L++ L  ++ K +I HV  C +C+ K   C+ C    +VIY    +    C    C S  H EC      S  C +C++ 
Sbjct:  122 DSKYYCTECMKSGGKVSIPARVVMDWDWRERAVSDRGRAWYEANQEKALINIKTTNSRLYAHAPALEETRKLREKLQLVSMYLFTCRESVSEDFRRRLWPKEYLRSEI---DVYSFADLIDVKSGALQRRLNSLL-KHSINHVMTCTLCKQKGFCCELC-TVNEVIYPFNTESTHRCLV--CFSAFHVECWR---TSGDCPKCVRR 317          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Celegans
Match: cup-14 (pep chromosome:WBcel235:II:13855788:13860079:-1 gene:WBGene00013093.1 transcript:Y51H1A.2e.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cup-14)

HSP 1 Score: 90.1225 bits (222), Expect = 4.159e-19
Identity = 63/206 (30.58%), Postives = 101/206 (49.03%), Query Frame = 1
Query: 2272 DGKLYCTNC-QSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINL-ADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQH 2883
            D K YCT C +SG K  IP  ++ +WD+ ++ VS   + +         IN+   +  L+   P L   R+LR KL L+ + + +C    S+  R  ++P++Y+   I   D+YS  DLI + SG L++ L  ++ K +I HV  C +C+ K   C+ C    +VIY    +    C    C S  H EC      S  C +C++ 
Sbjct:  122 DSKYYCTECMKSGGKVSIPARVVMDWDWRERAVSDRGRAWYEANQEKALINIKTTNSRLYAHAPALEETRKLREKLQLVSMYLFTCRESVSEDFRRRLWPKEYLRSEI---DVYSFADLIDVKSGALQRRLNSLL-KHSINHVMTCTLCKQKGFCCELC-TVNEVIYPFNTESTHRCLV--CFSAFHVECWR---TSGDCPKCVRR 317          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Celegans
Match: cup-14 (pep chromosome:WBcel235:II:13855788:13861040:-1 gene:WBGene00013093.1 transcript:Y51H1A.2e.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cup-14)

HSP 1 Score: 90.1225 bits (222), Expect = 4.159e-19
Identity = 63/206 (30.58%), Postives = 101/206 (49.03%), Query Frame = 1
Query: 2272 DGKLYCTNC-QSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINL-ADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQH 2883
            D K YCT C +SG K  IP  ++ +WD+ ++ VS   + +         IN+   +  L+   P L   R+LR KL L+ + + +C    S+  R  ++P++Y+   I   D+YS  DLI + SG L++ L  ++ K +I HV  C +C+ K   C+ C    +VIY    +    C    C S  H EC      S  C +C++ 
Sbjct:  122 DSKYYCTECMKSGGKVSIPARVVMDWDWRERAVSDRGRAWYEANQEKALINIKTTNSRLYAHAPALEETRKLREKLQLVSMYLFTCRESVSEDFRRRLWPKEYLRSEI---DVYSFADLIDVKSGALQRRLNSLL-KHSINHVMTCTLCKQKGFCCELC-TVNEVIYPFNTESTHRCLV--CFSAFHVECWR---TSGDCPKCVRR 317          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Celegans
Match: cup-14 (pep chromosome:WBcel235:II:13855788:13868119:-1 gene:WBGene00013093.1 transcript:Y51H1A.2e.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cup-14)

HSP 1 Score: 90.1225 bits (222), Expect = 4.159e-19
Identity = 63/206 (30.58%), Postives = 101/206 (49.03%), Query Frame = 1
Query: 2272 DGKLYCTNC-QSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINL-ADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQH 2883
            D K YCT C +SG K  IP  ++ +WD+ ++ VS   + +         IN+   +  L+   P L   R+LR KL L+ + + +C    S+  R  ++P++Y+   I   D+YS  DLI + SG L++ L  ++ K +I HV  C +C+ K   C+ C    +VIY    +    C    C S  H EC      S  C +C++ 
Sbjct:  122 DSKYYCTECMKSGGKVSIPARVVMDWDWRERAVSDRGRAWYEANQEKALINIKTTNSRLYAHAPALEETRKLREKLQLVSMYLFTCRESVSEDFRRRLWPKEYLRSEI---DVYSFADLIDVKSGALQRRLNSLL-KHSINHVMTCTLCKQKGFCCELC-TVNEVIYPFNTESTHRCLV--CFSAFHVECWR---TSGDCPKCVRR 317          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Celegans
Match: cup-14 (pep chromosome:WBcel235:II:13855788:13858798:-1 gene:WBGene00013093.1 transcript:Y51H1A.2e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cup-14)

HSP 1 Score: 90.1225 bits (222), Expect = 4.159e-19
Identity = 63/206 (30.58%), Postives = 101/206 (49.03%), Query Frame = 1
Query: 2272 DGKLYCTNC-QSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINL-ADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQH 2883
            D K YCT C +SG K  IP  ++ +WD+ ++ VS   + +         IN+   +  L+   P L   R+LR KL L+ + + +C    S+  R  ++P++Y+   I   D+YS  DLI + SG L++ L  ++ K +I HV  C +C+ K   C+ C    +VIY    +    C    C S  H EC      S  C +C++ 
Sbjct:  122 DSKYYCTECMKSGGKVSIPARVVMDWDWRERAVSDRGRAWYEANQEKALINIKTTNSRLYAHAPALEETRKLREKLQLVSMYLFTCRESVSEDFRRRLWPKEYLRSEI---DVYSFADLIDVKSGALQRRLNSLL-KHSINHVMTCTLCKQKGFCCELC-TVNEVIYPFNTESTHRCLV--CFSAFHVECWR---TSGDCPKCVRR 317          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Fly
Match: Plekhm1 (gene:FBgn0034694 transcript:FBtr0071758)

HSP 1 Score: 105.145 bits (261), Expect = 1.157e-22
Identity = 73/247 (29.55%), Postives = 117/247 (47.37%), Query Frame = 1
Query: 2113 DMITEKIEMKRLMDIFPGVDVCSTNDGLNSVFGGLCSTCSQPLETN--KVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHP--NINLADHLTLF--DVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            +++T + +M  L  +   +   +   GL++  G LC +C  PL        +  + G  YC +C      +IP  IIYNWDF +  VS     FL+E  SHP  ++ L +    F  D + EL   + LR +LN +   + +C   + + ++     R+Y+   I    LYSI DL ++  GVL + L     K+   HV KC +C +K   C+ C+   +V+Y   I     C   +C +V H EC
Sbjct:  450 ELLTSEFDMVELQQMVAQLCQLAREPGLDAQ-GFLCKSCQHPLGIGYSNFQVCAFSGSYYCNSCMDVEMQLIPARIIYNWDFRKYSVSKRAATFLAEFRSHPFLDMQLLNPRIYFASDAMAEL---QSLRIRLNFIRAYLYTCAPSSIELLQNQFAGREYLYEHIH---LYSIADLALIQRGVLCQQLQKAF-KLGEAHVLKCRLCHLKGFICEICQS-PRVLYPFHISTTFRCL--ACGAVFHAEC 685          

HSP 2 Score: 46.595 bits (109), Expect = 3.403e-7
Identity = 17/56 (30.36%), Postives = 35/56 (62.50%), Query Frame = 2
Query:  380 VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKMETFCGLLTCMFVFI 547
             W+R +LNE    SY++++R +   L Q+Y +++L+RD E +ET   ++  +  ++
Sbjct:  122 AWVRQSLNESVFSSYLNNMRKNGSALSQYYKRNALMRDSEGLETAAKIMESLEAYV 177          

HSP 3 Score: 28.4906 bits (62), Expect = 3.403e-7
Identity = 20/75 (26.67%), Postives = 35/75 (46.67%), Query Frame = 1
Query:  124 TQNLCSAIEALFIQGQLKNQ----SFKLLSKISRRKHSYEYDFWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW 336
            T  LC+ +EALF+ G LK+     +F +++    R+   E  FW      + K ++  ++  S   +  G  R W
Sbjct:   52 TSALCTTLEALFLHG-LKDSFLSATFNVIAGDVERRP--EPSFWAPCMVFMHKQVIEQVQGLSQITSETGQCRAW 123          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Fly
Match: CG11534 (gene:FBgn0046296 transcript:FBtr0075995)

HSP 1 Score: 73.1738 bits (178), Expect = 6.396e-13
Identity = 67/237 (28.27%), Postives = 110/237 (46.41%), Query Frame = 1
Query: 2191 GLNSVFGGLCSTCSQPLETNKVIID----HYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINL-ADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETS-KRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYC-ECSTPSCKSVIHKECKSPTIVSFYCRRCIQ 2880
            GL S  G  C+ C   L      I+     Y G  YC  C     + IP  II+NWDF+ + VS T  + +   ++ P I L  D+  LF  + +L  V++LR  L  +   + +C I +  K + + +  R ++  S   ++ YS+ DL  + SG L + L  V  K    H++ C +C  +   C+ C + +    I   D+ C +C    C S+ H+ C   T  +  C +CI+
Sbjct:  234 GLASQ-GYKCAECGTMLNIKNTWIEPRLCDYSGLYYCPRCNWNDSNFIPARIIHNWDFSPRRVSRTALQEIRLFLNKPLIRLEEDNPKLFVFVEKLCAVKKLRQNLVHMRHYLAACKIASELKLVDQQLGVRRHLAQS---NEFYSLSDLSQVESGALSEFLQGVF-KAFNDHIRSCPMCLAQAYICEICSNNE---VIFPFDDGCIKCD--QCNSIFHRVCL--TRKNMICPKCIR 458          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Fly
Match: CG12772 (gene:FBgn0030055 transcript:FBtr0331728)

HSP 1 Score: 59.6918 bits (143), Expect = 1.283e-8
Identity = 46/211 (21.80%), Postives = 89/211 (42.18%), Query Frame = 1
Query: 2218 CSTCSQPLETNKVIIDH-----YDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            C+ C   +   K +  H     Y GK  CT C     S IP  I+ +WDF    V     R + ++ + P  ++ D  +      EL++ R+ R +L  +   + +C   T    RE  F         ++ D++S+ D + + +  + +++  VI  ++  HV  C++C  +   C+ C+  + +       + C+     C +  H  C
Sbjct:  603 CAGCG--MRVAKHLQQHFRYCTYLGKYLCTGCHRNQISAIPARILRSWDFRCYPVCSFAYRLIEQMYAFPLFHVPDLNSQLYKHKELAKARKRRLQLQAVKGFIANCRFAT----REQSFFNAIPAHITQDPDMWSMCDFVDVQNTSMNRSIKEVI-ALSEQHVHNCVLCTGRAFVCEHCKGGELIYPWQRKVQRCD----RCGACFHNGC 802          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Fly
Match: CG12772 (gene:FBgn0030055 transcript:FBtr0071221)

HSP 1 Score: 59.6918 bits (143), Expect = 1.283e-8
Identity = 46/211 (21.80%), Postives = 89/211 (42.18%), Query Frame = 1
Query: 2218 CSTCSQPLETNKVIIDH-----YDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            C+ C   +   K +  H     Y GK  CT C     S IP  I+ +WDF    V     R + ++ + P  ++ D  +      EL++ R+ R +L  +   + +C   T    RE  F         ++ D++S+ D + + +  + +++  VI  ++  HV  C++C  +   C+ C+  + +       + C+     C +  H  C
Sbjct:  603 CAGCG--MRVAKHLQQHFRYCTYLGKYLCTGCHRNQISAIPARILRSWDFRCYPVCSFAYRLIEQMYAFPLFHVPDLNSQLYKHKELAKARKRRLQLQAVKGFIANCRFAT----REQSFFNAIPAHITQDPDMWSMCDFVDVQNTSMNRSIKEVI-ALSEQHVHNCVLCTGRAFVCEHCKGGELIYPWQRKVQRCD----RCGACFHNGC 802          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Zebrafish
Match: CR407600.1 (pleckstrin homology domain containing, family M, member 3 [Source:NCBI gene;Acc:571507])

