EED-1

Overview
NameEED-1 (AFD29604.1)
Smed IDSMED30006748
Length (bp)1398
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EED-1 (SMED30006748) t-SNE clustered cells

Violin plots show distribution of expression levels for EED-1 (SMED30006748) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EED-1 (SMED30006748) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EED-1 (SMED30006748) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006748

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006748SMESG000045902.1 SmedASXL_013489SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
tail stripeSMED30006748SMESG000045902.1 isotig15566be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30006748SMESG000045902.1 isotig15566be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EED-1 vs. Ensembl Human
Match: EED (embryonic ectoderm development [Source:HGNC Symbol;Acc:HGNC:3188])

HSP 1 Score: 302.753 bits (774), Expect = 7.347e-98
Identity = 158/400 (39.50%), Postives = 221/400 (55.25%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPS-----ILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+MN+I +S  Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KPS     IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    + +     IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   82 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDI-------DKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDR 439          
BLAST of EED-1 vs. Ensembl Human
Match: EED (embryonic ectoderm development [Source:HGNC Symbol;Acc:HGNC:3188])

HSP 1 Score: 302.753 bits (774), Expect = 7.347e-98
Identity = 158/400 (39.50%), Postives = 221/400 (55.25%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPS-----ILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+MN+I +S  Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KPS     IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    + +     IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   82 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDI-------DKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDR 439          
BLAST of EED-1 vs. Ensembl Human
Match: EED (embryonic ectoderm development [Source:HGNC Symbol;Acc:HGNC:3188])

HSP 1 Score: 302.368 bits (773), Expect = 6.171e-97
Identity = 158/400 (39.50%), Postives = 221/400 (55.25%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPS-----ILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+MN+I +S  Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KPS     IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    + +     IRQT F+ D+ IL+  CD   I R+DR
Sbjct:  142 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDI-------DKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDR 499          
BLAST of EED-1 vs. Ensembl Human
Match: EED (embryonic ectoderm development [Source:HGNC Symbol;Acc:HGNC:3188])

HSP 1 Score: 288.886 bits (738), Expect = 3.244e-92
Identity = 158/425 (37.18%), Postives = 221/425 (52.00%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSK-------------------------SCEGYLVLWKPGSLNSSLLPTFKIGQDVKPS-----ILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+MN+I +S  Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SK                         SCE  +V WKPG +   +         +KPS     IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    + +     IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   82 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSGRAILHSHQQCMRDPVSPNLRQHLSCENAIVCWKPGKMEDDI-------DKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDR 464          
BLAST of EED-1 vs. Ensembl Human
Match: EED (embryonic ectoderm development [Source:HGNC Symbol;Acc:HGNC:3188])

HSP 1 Score: 283.493 bits (724), Expect = 6.531e-91
Identity = 142/344 (41.28%), Postives = 198/344 (57.56%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPS-----ILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLR 1218
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+MN+I +S  Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KPS     IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L 
Sbjct:   82 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDI-------DKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE 392          
BLAST of EED-1 vs. Ensembl Celegans
Match: mes-6 (Polycomb protein mes-6 [Source:UniProtKB/Swiss-Prot;Acc:Q9GYS1])

HSP 1 Score: 88.5817 bits (218), Expect = 1.038e-18
Identity = 98/453 (21.63%), Postives = 164/453 (36.20%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDG-------MFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVF----------------------------DTFLQ---------------HFPDFSSNKIHGNYIDCGRWFGGL--VFSKSC--EGYLVLWKPGSLNSSLLPTFKIGQDVKP----SILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            F  TA + E    +I+G + N     ++   +   +VGG  +  Y   +D  INNI+                  WS   P    ++  R+         +++Y          V   G  G I +I      +   L   G  IN+I   P   +L+   S D +IR+ ++ N   + + GG E H   IL  D    G F+LSCG DH +  W L   ++   + ++ K LH +   V                             D  L+               + P   S  +H +Y+DC R+  G     SK C  E  +  W+ G     +      G  ++P    +      +     W+++F +D +R  L  G   G +  ++LR+ + T       +  +            T+RQ  F+   + L+   D G + RFDR
Sbjct:   27 FVLTAKLLEDQKKAIYGCAFNQYAGIDEEQAV--ATVGGSFLHMYSVPID--INNIEL----------------QWSCNFPTDKSSKVEREESLFTVTWCYDTYEAENDRNPFKVVTGGTLGHIYVIDYVSRKLSNRLRSVGWEINDIRTCPANSNLIVCASSDQSIRIHHIRNEACLIVIGGLECHAGTILSVDWSTDGDFILSCGFDHQLMEWDLSVKQVKEHLERACKALHQDKINVLTQSQDIPYVSKGTMRKSAVSRNIPDKEEDQLLELHRELIPRPSCLLPIYTPSSVSTDMHSDYVDCIRFLIGTNYALSKGCGNEKAIHFWRFGPPKGEVENRIH-GNVLRPKSCTTKFRTMNVPSGSAWFIKFAVDPRRRWLVCGGAGGSVMFFDLRNNEETNPTHTCSVGSR------------TVRQASFSTCGRFLVLVTDEGFVCRFDR 446          
BLAST of EED-1 vs. Ensembl Celegans
Match: wdr-23 (DDB1- and CUL4-associated factor 11 homolog [Source:UniProtKB/Swiss-Prot;Acc:P90794])