HSP 1 Score: 105.916 bits (263), Expect = 8.450e-23
Identity = 72/234 (30.77%), Postives = 115/234 (49.15%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITF 2910
            C+ C +P  L   K  +  Y G  YCT+C      +IP  +++NWD N+  VS   K FL  +   P +++   +  L++    L+ V +LR +L  L   + SC    ++ +R  +FPR+Y+L  +    LYS+ DL  +  G L   L  VI K A  HV  C +CR K   C+ C    +VIY  + +    C    C +V H EC+   + +  C RC++    ++P +F
Sbjct:  464 CAGCQRPVGLSRGKAKVCAYSGWYYCTSCHQDNLFLIPARLLHNWDTNRHKVSKQAKEFLEFVYEEPLLDVQQLNPCLYEHCEPLAAVLKLRQQLQSLRAYLFSCRATVAEDLRRRIFPREYLLQHVH---LYSLADLQQVIDGKLAPFLSKVI-KFASSHVYSCSLCREKGFICELCHT-GQVIYPFQENATKRCE--GCGAVFHAECR---MRAQPCPRCVRRELHKKPASF 687          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Zebrafish
Match: plekhm3 (pleckstrin homology domain containing, family M, member 3 [Source:ZFIN;Acc:ZDB-GENE-070912-382])

HSP 1 Score: 105.916 bits (263), Expect = 8.565e-23
Identity = 72/234 (30.77%), Postives = 115/234 (49.15%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITF 2910
            C+ C +P  L   K  +  Y G  YCT+C      +IP  +++NWD N+  VS   K FL  +   P +++   +  L++    L+ V +LR +L  L   + SC    ++ +R  +FPR+Y+L  +    LYS+ DL  +  G L   L  VI K A  HV  C +CR K   C+ C    +VIY  + +    C    C +V H EC+   + +  C RC++    ++P +F
Sbjct:  466 CAGCQRPVGLSRGKAKVCAYSGWYYCTSCHQDNLFLIPARLLHNWDTNRHKVSKQAKEFLEFVYEEPLLDVQQLNPCLYEHCEPLAAVLKLRQQLQSLRAYLFSCRATVAEDLRRRIFPREYLLQHVH---LYSLADLQQVIDGKLAPFLSKVI-KFASSHVYSCSLCREKGFICELCHT-GQVIYPFQENATKRCE--GCGAVFHAECR---MRAQPCPRCVRRELHKKPASF 689          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Zebrafish
Match: plekhm3 (pleckstrin homology domain containing, family M, member 3 [Source:ZFIN;Acc:ZDB-GENE-070912-382])

HSP 1 Score: 105.916 bits (263), Expect = 8.565e-23
Identity = 72/234 (30.77%), Postives = 115/234 (49.15%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITF 2910
            C+ C +P  L   K  +  Y G  YCT+C      +IP  +++NWD N+  VS   K FL  +   P +++   +  L++    L+ V +LR +L  L   + SC    ++ +R  +FPR+Y+L  +    LYS+ DL  +  G L   L  VI K A  HV  C +CR K   C+ C    +VIY  + +    C    C +V H EC+   + +  C RC++    ++P +F
Sbjct:  466 CAGCQRPVGLSRGKAKVCAYSGWYYCTSCHQDNLFLIPARLLHNWDTNRHKVSKQAKEFLEFVYEEPLLDVQQLNPCLYEHCEPLAAVLKLRQQLQSLRAYLFSCRATVAEDLRRRIFPREYLLQHVH---LYSLADLQQVIDGKLAPFLSKVI-KFASSHVYSCSLCREKGFICELCHT-GQVIYPFQENATKRCE--GCGAVFHAECR---MRAQPCPRCVRRELHKKPASF 689          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Zebrafish
Match: rubcn (rubicon autophagy regulator [Source:ZFIN;Acc:ZDB-GENE-100922-142])

HSP 1 Score: 96.2857 bits (238), Expect = 8.995e-20
Identity = 65/208 (31.25%), Postives = 111/208 (53.37%), Query Frame = 1
Query: 2269 YDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYML-GSIKES-DLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC-KSPTIVSFYCRRCIQ 2880
            Y G+ +C  C    +SVIP  II  WDF++ +VS  ++  L++I   P  NL+D +  L+  +  L  VR LR +LNL+   + +C +  +K + E     D +L G + E   L+S+ DL  + SG L   L  ++ ++   HV  C++C+ K   C+ C ++K +I+ +E+++   C    C +  HK C K+ T     C RC++
Sbjct:  696 YLGRYFCQCCHENAQSVIPAKIIRKWDFSKSYVSNFSRDLLAKISGDPLFNLSDINSALYKKVKALDTVRALREQLNLMKNLLKTCRL--AKDVLEEF---DSLLPGHLTEDMQLFSLSDLNAVRSGSLTPQLRHLL-RLGSTHVTHCMLCQAKGFICEFCGNDKDIIFPYELNKCLRCE--DCHACYHKSCFKTGT----QCPRCLR 891          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Zebrafish
Match: rubcn (rubicon autophagy regulator [Source:ZFIN;Acc:ZDB-GENE-100922-142])

HSP 1 Score: 96.2857 bits (238), Expect = 1.023e-19
Identity = 65/208 (31.25%), Postives = 111/208 (53.37%), Query Frame = 1
Query: 2269 YDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYML-GSIKES-DLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC-KSPTIVSFYCRRCIQ 2880
            Y G+ +C  C    +SVIP  II  WDF++ +VS  ++  L++I   P  NL+D +  L+  +  L  VR LR +LNL+   + +C +  +K + E     D +L G + E   L+S+ DL  + SG L   L  ++ ++   HV  C++C+ K   C+ C ++K +I+ +E+++   C    C +  HK C K+ T     C RC++
Sbjct:  687 YLGRYFCQCCHENAQSVIPAKIIRKWDFSKSYVSNFSRDLLAKISGDPLFNLSDINSALYKKVKALDTVRALREQLNLMKNLLKTCRL--AKDVLEEF---DSLLPGHLTEDMQLFSLSDLNAVRSGSLTPQLRHLL-RLGSTHVTHCMLCQAKGFICEFCGNDKDIIFPYELNKCLRCE--DCHACYHKSCFKTGT----QCPRCLR 882          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Xenopus
Match: smim19 (small integral membrane protein 19 [Source:Xenbase;Acc:XB-GENE-5848731])

HSP 1 Score: 103.99 bits (258), Expect = 4.476e-22
Identity = 68/224 (30.36%), Postives = 111/224 (49.55%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINL-ADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQ 2880
            C+ C +P  L   K  +  Y G  YC+ C      +IP  +I+NWD ++  VS   K FL  +   P I++  ++  L+  +  L+ V +LR +L  L   + SC    ++ +R  +FPR+Y+   I    LYS+ DL  +  G L   LL +I K A  HV  C +C  K   C+ C +  +++Y  E +    C   +C +V H +CK  T+    C +C++
Sbjct:  505 CAGCQRPIGLSNEKAKVCSYSGWYYCSTCHVDDGFIIPARLIHNWDASKHKVSKQAKEFLEYVYEEPLIDVHQENPLLYRHVDSLAHVVRLRQQLKSLRAYLFSCRAVVAEDLRRRIFPREYLFQQIH---LYSLSDLQQVIEGKLAPFLLKII-KFATSHVYSCSLCSQKGFICEIC-NNGEILYPFEENSTSRCE--NCGAVFHTDCKVRTVP---CPKCVR 718          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Xenopus
Match: ENSXETT00000046914.1 (RUN domain and cysteine-rich domain containing, Beclin 1-interacting protein [Source:NCBI gene;Acc:100497647])

HSP 1 Score: 93.2041 bits (230), Expect = 1.155e-18
Identity = 68/211 (32.23%), Postives = 110/211 (52.13%), Query Frame = 1
Query: 2218 CSTCSQPLETN---KVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKES-DLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            C+ C   +E++   ++    Y GK +C  C    +SVIP  II  WDF++ +VS  +K  L++I S P  NL D +  L+  +  L +VR LR +L  L     +C +  +K I E     D + G + E   L+S+ DL  +  G L   L  ++   A+ HV+KC++C+ K   C+ C++E  VI+  E+++   C    CK+  HK C
Sbjct:  666 CAGCGIRIESDYIKRLRYCEYLGKYFCQCCHENAQSVIPGRIIRKWDFSKYYVSNFSKDLLTKIWSDPLFNLQDINSPLYRKVKALEQVRLLRIQLVHLKNMFKTCRL--AKGILELY---DIVPGHLTEDHHLFSLSDLTSIKKGELVPRLRDLVKSGAL-HVEKCMLCQAKGFICEFCQNEDDVIFPFELNKCRRCE--DCKACYHKYC 868          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Xenopus
Match: ENSXETT00000046930.1 (RUN domain and cysteine-rich domain containing, Beclin 1-interacting protein [Source:NCBI gene;Acc:100497647])

HSP 1 Score: 93.2041 bits (230), Expect = 1.169e-18
Identity = 68/211 (32.23%), Postives = 110/211 (52.13%), Query Frame = 1
Query: 2218 CSTCSQPLETN---KVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKES-DLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            C+ C   +E++   ++    Y GK +C  C    +SVIP  II  WDF++ +VS  +K  L++I S P  NL D +  L+  +  L +VR LR +L  L     +C +  +K I E     D + G + E   L+S+ DL  +  G L   L  ++   A+ HV+KC++C+ K   C+ C++E  VI+  E+++   C    CK+  HK C
Sbjct:  641 CAGCGIRIESDYIKRLRYCEYLGKYFCQCCHENAQSVIPGRIIRKWDFSKYYVSNFSKDLLTKIWSDPLFNLQDINSPLYRKVKALEQVRLLRIQLVHLKNMFKTCRL--AKGILELY---DIVPGHLTEDHHLFSLSDLTSIKKGELVPRLRDLVKSGAL-HVEKCMLCQAKGFICEFCQNEDDVIFPFELNKCRRCE--DCKACYHKYC 843          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Xenopus
Match: ENSXETT00000046840.1 (RUN domain and cysteine-rich domain containing, Beclin 1-interacting protein [Source:NCBI gene;Acc:100497647])

HSP 1 Score: 93.2041 bits (230), Expect = 1.379e-18
Identity = 68/211 (32.23%), Postives = 110/211 (52.13%), Query Frame = 1
Query: 2218 CSTCSQPLETN---KVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKES-DLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            C+ C   +E++   ++    Y GK +C  C    +SVIP  II  WDF++ +VS  +K  L++I S P  NL D +  L+  +  L +VR LR +L  L     +C +  +K I E     D + G + E   L+S+ DL  +  G L   L  ++   A+ HV+KC++C+ K   C+ C++E  VI+  E+++   C    CK+  HK C
Sbjct:  685 CAGCGIRIESDYIKRLRYCEYLGKYFCQCCHENAQSVIPGRIIRKWDFSKYYVSNFSKDLLTKIWSDPLFNLQDINSPLYRKVKALEQVRLLRIQLVHLKNMFKTCRL--AKGILELY---DIVPGHLTEDHHLFSLSDLTSIKKGELVPRLRDLVKSGAL-HVEKCMLCQAKGFICEFCQNEDDVIFPFELNKCRRCE--DCKACYHKYC 887          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Xenopus
Match: ENSXETT00000046880.1 (RUN domain and cysteine-rich domain containing, Beclin 1-interacting protein [Source:NCBI gene;Acc:100497647])

HSP 1 Score: 92.8189 bits (229), Expect = 1.477e-18
Identity = 68/211 (32.23%), Postives = 110/211 (52.13%), Query Frame = 1
Query: 2218 CSTCSQPLETN---KVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKES-DLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            C+ C   +E++   ++    Y GK +C  C    +SVIP  II  WDF++ +VS  +K  L++I S P  NL D +  L+  +  L +VR LR +L  L     +C +  +K I E     D + G + E   L+S+ DL  +  G L   L  ++   A+ HV+KC++C+ K   C+ C++E  VI+  E+++   C    CK+  HK C
Sbjct:  644 CAGCGIRIESDYIKRLRYCEYLGKYFCQCCHENAQSVIPGRIIRKWDFSKYYVSNFSKDLLTKIWSDPLFNLQDINSPLYRKVKALEQVRLLRIQLVHLKNMFKTCRL--AKGILELY---DIVPGHLTEDHHLFSLSDLTSIKKGELVPRLRDLVKSGAL-HVEKCMLCQAKGFICEFCQNEDDVIFPFELNKCRRCE--DCKACYHKYC 846          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Mouse
Match: Plekhm3 (pleckstrin homology domain containing, family M, member 3 [Source:MGI Symbol;Acc:MGI:2443627])

HSP 1 Score: 102.064 bits (253), Expect = 1.642e-21
Identity = 70/224 (31.25%), Postives = 109/224 (48.66%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLTLFDVIPE-LSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQ 2880
            C+ C +   L   K  + +Y G  YC++C      +IP  I++NWD ++  VS   K FL  +   P I++     +  +  E L+ V +LR +L  L   + SC    ++ +R  +FPR+Y+L  I    LYS+ DL  +  G L   L  VI K A  HV  C +C  K   C+ C +  +++Y  E      C   SC +V H ECK  ++    C RC++
Sbjct:  514 CAGCQRSIGLSNGKAKVCNYSGWYYCSSCHVDDSFLIPARIVHNWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENPMLYLHAEPLATVVRLRQRLKSLRAYLFSCRAAVAEDLRRRIFPREYLLQQIH---LYSLADLQQVIEGKLAPFLGKVI-KFATAHVYSCSLCSQKGFICEIC-NNGEILYPFEDISTSRCE--SCGAVFHSECKEKSVP---CPRCVR 727          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Mouse
Match: Plekhm3 (pleckstrin homology domain containing, family M, member 3 [Source:MGI Symbol;Acc:MGI:2443627])

HSP 1 Score: 102.064 bits (253), Expect = 1.642e-21
Identity = 70/224 (31.25%), Postives = 109/224 (48.66%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLTLFDVIPE-LSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQ 2880
            C+ C +   L   K  + +Y G  YC++C      +IP  I++NWD ++  VS   K FL  +   P I++     +  +  E L+ V +LR +L  L   + SC    ++ +R  +FPR+Y+L  I    LYS+ DL  +  G L   L  VI K A  HV  C +C  K   C+ C +  +++Y  E      C   SC +V H ECK  ++    C RC++
Sbjct:  514 CAGCQRSIGLSNGKAKVCNYSGWYYCSSCHVDDSFLIPARIVHNWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENPMLYLHAEPLATVVRLRQRLKSLRAYLFSCRAAVAEDLRRRIFPREYLLQQIH---LYSLADLQQVIEGKLAPFLGKVI-KFATAHVYSCSLCSQKGFICEIC-NNGEILYPFEDISTSRCE--SCGAVFHSECKEKSVP---CPRCVR 727          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Mouse
Match: Plekhm1 (pleckstrin homology domain containing, family M (with RUN domain) member 1 [Source:MGI Symbol;Acc:MGI:2443207])

HSP 1 Score: 93.9745 bits (232), Expect = 6.524e-19
Identity = 70/242 (28.93%), Postives = 118/242 (48.76%), Query Frame = 1
Query: 2182 TNDGLNSVFGGLCSTCSQPLETNKVI--IDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLA-DHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQ 2898
            T  GL+S  G  C+ CS+ +  + V   +  + G  YC  C     SVIP  II+NWD  ++ V     +FL++I + P INL   + +L++ +  +  + + R +L LL   +  C     K + + +  R+Y+L S      +S+ DL  +  GV E  L  +I + A  HV  C +C  +   C  C   + +I+  E D    C+   C++V H+ C++  +V   C RC +  K Q+
Sbjct:  838 TEKGLDSQ-GCFCAGCSRQIGFSFVRPKLCAFSGLYYCDFCHQDDASVIPARIIHNWDLTKRPVCRQALKFLAQIRAQPLINLQLVNASLYEHVERMHLIGRSREQLKLLGDYLGLCRSGALKELCKRLSHRNYLLESPHR---FSVADLQQIAEGVYEGFLKALI-EFASQHVYHCDLCTQRGFICQICH-HQDIIFPFEFDTTVRCA--ECRTVFHQSCQA--VVRKGCPRCARRRKYQE 1069          

HSP 2 Score: 43.8986 bits (102), Expect = 3.736e-8
Identity = 31/114 (27.19%), Postives = 56/114 (49.12%), Query Frame = 1
Query:   22 VDKNIILDVLKK----SIHNLLQSNELIDLVEIEDSIYTQNLCSAIEALFIQGQLKNQSFKLLSKISRRKHSYEYD-----FWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW 336
            +D    + V+KK    S+  L + +  +D V   +      +CSA+EA+FI G L  +  +  +   R+KH+++       FW  +K +  ++++  LE+  F  T VG  R W
Sbjct:    8 LDPRAAIQVIKKKLVGSVKALQKQHVSLDTVVTSEDGDANTMCSALEAVFIHG-LHAKHIRAEAGGKRKKHTHQKALPQPVFWPLLKAITHRHIVSDLEHLVFINTDVGRCRAW 120          

HSP 3 Score: 34.6538 bits (78), Expect = 3.736e-8
Identity = 15/43 (34.88%), Postives = 25/43 (58.14%), Query Frame = 2
Query:  380 VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKME 508
             WLR ALN+  +  Y+  +  +  RL ++Y   +L+RD E+ E
Sbjct:  119 AWLRLALNDGLMECYLKLLLQEPARLCEYYQPTALLRDAEEAE 161          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Mouse
Match: Def8 (differentially expressed in FDCP 8 [Source:MGI Symbol;Acc:MGI:1346331])

HSP 1 Score: 85.8853 bits (211), Expect = 7.653e-17
Identity = 56/212 (26.42%), Postives = 104/212 (49.06%), Query Frame = 1
Query: 2218 CSTCSQPLETNKVIIDH----YDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVK-KCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            C+ C  P+    V  +     Y G+ YC++C     +VIP  +++NWDF  + VS  + R+L+ ++S P + L + +  LF+ + EL  +R+LR  + L+     +C      R+   +  R +    ++  ++YSI+DL+ +H G L  +L   I+ +   H+K  C  C+ K   C+ C++   +         C      C +V H++C
Sbjct:  238 CAECRAPISLRGVPSEARQCDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLLFNYVEELVEIRKLRQDILLMKPYFITCKEAMEARLLLQLQDRQHF---VENDEMYSIQDLLEVHMGRLSCSLT-EIHTLFAKHIKLDCERCQAKGFVCELCKEGDVLFPFDSHTSVCN----DCSAVFHRDC 441          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Mouse
Match: Def8 (differentially expressed in FDCP 8 [Source:MGI Symbol;Acc:MGI:1346331])

HSP 1 Score: 85.5001 bits (210), Expect = 8.488e-17
Identity = 73/310 (23.55%), Postives = 140/310 (45.16%), Query Frame = 1
Query: 1936 NSKESNSDILAQSKVYSSLIASKLITPTAD----FVYNLIVRRFNFPIFTVKESDQSWEFIGDDMITEKIEMKRLMDIFPGVDVCSTNDGLNSVFGGLCSTCSQPLETNKVIIDH----YDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVK-KCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            N +E N  +L + + Y     SK +  T D     ++ LI   +       +   +    I    ++ K+  +   ++    ++C    GL+S     C+ C  P+    V  +     Y G+ YC++C     +VIP  +++NWDF  + VS  + R+L+ ++S P + L + +  LF+ + EL  +R+LR  + L+     +C      R+   +  R +    ++  ++YSI+DL+ +H G L  +L   I+ +   H+K  C  C+ K   C+ C++   +         C      C +V H++C
Sbjct:  124 NEEEPNIRVLLEHRFYKE--KSKSVKQTCDKCNTIIWGLIQTWYTCTGCCYRCHSKCLNLISKPCVSSKVSHQAEYEL----NICPET-GLDSQ-DYRCAECRAPISLRGVPSEARQCDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLLFNYVEELVEIRKLRQDILLMKPYFITCKEAMEARLLLQLQDRQHF---VENDEMYSIQDLLEVHMGRLSCSLT-EIHTLFAKHIKLDCERCQAKGFVCELCKEGDVLFPFDSHTSVCN----DCSAVFHRDC 417          
BLAST of CLUMA_CG020736, isoform A vs. UniProt/SwissProt
Match: sp|Q08AW4|PKHM3_XENLA (Pleckstrin homology domain-containing family M member 3 OS=Xenopus laevis OX=8355 GN=plekhm3 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 2.085e-21
Identity = 68/224 (30.36%), Postives = 111/224 (49.55%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINL-ADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQ 2880
            C+ C +P  L   K  +  Y G  YC+ C      +IP  +I+NWD ++  VS   K FL  +   P I++  ++  L+  +  L+ V +LR +L  L   + SC    ++ +R  +FPR+Y+   I    LYS+ DL  +  G L   LL +I K A  HV  C +C  K   C+ C +  +++Y  E +    C   +C +V H +CK  T+    C +C++
Sbjct:  501 CAGCQRPIGLSNEKAKVCSYSGWYYCSTCHVDDGFIIPARLIHNWDTSKHKVSKQAKEFLEYVYEEPLIDVHQENPLLYRHVDALAHVVRLRQQLKSLRAYLFSCRAVVAEDLRRRIFPREYLFQQIH---LYSLSDLQQVVEGKLAPFLLKII-KFATSHVYSCSLCSQKGFICEIC-NNGEILYPFEENSTSRCE--NCGAVFHSDCKVRTVP---CPKCVR 714          
BLAST of CLUMA_CG020736, isoform A vs. UniProt/SwissProt
Match: sp|Q6ZWE6|PKHM3_HUMAN (Pleckstrin homology domain-containing family M member 3 OS=Homo sapiens OX=9606 GN=PLEKHM3 PE=2 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 3.777e-21
Identity = 70/224 (31.25%), Postives = 110/224 (49.11%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINL-ADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQ 2880
            C+ C +   L   K  + +Y G  YC++C      +IP  I++NWD ++  VS   K FL  +   P I++  ++  L+     L+ V +LR +L  L   + SC    ++ +R  +FPR+Y+L  I    LYS+ DL  +  G L   L  VI K A  HV  C +C  K   C+ C +  +++Y  E      C   SC +V H ECK  ++    C RC++
Sbjct:  514 CAGCQRSIGLSNGKAKVCNYSGWYYCSSCHVDDSFLIPARIVHNWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENAMLYHHAEPLAAVLRLRQRLKSLRAYLFSCRAAVAEDLRRRIFPREYLLQQIH---LYSLADLQQVIEGKLAPFLGKVI-KFATSHVYSCSLCSQKGFICEIC-NNGEILYPFEDISTSRCE--SCGAVFHSECKEKSVP---CPRCVR 727          
BLAST of CLUMA_CG020736, isoform A vs. UniProt/SwissProt
Match: sp|Q8BM47|PKHM3_MOUSE (Pleckstrin homology domain-containing family M member 3 OS=Mus musculus OX=10090 GN=Plekhm3 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.149e-20
Identity = 70/224 (31.25%), Postives = 109/224 (48.66%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLTLFDVIPE-LSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQ 2880
            C+ C +   L   K  + +Y G  YC++C      +IP  I++NWD ++  VS   K FL  +   P I++     +  +  E L+ V +LR +L  L   + SC    ++ +R  +FPR+Y+L  I    LYS+ DL  +  G L   L  VI K A  HV  C +C  K   C+ C +  +++Y  E      C   SC +V H ECK  ++    C RC++
Sbjct:  514 CAGCQRSIGLSNGKAKVCNYSGWYYCSSCHVDDSFLIPARIVHNWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENPMLYLHAEPLATVVRLRQRLKSLRAYLFSCRAAVAEDLRRRIFPREYLLQQIH---LYSLADLQQVIEGKLAPFLGKVI-KFATAHVYSCSLCSQKGFICEIC-NNGEILYPFEDISTSRCE--SCGAVFHSECKEKSVP---CPRCVR 727          
BLAST of CLUMA_CG020736, isoform A vs. UniProt/SwissProt
Match: sp|Q5PQS0|PKHM1_RAT (Pleckstrin homology domain-containing family M member 1 OS=Rattus norvegicus OX=10116 GN=Plekhm1 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 9.915e-19
Identity = 70/242 (28.93%), Postives = 119/242 (49.17%), Query Frame = 1
Query: 2182 TNDGLNSVFGGLCSTCSQPLETNKVI--IDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLA-DHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQ 2898
            T  GL+S  G  C+ CS+ +  + V   +  + G  YC  C     SVIP  II+NWD  ++ V     +FL++I + P INL   + +L++ +  +  + + R +L LL   +  C     K + + +  R+Y+L S  +   +S+ DL  +  GV E  L  +I + A  HV  C +C  +   C  C   + +I+  E D    C+   C++V H+ C++  +V   C RC +  K Q+
Sbjct:  823 TEKGLDSQ-GCFCAGCSRQIGFSFVRPKLCAFSGLYYCDFCHQDDASVIPARIIHNWDLTKRPVCRQALKFLAQIRAQPLINLQLVNASLYEHVERMHLIGRSREQLKLLGDYLGLCRSGALKELSKRLSHRNYLLESPHK---FSVADLQQIAEGVYEGFLKALI-EFASQHVYHCDLCTQRGFICQICH-HQDIIFPFEFDTTVRCA--ECRTVFHQSCQA--VVRKGCPRCARRRKYQE 1054          