HSP 1 Score: 51.9878 bits (123), Expect = 7.290e-7
Identity = 28/102 (27.45%), Postives = 48/102 (47.06%), Query Frame = 1
Query:  592 LGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWN--VWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHEN 891
            +  H   +N + F  L  +L++S   D  +++W+   W+   V   G   GHR  + H D     R+LLS   D TIK+W L     M+ +  +R  +  ++
Sbjct:  234 VNAHEDDVNSVCFADLGSNLIYSAGDDGLVKVWDKRAWSDGDVEPVGVFAGHRDGVTHVDSRQDERYLLSNSKDQTIKVWDLRKFSNMSGVEATRACVQSQH 335          
BLAST of EED-1 vs. Ensembl Celegans
Match: wdr-23 (DDB1- and CUL4-associated factor 11 homolog [Source:UniProtKB/Swiss-Prot;Acc:P90794])

HSP 1 Score: 51.9878 bits (123), Expect = 7.290e-7
Identity = 28/102 (27.45%), Postives = 48/102 (47.06%), Query Frame = 1
Query:  592 LGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWN--VWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHEN 891
            +  H   +N + F  L  +L++S   D  +++W+   W+   V   G   GHR  + H D     R+LLS   D TIK+W L     M+ +  +R  +  ++
Sbjct:  234 VNAHEDDVNSVCFADLGSNLIYSAGDDGLVKVWDKRAWSDGDVEPVGVFAGHRDGVTHVDSRQDERYLLSNSKDQTIKVWDLRKFSNMSGVEATRACVQSQH 335          
BLAST of EED-1 vs. Ensembl Celegans
Match: wdr-23 (DDB1- and CUL4-associated factor 11 homolog [Source:UniProtKB/Swiss-Prot;Acc:P90794])

HSP 1 Score: 51.6026 bits (122), Expect = 8.615e-7
Identity = 28/102 (27.45%), Postives = 48/102 (47.06%), Query Frame = 1
Query:  592 LGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWN--VWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHEN 891
            +  H   +N + F  L  +L++S   D  +++W+   W+   V   G   GHR  + H D     R+LLS   D TIK+W L     M+ +  +R  +  ++
Sbjct:  266 VNAHEDDVNSVCFADLGSNLIYSAGDDGLVKVWDKRAWSDGDVEPVGVFAGHRDGVTHVDSRQDERYLLSNSKDQTIKVWDLRKFSNMSGVEATRACVQSQH 367          
BLAST of EED-1 vs. Ensembl Celegans
Match: wdr-23 (DDB1- and CUL4-associated factor 11 homolog [Source:UniProtKB/Swiss-Prot;Acc:P90794])

HSP 1 Score: 51.6026 bits (122), Expect = 8.615e-7
Identity = 28/102 (27.45%), Postives = 48/102 (47.06%), Query Frame = 1
Query:  592 LGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWN--VWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHEN 891
            +  H   +N + F  L  +L++S   D  +++W+   W+   V   G   GHR  + H D     R+LLS   D TIK+W L     M+ +  +R  +  ++
Sbjct:  266 VNAHEDDVNSVCFADLGSNLIYSAGDDGLVKVWDKRAWSDGDVEPVGVFAGHRDGVTHVDSRQDERYLLSNSKDQTIKVWDLRKFSNMSGVEATRACVQSQH 367          
BLAST of EED-1 vs. Ensembl Fly
Match: escl (gene:FBgn0032391 transcript:FBtr0342581)

HSP 1 Score: 295.049 bits (754), Expect = 5.958e-95
Identity = 155/400 (38.75%), Postives = 221/400 (55.25%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDT---PINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNL--RDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            +K ++ ++E HN+ IFG+  N  +  ++  P +F +VG   V+ YEC   T       I+ L  Y D D +E FY CAWSY                         G  ++A AG +G+IRI +P       N  GHG +INE+ FHP  P LL S SKD+++RLWN+ + V V +FGG EGHR E+L  D D+ G  ++S GMDH++K+W+LD   +  +I  S  +  ++N   F T  +HFPDFS+  IH NY+DC +WFG  VFSKSCE  +V WKPG L+ S        Q+   ++LH F+   C+IW+VRF  +  + +LALGN+LG  +VW L   D  +T+ + +   K              TIRQT F+ D  IL+C CD   + R+DR
Sbjct:   97 YKYSSHVREDHNHQIFGVQFNPFL--DRGQPQVFATVGKDRVSIYECERSTGQESCEGIRLLQVYADPDTDESFYTCAWSY---------------------DSVTGDPVLAAAGYRGVIRIFNPVKHQCSKNYIGHGHAINELKFHPTRPQLLLSGSKDHSLRLWNIQSDVCVAVFGGVEGHRDEVLSVDFDLRGDRIMSSGMDHSLKLWRLDKPDIKEAIELSSGFSPNKNTGPFPTIKEHFPDFSTRDIHRNYVDCVQWFGDFVFSKSCENSIVCWKPGKLSESWHEIKP--QESATTVLHHFDYKMCEIWFVRFAFNAWQKILALGNQLGTTFVWELDCNDPNLTKCSQLVHPKSNS-----------TIRQTSFSKDGSILVCVCDDSTVWRWDR 460          
BLAST of EED-1 vs. Ensembl Fly
Match: escl (gene:FBgn0032391 transcript:FBtr0080286)

HSP 1 Score: 295.049 bits (754), Expect = 5.958e-95
Identity = 155/400 (38.75%), Postives = 221/400 (55.25%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDT---PINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNL--RDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            +K ++ ++E HN+ IFG+  N  +  ++  P +F +VG   V+ YEC   T       I+ L  Y D D +E FY CAWSY                         G  ++A AG +G+IRI +P       N  GHG +INE+ FHP  P LL S SKD+++RLWN+ + V V +FGG EGHR E+L  D D+ G  ++S GMDH++K+W+LD   +  +I  S  +  ++N   F T  +HFPDFS+  IH NY+DC +WFG  VFSKSCE  +V WKPG L+ S        Q+   ++LH F+   C+IW+VRF  +  + +LALGN+LG  +VW L   D  +T+ + +   K              TIRQT F+ D  IL+C CD   + R+DR
Sbjct:   97 YKYSSHVREDHNHQIFGVQFNPFL--DRGQPQVFATVGKDRVSIYECERSTGQESCEGIRLLQVYADPDTDESFYTCAWSY---------------------DSVTGDPVLAAAGYRGVIRIFNPVKHQCSKNYIGHGHAINELKFHPTRPQLLLSGSKDHSLRLWNIQSDVCVAVFGGVEGHRDEVLSVDFDLRGDRIMSSGMDHSLKLWRLDKPDIKEAIELSSGFSPNKNTGPFPTIKEHFPDFSTRDIHRNYVDCVQWFGDFVFSKSCENSIVCWKPGKLSESWHEIKP--QESATTVLHHFDYKMCEIWFVRFAFNAWQKILALGNQLGTTFVWELDCNDPNLTKCSQLVHPKSNS-----------TIRQTSFSKDGSILVCVCDDSTVWRWDR 460          
BLAST of EED-1 vs. Ensembl Fly
Match: esc (gene:FBgn0000588 transcript:FBtr0080325)

HSP 1 Score: 281.952 bits (720), Expect = 2.087e-90
Identity = 151/400 (37.75%), Postives = 219/400 (54.75%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPS-----ILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            +K    +KE+H  +IFG++ N  + K+  +P +F + G   VT YEC        ++ LH Y D DP+E FY CAWSY                            ++A AG +G+IR+I    +  + N  GHGQ+INE+ FHP    LL S SKD+ IRLWN+ + V + I GG EGHR E+L  D +M G  ++S GMDH++K+W L+     + I  S  +   ++ + F T  +HFPDFS+  IH NY+DC +WFG  V SKSCE  +V WKPG L+ S        + VKPS     I+ +FE D+C+IW+VRF  +  + ++ALGN+ G +YVW L D    EG  +  L   + +         T+RQ  F+ DA +L+  CD   + R++R
Sbjct:   62 YKYDTHVKENHGANIFGVAFNTLLGKD--EPQVFATAGSNRVTVYECPRQ---GGMQLLHCYADPDPDEVFYTCAWSY---------------------DLKTSSPLLAAAGYRGVIRVIDVEQNEAVGNYIGHGQAINELKFHPHKLQLLLSGSKDHAIRLWNIQSHVCIAILGGVEGHRDEVLSIDFNMRGDRIVSSGMDHSLKLWCLNTPEFHHKIELSNTFSQEKSTLPFPTVTKHFPDFSTRDIHRNYVDCVQWFGNFVLSKSCENAIVCWKPGQLHQSF-------EQVKPSDSSCTIIAEFEYDECEIWFVRFGFNPWQKVIALGNQQGKVYVWEL-DPSDPEGAHMTTLHNSRSV--------ATVRQIAFSRDASVLVYVCDDATVWRWNR 419          
BLAST of EED-1 vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0087241)