HSP 2 Score: 44.669 bits (104), Expect = 1.404e-7
Identity = 32/114 (28.07%), Postives = 56/114 (49.12%), Query Frame = 1
Query:   22 VDKNIILDVLKK----SIHNLLQSNELIDLVEIEDSIYTQNLCSAIEALFIQGQLKNQSFKLLSKISRRKHSYEYD-----FWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW 336
            +D    + V+KK    S+  L + +  +D V   +      +CSA+EA+FI G L  +  +  +   R+KH+++       FW  +K +  K+++  LE+  F  T VG  R W
Sbjct:    8 LDPRAAIQVIKKKLVGSVKALQKQHVSLDTVVTSEDGDANTMCSALEAVFIHG-LHAKYIRAEAGGKRKKHTHQKPLPQPVFWPLLKAVTHKHIISDLEHLVFINTDVGRCRAW 120          

HSP 3 Score: 34.2686 bits (77), Expect = 1.404e-7
Identity = 15/43 (34.88%), Postives = 25/43 (58.14%), Query Frame = 2
Query:  380 VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKME 508
             WLR ALN+  +  Y+  +  +  RL ++Y   +L+RD E+ E
Sbjct:  119 AWLRLALNDGLMECYLKLLLQEPARLCEYYQPTALLRDAEEAE 161          
BLAST of CLUMA_CG020736, isoform A vs. UniProt/SwissProt
Match: sp|Q9Y4G2|PKHM1_HUMAN (Pleckstrin homology domain-containing family M member 1 OS=Homo sapiens OX=9606 GN=PLEKHM1 PE=1 SV=3)

HSP 1 Score: 95.5153 bits (236), Expect = 1.596e-18
Identity = 71/244 (29.10%), Postives = 119/244 (48.77%), Query Frame = 1
Query: 2191 GLNSVFGGLCSTCSQPLETNKVI--IDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITFA 2913
            GL+S  G  C+ CS+ +  + V   +  + G  YC  C     SVIP  II+NWD  ++ +     +FL++I + P INL   + +L++ +  +  + + R +L LL   +  C     K + + +  R+Y+L S      +S+ DL  +  GV E  L  +I + A  HV  C +C  +   C  C+    +I+  E D    C+   CK+V H+ C++  +V   C RC +  K Q+   FA
Sbjct:  823 GLDSQ-GCFCAGCSRQIGFSFVRPKLCAFSGLYYCDICHQDDASVIPARIIHNWDLTKRPICRQALKFLTQIRAQPLINLQMVNASLYEHVERMHLIGRRREQLKLLGDYLGLCRSGALKELSKRLNHRNYLLESPHR---FSVADLQQIADGVYEGFLKALI-EFASQHVYHCDLCTQRGFICQICQ-HHDIIFPFEFDTTVRCA--ECKTVFHQSCQA--VVKKGCPRCARRRKYQEQNIFA 1056          

HSP 2 Score: 41.9726 bits (97), Expect = 4.217e-7
Identity = 31/114 (27.19%), Postives = 55/114 (48.25%), Query Frame = 1
Query:   22 VDKNIILDVLKK----SIHNLLQSNELIDLVEIEDSIYTQNLCSAIEALFIQGQLKNQSFKLLSKISRRKHSYEYD-----FWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW 336
            +D    + V+KK    S+  L +    +D V   +      +CSA+EA+FI G L  +  +  +   R+K +++       FW  +K +  K+++  LE+ +F  T VG  R W
Sbjct:    9 LDPQAAIPVIKKKLVGSVKALQKQYVSLDTVVTSEDGDANTMCSALEAVFIHG-LHAKHIRAEAGGKRKKSAHQKPLPQPVFWPLLKAVTHKHIISELEHLTFVNTDVGRCRAW 121          

HSP 3 Score: 35.8094 bits (81), Expect = 4.217e-7
Identity = 15/43 (34.88%), Postives = 25/43 (58.14%), Query Frame = 2
Query:  380 VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKME 508
             WLR ALN+  +  Y+  +  +  RL ++Y   +L+RD E+ E
Sbjct:  120 AWLRLALNDGLMECYLKLLLQEQARLHEYYQPTALLRDAEEGE 162          
BLAST of CLUMA_CG020736, isoform A vs. TrEMBL
Match: A0A4E0RJN8 (RUN domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_008138 PE=4 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 6.355e-58
Identity = 107/256 (41.80%), Postives = 157/256 (61.33%), Query Frame = 1
Query: 2080 ESDQSWEFIGDDMI---TEKIEMKRLMDIFPGVDVCSTNDGLNSVFGGLCSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            E D SW+ +G+D++   TE+ +M+RL  ++PG       +G N  F G C+ C + L      +D YD  LYCTNC    +++IPRN++ NWDF+ + VS TTK FLS +   P +NLA  + TL+ VIPEL  VRQLR  + LLW Q++ CD + +  +R ++ PRDYML S+ + D+YS+ DL  +HSG LE+ +  V+  +A+ HV  CL CR + + CD C D +  I+ HE+  Y  C+ P C  V+H  C
Sbjct:  346 EIDCSWQVVGEDLLLVLTEQ-DMERLAKLYPGATSFDQENGRNCAFHGECNRCGRFLTPKTSFLDTYDAHLYCTNCHQLQETIIPRNVVLNWDFSLQSVSQTTKSFLSGLYYKPVLNLAKLNPTLYAVIPELLNVRQLRRAVILLWHQISRCDAKAASDLRRSLHPRDYMLFSLNDLDVYSMHDLFEVHSGRLERKITSVLCNVALAHVHGCLACRRRALLCDFCEDLRHPIWPHEVTTYRRCAVPGCHKVMHVAC 600          
BLAST of CLUMA_CG020736, isoform A vs. TrEMBL
Match: A0A4S2MDF8 (RUN domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000856 PE=4 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.219e-57
Identity = 113/293 (38.57%), Postives = 165/293 (56.31%), Query Frame = 1
Query: 1984 SSLIASKLITPTADFVYNLIVRRFNFPIFT------VKESDQSWEFIGDDMITEKIE--MKRLMDIFPGVDVCSTNDGLNSVFGGLCSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            S+L  S  + PT D       +  +FP+        V E + +W+ +G+D++    E  + RL+ +FPG       DG N  F G C  C + L      +D YD +LYC NC    +++IPR++IYNWDF+ + VS  T+ FL E+ + P INLA  H +L+ VIPEL  +RQLR  L LLW Q+  CD +++  ++  + P DYML S+ + DLYS+ DL  + SG L+K L+  I  +A+ HV  C  CR + + CD C D ++ I+ HE   Y  CSTP C  V+H  C
Sbjct:  356 STLKTSSPVLPTVD------EQSASFPVVIQAKQADVAEGESNWQVVGEDLLVTLTEQDITRLVRLFPGAPAFDLEDGRNCAFNGKCGRCDKQLSPTTAFLDSYDARLYCMNCHQLQEAIIPRDVIYNWDFSLQPVSQPTRSFLGELFNRPLINLAKIHPSLYAVIPELLVIRQLRRALILLWHQIARCDAKSASDLQRCIRPLDYMLISLNDLDLYSMHDLYRVQSGELQKKLMTAICDVALVHVHGCRACRRRALLCDLCGDVERPIWPHEFTTYKWCSTPGCIRVMHVNC 642          

HSP 2 Score: 63.5438 bits (153), Expect = 1.679e-13
Identity = 40/105 (38.10%), Postives = 56/105 (53.33%), Query Frame = 1
Query:   28 KNIILDVLKKSIHNLLQSNELIDLVEIEDSIYTQNLCSAIEALFIQGQLKNQS--FKLLSKISRRKHSYEYDFWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW 336
            KN +LD  +   + LL+  E      + D   T  +CS +EA+F+   ++     F   S  S  + S    FWNFIKGLIPK+LL VL++   K TA+G  RVW
Sbjct:    7 KNDLLDAFRIHSNILLKDYEERRFEHVRDDTTTAYVCSILEAVFLHKLIRRHGTFFSFNSTSSPEQAS----FWNFIKGLIPKHLLSVLDSIGGKRTAIGRCRVW 107          