HSP 1 Score: 55.4546 bits (132), Expect = 5.382e-8
Identity = 34/91 (37.36%), Postives = 45/91 (49.45%), Query Frame = 1
Query:  586 FNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGD------VDMAGRFLLSCGMDHTIKIWKLDDS 840
            F+L GH  SI  +IFHP++  L+ S S+D TIR+W+         F   E  RS   H D       D  G+ L SC  D +IK+W    S
Sbjct:  102 FSLTGHRASITRVIFHPIFA-LMVSASEDATIRIWD---------FETGEYERSLKGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQS 182          
BLAST of EED-1 vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0304747)

HSP 1 Score: 55.4546 bits (132), Expect = 5.382e-8
Identity = 34/91 (37.36%), Postives = 45/91 (49.45%), Query Frame = 1
Query:  586 FNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGD------VDMAGRFLLSCGMDHTIKIWKLDDS 840
            F+L GH  SI  +IFHP++  L+ S S+D TIR+W+         F   E  RS   H D       D  G+ L SC  D +IK+W    S
Sbjct:  102 FSLTGHRASITRVIFHPIFA-LMVSASEDATIRIWD---------FETGEYERSLKGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQS 182          
BLAST of EED-1 vs. Ensembl Zebrafish
Match: eed (embryonic ectoderm development [Source:NCBI gene;Acc:550463])

HSP 1 Score: 292.352 bits (747), Expect = 5.325e-94
Identity = 155/400 (38.75%), Postives = 217/400 (54.25%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKP-----SILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE H   +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW++                      C+    ++A AG +GIIRII+      + +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+LD  RL  +I  S +Y   +    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KP     +IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    +       IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   84 FKCVNSLKEDHGQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYEC---HSQGEIRLLQSYVDADADENFYTCAWTF---------------------DCSSSHPLLAVAGSRGIIRIINHITMQCVKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADFDLLGEKIMSCGMDHSLKLWRLDSERLQRAIRGSYEYNPSKTNRPFVSQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGRMEDDI-------DRIKPNESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTLPRCTSAIRQTSFSRDSSILIAVCDDASIWRWDR 441          
BLAST of EED-1 vs. Ensembl Zebrafish
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 51.9878 bits (123), Expect = 1.039e-6
Identity = 26/80 (32.50%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  586 FNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIW 825
            + L GH   +  +IFHP++  L+ S S+D TI++W+             +GH   +     D  G+ L SC  D TIK+W
Sbjct:  102 YALSGHRSPVTRVIFHPVF-SLMVSASEDATIKVWDYEAGDFERTL---KGHTDSVQDISFDQTGKLLASCSADMTIKLW 177          
BLAST of EED-1 vs. Ensembl Zebrafish
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 51.9878 bits (123), Expect = 1.039e-6
Identity = 26/80 (32.50%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  586 FNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIW 825
            + L GH   +  +IFHP++  L+ S S+D TI++W+             +GH   +     D  G+ L SC  D TIK+W
Sbjct:  102 YALSGHRSPVTRVIFHPVF-SLMVSASEDATIKVWDYEAGDFERTL---KGHTDSVQDISFDQTGKLLASCSADMTIKLW 177          
BLAST of EED-1 vs. Ensembl Zebrafish
Match: copa (coatomer protein complex, subunit alpha [Source:ZFIN;Acc:ZDB-GENE-020905-2])

HSP 1 Score: 50.8322 bits (120), Expect = 2.932e-6
Identity = 31/113 (27.43%), Postives = 51/113 (45.13%), Query Frame = 1
Query:  514 QQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMN 852
            Q +    G    I++ +  +   +F L GH   I    FH  YP +L S S D TIR+WN  +   VC+     GH   ++      +   ++S  +D T+++W +   R  N
Sbjct:   63 QPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWIL-SASDDQTIRIWNWQSRTCVCVL---TGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKN 171          
BLAST of EED-1 vs. Ensembl Zebrafish
Match: pafah1b1a (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1a [Source:NCBI gene;Acc:394246])