HSP 3 Score: 43.8986 bits (102), Expect = 1.679e-13
Identity = 19/42 (45.24%), Postives = 27/42 (64.29%), Query Frame = 2
Query:  380 VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKM 505
            VW+R  LNE ++ SY+    ADT +L  FYS D+ +RD+  M
Sbjct:  106 VWIRHCLNEASMHSYLVLASADTSKLNNFYSADAALRDENFM 147          
BLAST of CLUMA_CG020736, isoform A vs. TrEMBL
Match: A0A5J4NHM7 (DUF4206 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0001534 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 6.280e-56
Identity = 109/272 (40.07%), Postives = 157/272 (57.72%), Query Frame = 1
Query: 2080 ESDQSWEFIGDDMITEKIE--MKRLMDIFPGVDVCSTNDGLNSVFGGLCSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC------KSPTIVS-FYC 2865
            E + SW+ +G+D++    E  + RL+++FPG       +G N VF G C  C + L      +DHYD + YC+NC    +++IPR++I+NWDF+ + VS TTK FL  +   P INLA  + TL+ VIP+L  VRQLR  L LLW Q+  C  + +  +R ++ P DYML ++   D+YSI+DL ++ SG L   L   I  +A+ HV  C  CR + + CD C D  K I+ HE   Y  CSTP C  V+H  C       SP+++S F C
Sbjct:  116 EGECSWQVVGEDLLVVLTEQDVARLVELFPGAPSFELVNGQNCVFHGRCVRCERYLLPGSAFLDHYDTRFYCSNCHQLQEAIIPRDVIFNWDFSVQPVSQTTKSFLLNLHRKPVINLARLNPTLYAVIPDLLTVRQLRRALVLLWHQIARCSAKAASDLRRSIQPLDYMLFTLNNLDVYSIQDLCLVQSGQLAWKLTSAIVNVALVHVHGCTSCRRRALLCDLCEDLHKPIWPHEFASYQWCSTPQCLKVMHVSCLAKERRLSPSLISCFAC 387          
BLAST of CLUMA_CG020736, isoform A vs. TrEMBL
Match: A0A3R7JNB0 (Pleckstrin homology domain-containing family M member 3 (Fragment) OS=Clonorchis sinensis OX=79923 GN=plekhm3 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.274e-54
Identity = 104/277 (37.55%), Postives = 156/277 (56.32%), Query Frame = 1
Query: 1984 SSLIASKLITPTADFVYNLIVRRFNFPIFT------VKESDQSWEFIGDDMITEKIE--MKRLMDIFPGVDVCSTNDGLNSVFGGLCSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEY 2787
            ++L  S  + PT D       +  +FP+        V E + +W+ +G+D++    E  + RL+ +FPG       DG N  F G C  C + L      +D YD +LYC NC    +++IPR++IYNWDF+ + VS  T+ FL E+ + P INLA  H +L+ VIPEL  +RQLR  L LLW Q+  CD +++  ++  + P DYML S+ + DLYS+ DL  + SG L+K L+  I  +A+ HV  C  CR + + CD C D ++ I+ HE   Y
Sbjct:  127 ATLKTSSPVLPTVD------QQSASFPVVIQAKQADVAEGESNWQVVGEDLLVTLTEQDITRLVRLFPGAPAFDLEDGRNCAFNGKCGRCDKQLSPTTAFLDSYDARLYCMNCHQLQEAIIPRDVIYNWDFSLQPVSQPTRSFLGELFNRPLINLAKIHPSLYAVIPELLVIRQLRRALILLWHQIARCDAKSASDLQRCIRPLDYMLISLNDLDLYSMHDLYRVQSGELQKKLMTAICDVALVHVHGCRACRRRALLCDLCGDVERPIWPHEFTTY 397          
BLAST of CLUMA_CG020736, isoform A vs. TrEMBL
Match: A0A1S8WY15 (DUF4206 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=X801_04789 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 3.683e-53
Identity = 105/277 (37.91%), Postives = 155/277 (55.96%), Query Frame = 1
Query: 1984 SSLIASKLITPTADFVYNLIVRRFNFPIFT------VKESDQSWEFIGDDMITEKIE--MKRLMDIFPGVDVCSTNDGLNSVFGGLCSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEY 2787
            S+L  S  + PT D       +   FP+        V E + +W+ +G+D++    E  + RL+ +FPG       DG N  F G C  C + L      +D YD +LYC NC    +++IPR++IYNWDF+ + VS  T+ FL E+ + P INLA  H +L+ VIPEL  +RQLR  L LLW Q+  CD +++  ++  + P DYML S+ + DLYS+ DL  + SG L+K L+  I  +A+ HV  C  CR + + CD C D ++ I+ HE   Y
Sbjct:  126 STLETSSPVLPTMD------QQSAPFPVVIQAKQADVAEGESNWQVVGEDLLVTLTEQDITRLIRLFPGAPAFDFEDGRNCAFNGKCGRCDKQLSPTTAFLDSYDARLYCMNCHQLQEAIIPRDVIYNWDFSLQPVSQPTRSFLGELFNRPVINLAKIHPSLYAVIPELLVIRQLRRALILLWHQIARCDAKSASDLQRCIRPLDYMLISLNDLDLYSMHDLCRVQSGELQKKLMTAICDVALVHVHGCRACRRRALLCDLCGDVERPIWPHEFTTY 396          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Cavefish
Match: plekhm3 (pleckstrin homology domain containing M3 [Source:NCBI gene;Acc:103035695])

HSP 1 Score: 104.76 bits (260), Expect = 1.264e-22
Identity = 71/234 (30.34%), Postives = 116/234 (49.57%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITF 2910
            C+ C +P  L   K  + HY G  YC +C      +IP  +++NWD ++  VS   K FL  I   P +++   +  L++    L+ V +LR +L  L   + +C    ++ +R  +FPR+Y+L  I    LYS+ DL  +  G L   L  VI K A  HV  C +CR K   C+ C D  +++Y  + +    C    C +V H EC+   + +  C RC++    ++P +F
Sbjct:  460 CAGCQRPVGLSRGKAKVCHYSGWYYCQSCHQDNLFLIPARLLHNWDTSRHKVSKQAKEFLEFIYEEPLLDVQQLNPCLYEHSEPLAAVLKLRQQLQSLRAYLFNCRATVAEDLRRRIFPREYLLQHIH---LYSLADLQQVIDGKLAPFLSKVI-KFASSHVYSCSLCREKGFICELCHD-GQILYPFQENATKRCE--GCGAVFHAECR---MRAQPCPRCVRRELHKKPSSF 683          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Cavefish
Match: def8 (differentially expressed in FDCP 8 homolog [Source:NCBI gene;Acc:103039176])

HSP 1 Score: 84.7297 bits (208), Expect = 1.063e-16
Identity = 60/233 (25.75%), Postives = 112/233 (48.07%), Query Frame = 1
Query: 2218 CSTCSQPLETNKVIIDH----YDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVK-KCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQ 2898
            C+ C  P+    V  +     Y G+ YC++C     +++P  +I+NW+F  K V  ++ R+L+ ++S P + L + +  LF+ + EL  +R+LR  + L+     +C      R+   +  R +    ++  D+YS++DLI + SG L  +L  +    A  H+K  C  C+ K   C+ C++   +         C+     C +V H++C      S  C RC +  + +Q
Sbjct:  211 CAECRTPISLRGVPSEARQCDYTGQYYCSSCHWNDTAIVPARVIHNWEFEPKKVCRSSMRYLALMISRPVLKLKEINPLLFNFVEELVEIRKLRQDILLMKPYFITCKEAMEARLLLHLQDRQHF---VENDDMYSLQDLIDISSGRLSCSLTEIHTTFA-KHIKLDCEKCQAKGFVCELCKEGDILFPFDSHTSVCQ----DCSAVFHRDCYYDN--STTCPRCARMTERKQ 433          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Cavefish
Match: rubcn (rubicon autophagy regulator [Source:NCBI gene;Acc:103027127])

HSP 1 Score: 81.6481 bits (200), Expect = 2.442e-15
Identity = 56/208 (26.92%), Postives = 99/208 (47.60%), Query Frame = 1
Query: 2218 CSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKES-DLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            C T   P    ++    Y G+ +C  C     +V+P +++  WDF++ +VS   +  L +I   P  N  D +  L+  +  L  VR LR +L  +     +C +  +K + E     D + G + E   L+S+ DL  + SG L  T L  + ++   HV  C++C+ K   C+ C +EK +I+ +E+ +   C    C +  H+ C
Sbjct:  683 CGTRIDPDYIKRLRYCEYLGRYFCQCCHENATAVVPGHVLRKWDFSKYYVSNFARDLLGKIAGDPLFNPNDVNTALYKKVKALETVRVLRMQLFHMKNLFKTCRL--AKDVLEDF---DSVAGHLTEDLHLFSLNDLTAVRSGEL-TTKLRELLRLGSAHVSSCVLCQAKGFVCEFCGNEKDIIFPYELHKCQRCE--ECNACYHRTC 882          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Cavefish
Match: rubcn (rubicon autophagy regulator [Source:NCBI gene;Acc:103027127])

HSP 1 Score: 81.6481 bits (200), Expect = 2.664e-15
Identity = 56/208 (26.92%), Postives = 99/208 (47.60%), Query Frame = 1
Query: 2218 CSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKES-DLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            C T   P    ++    Y G+ +C  C     +V+P +++  WDF++ +VS   +  L +I   P  N  D +  L+  +  L  VR LR +L  +     +C +  +K + E     D + G + E   L+S+ DL  + SG L  T L  + ++   HV  C++C+ K   C+ C +EK +I+ +E+ +   C    C +  H+ C
Sbjct:  699 CGTRIDPDYIKRLRYCEYLGRYFCQCCHENATAVVPGHVLRKWDFSKYYVSNFARDLLGKIAGDPLFNPNDVNTALYKKVKALETVRVLRMQLFHMKNLFKTCRL--AKDVLEDF---DSVAGHLTEDLHLFSLNDLTAVRSGEL-TTKLRELLRLGSAHVSSCVLCQAKGFVCEFCGNEKDIIFPYELHKCQRCE--ECNACYHRTC 898          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Cavefish
Match: rubcn (rubicon autophagy regulator [Source:NCBI gene;Acc:103027127])

HSP 1 Score: 81.6481 bits (200), Expect = 2.881e-15
Identity = 56/208 (26.92%), Postives = 99/208 (47.60%), Query Frame = 1
Query: 2218 CSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKES-DLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            C T   P    ++    Y G+ +C  C     +V+P +++  WDF++ +VS   +  L +I   P  N  D +  L+  +  L  VR LR +L  +     +C +  +K + E     D + G + E   L+S+ DL  + SG L  T L  + ++   HV  C++C+ K   C+ C +EK +I+ +E+ +   C    C +  H+ C
Sbjct:  675 CGTRIDPDYIKRLRYCEYLGRYFCQCCHENATAVVPGHVLRKWDFSKYYVSNFARDLLGKIAGDPLFNPNDVNTALYKKVKALETVRVLRMQLFHMKNLFKTCRL--AKDVLEDF---DSVAGHLTEDLHLFSLNDLTAVRSGEL-TTKLRELLRLGSAHVSSCVLCQAKGFVCEFCGNEKDIIFPYELHKCQRCE--ECNACYHRTC 874          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Sea Lamprey
Match: plekhm1 (pleckstrin homology domain containing, family M (with RUN domain) member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2752])

HSP 1 Score: 97.4413 bits (241), Expect = 8.895e-21
Identity = 62/221 (28.05%), Postives = 106/221 (47.96%), Query Frame = 1
Query: 2218 CSTCSQPLE--TNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRR 2871
            C+ C + +     K  +  Y  + YC +C +    +IP  +++NWD + + V+   K FL  I   P +++++ +  L+  + EL+ +R +R +L  L   + +C    +  +R  + PR+Y+L  +    LYSI DL  +  G     L   I K A  HV  C +C  K   C+ C +  ++IY  E+     C    C++V HK CK  T+    C R
Sbjct:  780 CAGCGREIGFCYGKAKVCSYSRRYYCVHCHADDLVLIPGRVLHNWDVSLQKVAKQAKEFLEYIAEEPLLDVSEVNPKLYKHVAELASLRTMRQQLKSLRAYLFTCRSIVADELRRRVLPREYLLAHMH---LYSITDLQQVIDGRFAPFLAKTI-KFASDHVYSCGLCSQKGFICEIC-NSSEIIYPFEVSSTIRCE--RCQAVFHKACKGSTVACPKCMR 993          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008319.1 (pep scaffold:Pmarinus_7.0:GL477638:57374:63041:-1 gene:ENSPMAG00000007527.1 transcript:ENSPMAT00000008319.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 3.661e-15
Identity = 57/205 (27.80%), Postives = 100/205 (48.78%), Query Frame = 1
Query: 2314 SVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSI-KESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITFADCD 2922
            +V+P  ++  WD ++  VS   +  L  I   P  NL D +  L+  +  L+ V++LR +L  L   + +C +  S     +  P     G + +E DLYS+EDL+ +  G L  TL  V+ +    HV+ C +C+ +   C+ C+ E+ +++  E+    +C  P C++  HK C +       C RC + L  +Q +   D D
Sbjct:    1 AVVPGRLLRRWDASRYPVSNFARELLVRIGHDPLYNLLDINPQLYRRVKALTVVQELRKQLVHLKHLLQTCRLAESLETLSSTVP-----GHLTEEVDLYSLEDLLAVRRGELAPTLRQVVTQTT-QHVRACQLCQARGFICEFCQKEEDILFPFELTRCQQC--PGCRACYHKCCFAAARED--CPRCKRILARRQRLAQPDID 195          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Nematostella
Match: EDO32187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVS4])

HSP 1 Score: 110.153 bits (274), Expect = 4.935e-27
Identity = 71/191 (37.17%), Postives = 100/191 (52.36%), Query Frame = 1
Query: 2269 YDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECK 2838
            YDG  YC  C      VIP  +IYNWD  +  V+  TK FL +I   P +N+ + + TL+ V+ EL  ++ LR +L  L   + +C    +  IR  ++PR+Y+   I +   YS+ DLI   SG L   L  +I +    HV KC +C  K   C+ C D  K+IY  E+    +C  P CKSV HK CK
Sbjct:   40 YDGGYYCYECHMDEDHVIPARVIYNWDLRKHRVARCTKLFLLQIEEEPLLNIDETNPTLYSVVEELEEIKVLRQQLQHLKGFLLTCKQPIADDIRRRIWPREYLWDDIHQ---YSLLDLIQTQSGQLAHHLKKIIGQ-CTKHVYKCDLCCQKGFICEFCND-PKIIYPFEVKTTFQC--PKCKSVSHKSCK 223          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Nematostella
Match: EDO45985 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRC1])

HSP 1 Score: 75.8702 bits (185), Expect = 1.506e-14
Identity = 54/191 (28.27%), Postives = 97/191 (50.79%), Query Frame = 1
Query: 2269 YDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFV--INKIAIPHVKK-CLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHK 2829
            Y G+ +C  C    + +IP  II+NWDF    V+   K+ L+ +++ P +NL   +  LF  + EL  +++LR ++ ++     SC      ++   +  R +    +  S  YS++DLI +  G L   L FV  ++ + + H+K  C +C+ K   C+ C+    VI+  +     +CS   CK+V+HK
Sbjct:  178 YSGQYFCEECHWNDQVLIPARIIHNWDFTNYKVARQNKQLLALMLNKPQLNLEQLNPALFKFVGELREIKRLREEILIMKKYFMSCRAALESKLLLQLQDRQHF---VDNSYQYSLQDLIDVERGSL---LPFVTRVHSLFLTHIKTDCELCQAKGFVCEVCKSN-DVIFAFD-PHAVQCS--KCKAVLHK 358          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Nematostella
Match: EDO46085 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR10])

HSP 1 Score: 60.077 bits (144), Expect = 1.026e-9
Identity = 43/133 (32.33%), Postives = 64/133 (48.12%), Query Frame = 1
Query: 2269 YDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLF 2664
            Y GK +C++C      VIP  I+  WDF +  VS   K  L+ I   P  N+ D +  L+  +  L+ V+ LR +L        +C   T  R   A  P D++     E  L+S+EDL+ + SG  E  +LF
Sbjct:  127 YLGKYFCSSCHQNEPMVIPARIVRRWDFRKYEVSKFAKDLLNNIHYDPLFNIKDLNSALYQRVRALAEVQTLRKQLYFFRTFAQTCRKATELRQDLARIP-DHIFT---EEHLFSVEDLLQVKSG--EMVMLF 253          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Medaka
Match: plekhm3 (pleckstrin homology domain containing M3 [Source:NCBI gene;Acc:101163618])

HSP 1 Score: 102.064 bits (253), Expect = 1.227e-21
Identity = 78/246 (31.71%), Postives = 117/246 (47.56%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQH-LKVQQPITF--ADCDSANCY 2937
            C+ C  P  L   K  +  Y G  YC +C      +IP  +++NWD  +  VS   K FL  +   P +++   +  L+     LS V +LR +L  L   + SC    ++ +R  +FPR+Y+L  I    LYS+ DL  +  G L   L  VI K A  HV  C +CR K   C+ C D  +VIY  + +    C    C +V H EC+        C RC++  L  ++P +F   D DS +C+
Sbjct:  529 CAGCQHPIGLSRGKAKVCCYSGWYYCQSCHQDNSFLIPARLLHNWDTTKHKVSEQAKEFLEFVYEEPLLDVHQLNPCLYQHCEPLSIVLRLRQQLQSLRAYLFSCRATIAEDLRRRIFPREYLLQHIH---LYSLADLQQVIDGKLAPFLTKVI-KFASAHVFSCSLCREKGFICELCHD-GQVIYPFQENATRSCDL--CGAVFHTECRQKAQP---CPRCVRRELHHKRPSSFWSPDDDSPDCF 764          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Medaka
Match: plekhm3 (pleckstrin homology domain containing M3 [Source:NCBI gene;Acc:101163618])

HSP 1 Score: 102.064 bits (253), Expect = 1.227e-21
Identity = 78/246 (31.71%), Postives = 117/246 (47.56%), Query Frame = 1
Query: 2218 CSTCSQP--LETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQH-LKVQQPITF--ADCDSANCY 2937
            C+ C  P  L   K  +  Y G  YC +C      +IP  +++NWD  +  VS   K FL  +   P +++   +  L+     LS V +LR +L  L   + SC    ++ +R  +FPR+Y+L  I    LYS+ DL  +  G L   L  VI K A  HV  C +CR K   C+ C D  +VIY  + +    C    C +V H EC+        C RC++  L  ++P +F   D DS +C+
Sbjct:  529 CAGCQHPIGLSRGKAKVCCYSGWYYCQSCHQDNSFLIPARLLHNWDTTKHKVSEQAKEFLEFVYEEPLLDVHQLNPCLYQHCEPLSIVLRLRQQLQSLRAYLFSCRATIAEDLRRRIFPREYLLQHIH---LYSLADLQQVIDGKLAPFLTKVI-KFASAHVFSCSLCREKGFICELCHD-GQVIYPFQENATRSCDL--CGAVFHTECRQKAQP---CPRCVRRELHHKRPSSFWSPDDDSPDCF 764          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Medaka
Match: rubcn (rubicon autophagy regulator [Source:NCBI gene;Acc:101157851])

HSP 1 Score: 84.7297 bits (208), Expect = 2.854e-16
Identity = 60/224 (26.79%), Postives = 103/224 (45.98%), Query Frame = 1
Query: 2218 CSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLR----HKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKES-DLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRR 2871
            C T   P    ++    Y G+ +C  C    ++V+P  ++  WDF++ +VS   +  LS+I   P  N  D +  L+  I  L  VR LR    H  NLL         +T +  +E +   D + G + E   LYS+ DL  + +G L   +  ++ K+   HV  C++C+ K   C+ C ++K +I+  ++ +   C    C++  H+ C         CRR
Sbjct:  739 CGTRIDPDYIKRLRYCEYLGRYFCQCCHENAQAVVPGRVLRKWDFSKYYVSNFARDLLSKIAGDPLFNPNDINSGLYKKIKALESVRVLRVQLFHMKNLL---------KTCRFAKEVLDQFDSLPGHLTEDLHLYSLNDLTAVRNGELAPRMKELL-KLGTMHVAGCMLCQAKGFVCEFCGNDKDIIFPFQLSKCQRCE--ECRACYHRSCFQAGKDCPRCRR 950          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Medaka
Match: rubcn (rubicon autophagy regulator [Source:NCBI gene;Acc:101157851])

HSP 1 Score: 84.7297 bits (208), Expect = 3.035e-16
Identity = 60/224 (26.79%), Postives = 103/224 (45.98%), Query Frame = 1
Query: 2218 CSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLR----HKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKES-DLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRR 2871
            C T   P    ++    Y G+ +C  C    ++V+P  ++  WDF++ +VS   +  LS+I   P  N  D +  L+  I  L  VR LR    H  NLL         +T +  +E +   D + G + E   LYS+ DL  + +G L   +  ++ K+   HV  C++C+ K   C+ C ++K +I+  ++ +   C    C++  H+ C         CRR
Sbjct:  714 CGTRIDPDYIKRLRYCEYLGRYFCQCCHENAQAVVPGRVLRKWDFSKYYVSNFARDLLSKIAGDPLFNPNDINSGLYKKIKALESVRVLRVQLFHMKNLL---------KTCRFAKEVLDQFDSLPGHLTEDLHLYSLNDLTAVRNGELAPRMKELL-KLGTMHVAGCMLCQAKGFVCEFCGNDKDIIFPFQLSKCQRCE--ECRACYHRSCFQAGKDCPRCRR 925          
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Medaka
Match: rubcn (rubicon autophagy regulator [Source:NCBI gene;Acc:101157851])

HSP 1 Score: 84.7297 bits (208), Expect = 3.135e-16
Identity = 60/224 (26.79%), Postives = 103/224 (45.98%), Query Frame = 1
Query: 2218 CSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLAD-HLTLFDVIPELSRVRQLR----HKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKES-DLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRR 2871
            C T   P    ++    Y G+ +C  C    ++V+P  ++  WDF++ +VS   +  LS+I   P  N  D +  L+  I  L  VR LR    H  NLL         +T +  +E +   D + G + E   LYS+ DL  + +G L   +  ++ K+   HV  C++C+ K   C+ C ++K +I+  ++ +   C    C++  H+ C         CRR
Sbjct:  739 CGTRIDPDYIKRLRYCEYLGRYFCQCCHENAQAVVPGRVLRKWDFSKYYVSNFARDLLSKIAGDPLFNPNDINSGLYKKIKALESVRVLRVQLFHMKNLL---------KTCRFAKEVLDQFDSLPGHLTEDLHLYSLNDLTAVRNGELAPRMKELL-KLGTMHVAGCMLCQAKGFVCEFCGNDKDIIFPFQLSKCQRCE--ECRACYHRSCFQAGKDCPRCRR 950          
BLAST of CLUMA_CG020736, isoform A vs. Planmine SMEST
Match: SMESG000018175.1 (SMESG000018175.1)

HSP 1 Score: 1138.25 bits (2943), Expect = 0.000e+0
Identity = 585/589 (99.32%), Postives = 587/589 (99.66%), Query Frame = 1
Query: 1174 VYAAIERIPFNLDTKSPLLNTWINSDALKIAGIEVLLTKNEKFELFNESNLNYDANSISSVTNEDIEEILTTSVTHSSKKYSQSVPKKEITFVANDSHRMXXXXXXXXXXXXXXXXXXCRQKNSETSIGDPETNIMEDFDTSTQSENDICHENNESIPEIFTSEKEIIYNDTLDNKPDSVEMCEXXXXXXXXXXXXTIVENSKSEANNINGKSYDELWSEHYLTTQKSNESARSDDILNSPLSNVTNNHEEPEDNSKESNSDILAQSKVYSSLIASKLITPTADFVYNLIVRRFNFPIFTVKESDQSWEFIGDDMITEKIEMKRLMDIFPGVDVCSTNDGLNSVFGGLCSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITFADCDSANCYK 2940
            +  +IERIPFNLDTKSPLLNTWINSDALKIAGIEVLLTKNEKFELFNESNLNYDANSISSVTNEDIEEILTTSVTHSSKKYSQSVPKKEITFVANDSHRMSNNPFEESFEDENEFPEDCRQKNSETSIGDPETNIMEDFDTSTQSENDICHENNESIPEIFTSEKEIIYNDTLDNKPDSVEMCENLSLDLSLVNSNTIVENSKSEANNINGKSYDELWSEHYLTTQKSNESARSDDILNSPLSNVTNNHEEPEDNSKESNSDILAQSKVYSSLIASKLITPTADFVYNLIVRRFNFPIFTVKESDQSWEFIGDDMITEKIEMKRLMDIFPGVDVCSTNDGLNSVFGGLCSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITFADCDSANCYK
Sbjct:  493 LLTSIERIPFNLDTKSPLLNTWINSDALKIAGIEVLLTKNEKFELFNESNLNYDANSISSVTNEDIEEILTTSVTHSSKKYSQSVPKKEITFVANDSHRMSNNPFEESFEDENEFPEDCRQKNSETSIGDPETNIMEDFDTSTQSENDICHENNESIPEIFTSEKEIIYNDTLDNKPDSVEMCENLSLDLSLVNSNTIVENSKSEANNINGKSYDELWSEHYLTTQKSNESARSDDILNSPLSNVTNNHEEPEDNSKESNSDILAQSKVYSSLIASKLITPTADFVYNLIVRRFNFPIFTVKESDQSWEFIGDDMITEKIEMKRLMDIFPGVDVCSTNDGLNSVFGGLCSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITFADCDSANCYK 1081          

HSP 2 Score: 217.238 bits (552), Expect = 2.954e-82
Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 1
Query:   22 VDKNIILDVLKKSIHNLLQSNELIDLVEIEDSIYTQNLCSAIEALFIQGQLKNQSFKLLSKISRRKHSYEYDFWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW 336
            VDKNIILDVLKKSIHNLLQSNELIDLVEIEDSIYTQNLCSAIEALFIQGQLKNQSFKLLSKISRRKHSYEYDFWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW
Sbjct:  343 VDKNIILDVLKKSIHNLLQSNELIDLVEIEDSIYTQNLCSAIEALFIQGQLKNQSFKLLSKISRRKHSYEYDFWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW 447          

HSP 3 Score: 109.383 bits (272), Expect = 2.954e-82
Identity = 58/90 (64.44%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  380 VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKMETFCGLLTCM----------FVFINQSIIKSTIKIYLSRITLTKQRSF 619
            VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKMETFCGLLT +             +N  I    +KI    + LTK   F
Sbjct:  446 VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKMETFCGLLTSIERIPFNLDTKSPLLNTWINSDALKIAGIEVLLTKNEKF 535          
BLAST of CLUMA_CG020736, isoform A vs. Planmine SMEST
Match: SMESG000018175.1 (SMESG000018175.1)

HSP 1 Score: 991.875 bits (2563), Expect = 0.000e+0
Identity = 527/589 (89.47%), Postives = 532/589 (90.32%), Query Frame = 1
Query: 1174 VYAAIERIPFNLDTKSPLLNTWINSDALKIAGIEVLLTKNEKFELFNESNLNYDANSISSVTNEDIEEILTTSVTHSSKKYSQSVPKKEITFVANDSHRMXXXXXXXXXXXXXXXXXXCRQKNSETSIGDPETNIMEDFDTSTQSENDICHENNESIPEIFTSEKEIIYNDTLDNKPDSVEMCEXXXXXXXXXXXXTIVENSKSEANNINGKSYDELWSEHYLTTQKSNESARSDDILNSPLSNVTNNHEEPEDNSKESNSDILAQSKVYSSLIASKLITPTADFVYNLIVRRFNFPIFTVKESDQSWEFIGDDMITEKIEMKRLMDIFPGVDVCSTNDGLNSVFGGLCSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITFADCDSANCYK 2940
            +  +IERIPFNLDTKSPLLNTWINSDALKIAGIEVLLTKNEKFELFNESNLNYDANSISSVTNEDIEEILTTSVTHSSKKYSQSVPKKEITFVANDSHRMSNNPFEESFEDENEFPEDCRQKNSETSIGDPETNIMEDFDTSTQSENDICHENNESIPEIFTSEKEIIYNDTLDNKPDSVEMCENLSLDLSLVNSNTIVENSKSEANNINGKSYDELWSEHYLTTQKSNESARSDDILNSPLSNVTNNHEEPEDNSKESNS                                                    D++ +  EMKRLMDIFPGVDVCSTNDGLNSVFGGLCSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITFADCDSANCYK
Sbjct:  376 LLTSIERIPFNLDTKSPLLNTWINSDALKIAGIEVLLTKNEKFELFNESNLNYDANSISSVTNEDIEEILTTSVTHSSKKYSQSVPKKEITFVANDSHRMSNNPFEESFEDENEFPEDCRQKNSETSIGDPETNIMEDFDTSTQSENDICHENNESIPEIFTSEKEIIYNDTLDNKPDSVEMCENLSLDLSLVNSNTIVENSKSEANNINGKSYDELWSEHYLTTQKSNESARSDDILNSPLSNVTNNHEEPEDNSKESNS----------------------------------------------------DILAQSKEMKRLMDIFPGVDVCSTNDGLNSVFGGLCSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLTLFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITFADCDSANCYK 912          

HSP 2 Score: 217.238 bits (552), Expect = 3.056e-82
Identity = 105/109 (96.33%), Postives = 107/109 (98.17%), Query Frame = 1
Query:   10 KSYMVDKNIILDVLKKSIHNLLQSNELIDLVEIEDSIYTQNLCSAIEALFIQGQLKNQSFKLLSKISRRKHSYEYDFWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW 336
            ++  VDKNIILDVLKKSIHNLLQSNELIDLVEIEDSIYTQNLCSAIEALFIQGQLKNQSFKLLSKISRRKHSYEYDFWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW
Sbjct:  222 ETQAVDKNIILDVLKKSIHNLLQSNELIDLVEIEDSIYTQNLCSAIEALFIQGQLKNQSFKLLSKISRRKHSYEYDFWNFIKGLIPKNLLYVLENHSFKLTAVGLSRVW 330          

HSP 3 Score: 109.768 bits (273), Expect = 3.056e-82
Identity = 58/90 (64.44%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  380 VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKMETFCGLLTCM----------FVFINQSIIKSTIKIYLSRITLTKQRSF 619
            VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKMETFCGLLT +             +N  I    +KI    + LTK   F
Sbjct:  329 VWLRFALNECTILSYIDSVRADTKRLQQFYSKDSLIRDDEKMETFCGLLTSIERIPFNLDTKSPLLNTWINSDALKIAGIEVLLTKNEKF 418          
BLAST of CLUMA_CG020736, isoform A vs. Planmine SMEST
Match: SMESG000019858.1 (SMESG000019858.1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.291e-11
Identity = 59/193 (30.57%), Postives = 93/193 (48.19%), Query Frame = 1
Query: 2266 HYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLT--LFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLL-FVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            HY G  +C+ C S    VIP  I+  WDF    VS   +  L+ I S P  + A H +  L   +     V +LR +  LL   + SC    +  IR++M    + L  I    ++SI DL ++ SG +E+ L  FV+   A+ HV  C +C+     C+ C ++  VI+  E+D+  +C+   C    H +C
Sbjct:  510 HYYGYYFCSVCHSNTLMVIPARILTGWDFTMHPVSCLARDLLNVIHSEPLFS-ASHFSDGLRSSLRVFGAVMRLRLQGRLLLGFIGSCRQVGNDLIRKSMRLPCHWLSDI--CPMFSIADLQLIESGTMERNLKSFVME--AVEHVSICPLCQAHGYLCELCHNQSDVIFPFELDKVHQCN--RCFGCSHIKC 695          
BLAST of CLUMA_CG020736, isoform A vs. Planmine SMEST
Match: SMESG000019858.1 (SMESG000019858.1)

HSP 1 Score: 67.0106 bits (162), Expect = 4.828e-11
Identity = 59/193 (30.57%), Postives = 94/193 (48.70%), Query Frame = 1
Query: 2266 HYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLT--LFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLL-FVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            HY G  +C+ C S    VIP  I+  WDF    VS   +  L+ I S P  + A H +  L   +     V +LR +  LL   + SC  + +  IR++M    + L  I    ++SI DL ++ SG +E+ L  FV+   A+ HV  C +C+     C+ C ++  VI+  E+D+  +C+   C    H +C
Sbjct:  369 HYYGYYFCSVCHSNTLMVIPARILTGWDFTMHPVSCLARDLLNVIHSEPLFS-ASHFSDGLRSSLRVFGAVMRLRLQGRLLLGFIGSCR-QGNDLIRKSMRLPCHWLSDI--CPMFSIADLQLIESGTMERNLKSFVME--AVEHVSICPLCQAHGYLCELCHNQSDVIFPFELDKVHQCNR--CFGCSHIKC 553          
BLAST of CLUMA_CG020736, isoform A vs. Planmine SMEST
Match: SMESG000019858.1 (SMESG000019858.1)

HSP 1 Score: 67.0106 bits (162), Expect = 4.846e-11
Identity = 59/193 (30.57%), Postives = 94/193 (48.70%), Query Frame = 1
Query: 2266 HYDGKLYCTNCQSGIKSVIPRNIIYNWDFNQKFVSLTTKRFLSEIMSHPNINLADHLT--LFDVIPELSRVRQLRHKLNLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGVLEKTLL-FVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCECSTPSCKSVIHKEC 2835
            HY G  +C+ C S    VIP  I+  WDF    VS   +  L+ I S P  + A H +  L   +     V +LR +  LL   + SC  + +  IR++M    + L  I    ++SI DL ++ SG +E+ L  FV+   A+ HV  C +C+     C+ C ++  VI+  E+D+  +C+   C    H +C
Sbjct:  355 HYYGYYFCSVCHSNTLMVIPARILTGWDFTMHPVSCLARDLLNVIHSEPLFS-ASHFSDGLRSSLRVFGAVMRLRLQGRLLLGFIGSCR-QGNDLIRKSMRLPCHWLSDI--CPMFSIADLQLIESGTMERNLKSFVME--AVEHVSICPLCQAHGYLCELCHNQSDVIFPFELDKVHQCNR--CFGCSHIKC 539          
The following BLAST results are available for this feature:
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLEKHM37.865e-2231.25pleckstrin homology domain containing M3 [Source:H... [more]
PLEKHM37.865e-2231.25pleckstrin homology domain containing M3 [Source:H... [more]
PLEKHM13.323e-1929.10pleckstrin homology and RUN domain containing M1 [... [more]
PLEKHM13.323e-1929.10pleckstrin homology and RUN domain containing M1 [... [more]
PLEKHM13.323e-1929.10pleckstrin homology and RUN domain containing M1 [... [more]
back to top
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cup-144.159e-1930.58pep chromosome:WBcel235:II:13855788:13860058:-1 ge... [more]
cup-144.159e-1930.58pep chromosome:WBcel235:II:13855788:13860079:-1 ge... [more]
cup-144.159e-1930.58pep chromosome:WBcel235:II:13855788:13861040:-1 ge... [more]
cup-144.159e-1930.58pep chromosome:WBcel235:II:13855788:13868119:-1 ge... [more]
cup-144.159e-1930.58pep chromosome:WBcel235:II:13855788:13858798:-1 ge... [more]
back to top
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Plekhm11.157e-2229.55gene:FBgn0034694 transcript:FBtr0071758[more]
CG115346.396e-1328.27gene:FBgn0046296 transcript:FBtr0075995[more]
CG127721.283e-821.80gene:FBgn0030055 transcript:FBtr0331728[more]
CG127721.283e-821.80gene:FBgn0030055 transcript:FBtr0071221[more]
back to top
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR407600.18.450e-2330.77pleckstrin homology domain containing, family M, m... [more]
plekhm38.565e-2330.77pleckstrin homology domain containing, family M, m... [more]
plekhm38.565e-2330.77pleckstrin homology domain containing, family M, m... [more]
rubcn8.995e-2031.25rubicon autophagy regulator [Source:ZFIN;Acc:ZDB-G... [more]
rubcn1.023e-1931.25rubicon autophagy regulator [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smim194.476e-2230.36small integral membrane protein 19 [Source:Xenbase... [more]
ENSXETT00000046914.11.155e-1832.23RUN domain and cysteine-rich domain containing, Be... [more]
ENSXETT00000046930.11.169e-1832.23RUN domain and cysteine-rich domain containing, Be... [more]
ENSXETT00000046840.11.379e-1832.23RUN domain and cysteine-rich domain containing, Be... [more]
ENSXETT00000046880.11.477e-1832.23RUN domain and cysteine-rich domain containing, Be... [more]
back to top
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plekhm31.642e-2131.25pleckstrin homology domain containing, family M, m... [more]
Plekhm31.642e-2131.25pleckstrin homology domain containing, family M, m... [more]
Plekhm16.524e-1928.93pleckstrin homology domain containing, family M (w... [more]
Def87.653e-1726.42differentially expressed in FDCP 8 [Source:MGI Sym... [more]
Def88.488e-1723.55differentially expressed in FDCP 8 [Source:MGI Sym... [more]
back to top
BLAST of CLUMA_CG020736, isoform A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08AW4|PKHM3_XENLA2.085e-2130.36Pleckstrin homology domain-containing family M mem... [more]
sp|Q6ZWE6|PKHM3_HUMAN3.777e-2131.25Pleckstrin homology domain-containing family M mem... [more]
sp|Q8BM47|PKHM3_MOUSE1.149e-2031.25Pleckstrin homology domain-containing family M mem... [more]
sp|Q5PQS0|PKHM1_RAT9.915e-1928.93Pleckstrin homology domain-containing family M mem... [more]
sp|Q9Y4G2|PKHM1_HUMAN1.596e-1829.10Pleckstrin homology domain-containing family M mem... [more]
back to top
BLAST of CLUMA_CG020736, isoform A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RJN86.355e-5841.80RUN domain-containing protein OS=Fasciola hepatica... [more]
A0A4S2MDF81.219e-5738.57RUN domain-containing protein OS=Opisthorchis feli... [more]
A0A5J4NHM76.280e-5640.07DUF4206 domain-containing protein OS=Paragonimus w... [more]
A0A3R7JNB01.274e-5437.55Pleckstrin homology domain-containing family M mem... [more]
A0A1S8WY153.683e-5337.91DUF4206 domain-containing protein OS=Opisthorchis ... [more]
back to top
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhm31.264e-2230.34pleckstrin homology domain containing M3 [Source:N... [more]
def81.063e-1625.75differentially expressed in FDCP 8 homolog [Source... [more]
rubcn2.442e-1526.92rubicon autophagy regulator [Source:NCBI gene;Acc:... [more]
rubcn2.664e-1526.92rubicon autophagy regulator [Source:NCBI gene;Acc:... [more]
rubcn2.881e-1526.92rubicon autophagy regulator [Source:NCBI gene;Acc:... [more]
back to top
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
plekhm18.895e-2128.05pleckstrin homology domain containing, family M (w... [more]
ENSPMAT00000008319.13.661e-1527.80pep scaffold:Pmarinus_7.0:GL477638:57374:63041:-1 ... [more]
back to top
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO321874.935e-2737.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459851.506e-1428.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460851.026e-932.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CLUMA_CG020736, isoform A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhm31.227e-2131.71pleckstrin homology domain containing M3 [Source:N... [more]
plekhm31.227e-2131.71pleckstrin homology domain containing M3 [Source:N... [more]
rubcn2.854e-1626.79rubicon autophagy regulator [Source:NCBI gene;Acc:... [more]
rubcn3.035e-1626.79rubicon autophagy regulator [Source:NCBI gene;Acc:... [more]
rubcn3.135e-1626.79rubicon autophagy regulator [Source:NCBI gene;Acc:... [more]
back to top
BLAST of CLUMA_CG020736, isoform A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018175.12.954e-8299.32SMESG000018175.1[more]
SMESG000018175.13.056e-8289.47SMESG000018175.1[more]
SMESG000019858.11.291e-1130.57SMESG000019858.1[more]
SMESG000019858.14.828e-1130.57SMESG000019858.1[more]
SMESG000019858.14.846e-1130.57SMESG000019858.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006749 ID=SMED30006749|Name=CLUMA_CG020736, isoform A|organism=Schmidtea mediterranea sexual|type=transcript|length=3019bp
AATCTATATAAATCTTATATGGTTGACAAAAACATTATTCTTGATGTTCT
TAAGAAATCAATTCATAATCTGCTGCAATCAAACGAATTGATAGATCTCG
TTGAAATAGAAGATTCAATTTACACTCAAAATCTATGTTCAGCGATTGAA
GCGTTATTTATACAAGGCCAGCTTAAAAATCAGTCATTCAAACTTTTATC
TAAAATAAGCAGGAGAAAGCATTCTTATGAATACGATTTTTGGAATTTTA
TTAAAGGCTTAATACCAAAAAATTTATTATATGTTTTAGAAAACCATTCC
TTCAAACTAACTGCAGTTGGCTTAAGTAGAGTATGGAAATTGAATGTTTC
CAGTACGGTATTGAAAATGTAATTTATAGGTTTGGCTTAGATTTGCATTA
AATGAATGCACTATATTGAGCTATATAGATTCCGTTCGAGCTGACACAAA
ACGATTACAGCAATTTTATTCCAAAGACTCACTAATAAGGGACGATGAAA
AGATGGAAACGTTTTGTGGCTTGCTTACATGTATGTTTGTCTTTATAAAT
CAATCCATTATAAAATCCACGATTAAAATATATCTGTCCCGAATTACATT
GACAAAACAGCGGAGTTTTTCCACTTGTTTTAATGGACATGTAAGAAATA
ATAATCAATAAACAAAGATTTGCACTTTTCACACTAAAATAAAATCAATA
TTGTAAAGTGGCCGTATTCAAATTTCGTCAAAAGTCCCAAAGTGAATATA
TCTACACGCCATTCGCGCTATATTGGACAGGTTTTCACTTTAAATTGTAG
TAATTCATAGTGGCGTTACCCGCTCGCATCTACCGATAGTTACAATATAA
CCATTTGTTATGTCCTGAGACTCGCACAGAATCGAGGAATTAATAAATCC
GTGAATAGCTATCGGTAAGTATTATCGATGCACTGGAGAGTGACGTGAGG
AACTCGGGACGGAAGCCCATCATTCAATATCTCTATATGACCTATGAACG
GCAAACTAATTGCCCGTTTCCCATGGTTGCAGAATGCAACAGGTTACAAA
CCGCTGGTTTATGCAAATACCATTTTAAAAGAACAGCTGACAATGCGCAC
ACGAAATTCACAGCTGAATCGCTTTTGTCCTGATTATAATGTGTGCATAA
TATTTACTGTTTACGATATATTTGTGTACGCAGCCATTGAGCGCATACCG
TTTAATCTGGATACAAAATCACCACTACTGAACACTTGGATCAATTCCGA
TGCGTTGAAAATCGCTGGCATCGAGGTTTTGTTGACGAAAAATGAAAAAT
TTGAACTATTTAATGAATCGAACTTAAATTACGATGCGAATTCAATTTCC
TCTGTCACTAACGAAGACATTGAAGAAATATTAACCACGAGTGTGACGCA
TTCCTCCAAAAAATATAGTCAATCCGTTCCGAAAAAAGAAATTACGTTCG
TTGCAAATGATTCTCACAGAATGTCAAATAATCCATTTGAGGAATCTTTT
GAAGATGAAAATGAATTTCCGGAAGATTGTAGACAAAAAAACTCTGAGAC
TTCTATTGGGGATCCGGAAACCAATATAATGGAAGATTTTGATACATCGA
CTCAATCGGAAAATGATATTTGCCATGAAAATAATGAAAGCATACCAGAA
ATATTTACTTCTGAAAAAGAAATTATTTATAATGATACACTGGATAATAA
ACCGGATAGTGTAGAAATGTGTGAAAATTTGTCATTGGATTTGTCCCTTG
TGAATTCTAATACTATCGTTGAAAATTCCAAAAGTGAAGCAAACAATATT
AATGGCAAATCTTATGACGAATTGTGGTCAGAACATTACTTAACTACACA
AAAGTCGAATGAATCCGCACGGTCAGATGACATTTTAAATTCTCCATTAT
CGAATGTTACAAATAATCACGAAGAACCCGAAGACAATAGTAAAGAATCC
AATTCAGATATTTTAGCACAGTCAAAGGTTTATTCATCATTAATTGCTAG
CAAATTAATTACACCCACAGCTGATTTTGTCTATAATTTAATCGTACGGA
GATTTAATTTCCCTATTTTCACAGTCAAGGAGTCAGATCAATCTTGGGAG
TTCATAGGAGACGACATGATCACAGAAAAAATAGAGATGAAAAGGTTGAT
GGATATTTTCCCAGGGGTAGATGTATGTTCCACTAACGATGGACTAAATT
CAGTATTTGGTGGGTTATGCTCAACGTGTTCGCAACCATTAGAAACTAAT
AAAGTTATAATTGATCATTATGATGGGAAATTGTATTGTACTAATTGTCA
GTCAGGAATAAAATCTGTTATTCCAAGAAATATTATTTACAATTGGGATT
TCAATCAGAAATTCGTGTCCCTGACTACAAAAAGGTTTCTCTCAGAAATA
ATGAGTCATCCTAACATAAATCTTGCTGATCACTTGACTTTATTTGATGT
TATTCCTGAATTATCTCGGGTTCGTCAATTAAGGCATAAATTAAATCTTC
TGTGGTTGCAAGTTACTTCATGTGACATAGAAACATCAAAAAGAATTCGT
GAAGCAATGTTTCCACGAGATTATATGTTGGGAAGTATAAAAGAAAGTGA
TTTATATTCGATTGAAGATTTGATTATTTTACATAGCGGTGTTCTTGAAA
AAACACTTCTATTTGTTATTAATAAAATTGCCATACCACATGTCAAAAAA
TGCTTGATATGTCGCATGAAAACAATGGCATGTGATAAATGTCGCGATGA
AAAAAAAGTTATATATATTCACGAAATCGACGAATATTGTGAGTGTTCCA
CTCCTTCATGTAAATCAGTAATACATAAAGAATGCAAAAGTCCGACGATT
GTGTCATTTTATTGTCGTAGGTGTATACAACACCTTAAAGTACAACAACC
AATAACTTTTGCCGATTGTGATTCTGCAAATTGTTATAAGTGATTGAATT
TACATCAAGATTTTATATTTTGGATTATTTTCGCTATATCGACACATCTT
AATTGAGCGTCTCACTTTT
back to top

protein sequence of SMED30006749-orf-1

>SMED30006749-orf-1 ID=SMED30006749-orf-1|Name=SMED30006749-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
NLYKSYMVDKNIILDVLKKSIHNLLQSNELIDLVEIEDSIYTQNLCSAIE
ALFIQGQLKNQSFKLLSKISRRKHSYEYDFWNFIKGLIPKNLLYVLENHS
FKLTAVGLSRVWKLNVSSTVLKM*
back to top

protein sequence of SMED30006749-orf-2

>SMED30006749-orf-2 ID=SMED30006749-orf-2|Name=SMED30006749-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=650bp
MNGKLIARFPWLQNATGYKPLVYANTILKEQLTMRTRNSQLNRFCPDYNV
CIIFTVYDIFVYAAIERIPFNLDTKSPLLNTWINSDALKIAGIEVLLTKN
EKFELFNESNLNYDANSISSVTNEDIEEILTTSVTHSSKKYSQSVPKKEI
TFVANDSHRMSNNPFEESFEDENEFPEDCRQKNSETSIGDPETNIMEDFD
TSTQSENDICHENNESIPEIFTSEKEIIYNDTLDNKPDSVEMCENLSLDL
SLVNSNTIVENSKSEANNINGKSYDELWSEHYLTTQKSNESARSDDILNS
PLSNVTNNHEEPEDNSKESNSDILAQSKVYSSLIASKLITPTADFVYNLI
VRRFNFPIFTVKESDQSWEFIGDDMITEKIEMKRLMDIFPGVDVCSTNDG
LNSVFGGLCSTCSQPLETNKVIIDHYDGKLYCTNCQSGIKSVIPRNIIYN
WDFNQKFVSLTTKRFLSEIMSHPNINLADHLTLFDVIPELSRVRQLRHKL
NLLWLQVTSCDIETSKRIREAMFPRDYMLGSIKESDLYSIEDLIILHSGV
LEKTLLFVINKIAIPHVKKCLICRMKTMACDKCRDEKKVIYIHEIDEYCE
CSTPSCKSVIHKECKSPTIVSFYCRRCIQHLKVQQPITFADCDSANCYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004012Run_dom
IPR011528NERD
IPR025258Zf-RING_9
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0004386helicase activity
GO:0005524ATP binding
GO:0008026ATP-dependent helicase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025258Putative zinc-RING and/or ribbonSMARTSM01175DUF4206_2coord: 392..599
e-value: 5.0E-23
score: 92.5
IPR025258Putative zinc-RING and/or ribbonPFAMPF13901zf-RING_9coord: 392..596
e-value: 2.0E-37
score: 129.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 255..276
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 255..288
NoneNo IPR availablePANTHERPTHR12326:SF12coord: 32..594
NoneNo IPR availablePANTHERPTHR12326PLECKSTRIN HOMOLOGY DOMAIN CONTAINING PROTEINcoord: 32..594
NoneNo IPR availableTMHMMTMhelixcoord: 13..32