HSP 1 Score: 49.6766 bits (117), Expect = 5.571e-6
Identity = 25/80 (31.25%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  586 FNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIW 825
            + L GH   +  +IFHP++  ++ S S+D TI++W+             +GH   +     D  G+ L SC  D TIK+W
Sbjct:  102 YALSGHRSPVTRVIFHPVF-SVIVSASEDATIKVWDHETGDFERTL---KGHTDSVQDISFDHTGKLLASCSADMTIKLW 177          
BLAST of EED-1 vs. Ensembl Xenopus
Match: eed (embryonic ectoderm development [Source:NCBI gene;Acc:550079])

HSP 1 Score: 300.056 bits (767), Expect = 6.801e-97
Identity = 155/395 (39.24%), Postives = 219/395 (55.44%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC    P   I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+  +I +S +Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +        +V  +IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    +       IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   79 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYEC---HPQGEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSLRMKTAIRESYEYNPNKTNRPFVSQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKASESNV--TILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTYPKCASAIRQTSFSRDSSILVAVCDDATIWRWDR 436          
BLAST of EED-1 vs. Ensembl Xenopus
Match: eed (embryonic ectoderm development [Source:NCBI gene;Acc:550079])

HSP 1 Score: 295.049 bits (754), Expect = 6.233e-95
Identity = 155/395 (39.24%), Postives = 218/395 (55.19%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC    P   I+ L +Y D+D  E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+  +I +S +Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +        +V  +IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    +       IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   87 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYEC---HPQGEIRLLQSYVDAD--ENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSLRMKTAIRESYEYNPNKTNRPFVSQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKASESNV--TILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTYPKCASAIRQTSFSRDSSILVAVCDDATIWRWDR 442          
BLAST of EED-1 vs. Ensembl Xenopus
Match: eed (embryonic ectoderm development [Source:NCBI gene;Acc:550079])

HSP 1 Score: 295.049 bits (754), Expect = 7.345e-95
Identity = 155/395 (39.24%), Postives = 218/395 (55.19%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC    P   I+ L +Y D+D  E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+  +I +S +Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +        +V  +IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    +       IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   86 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYEC---HPQGEIRLLQSYVDAD--ENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSLRMKTAIRESYEYNPNKTNRPFVSQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKASESNV--TILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTYPKCASAIRQTSFSRDSSILVAVCDDATIWRWDR 441          
BLAST of EED-1 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:Xenbase;Acc:XB-GENE-490993])

HSP 1 Score: 53.9138 bits (128), Expect = 4.190e-7
Identity = 33/136 (24.26%), Postives = 67/136 (49.26%), Query Frame = 1
Query:  511 GQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLH----HENEMVFD 906
             ++++    + G +R+     + ++  L GH  ++  + FHP Y D + S S D  I+LW+V      C+F   +GH   +        G++L S   DH++K+W L   ++M  +++ +  ++    H NE + +
Sbjct:   74 AEELIVAGSQSGSLRVWDLEAAKILRTLMGHKANVCSLDFHP-YGDFVASGSLDTNIKLWDVRRKG--CVFR-YKGHTQAVRCLRFSPDGKWLASASDDHSVKLWDLTAGKMMAELSEHKGPVNIIEFHPNEYLLN 205          
BLAST of EED-1 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:Xenbase;Acc:XB-GENE-490993])

HSP 1 Score: 53.9138 bits (128), Expect = 4.398e-7
Identity = 33/135 (24.44%), Postives = 66/135 (48.89%), Query Frame = 1
Query:  511 GQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLH----HENEMVF 903
             ++++    + G +R+     + ++  L GH  ++  + FHP Y D + S S D  I+LW+V      C+F   +GH   +        G++L S   DH++K+W L   ++M  +++ +  ++    H NE + 
Sbjct:   74 AEELIVAGSQSGSLRVWDLEAAKILRTLMGHKANVCSLDFHP-YGDFVASGSLDTNIKLWDVRRKG--CVFR-YKGHTQAVRCLRFSPDGKWLASASDDHSVKLWDLTAGKMMAELSEHKGPVNIIEFHPNEYLL 204          
BLAST of EED-1 vs. Ensembl Mouse
Match: Eed (embryonic ectoderm development [Source:MGI Symbol;Acc:MGI:95286])

HSP 1 Score: 302.753 bits (774), Expect = 5.044e-98
Identity = 158/400 (39.50%), Postives = 221/400 (55.25%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPS-----ILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+MN+I +S  Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KPS     IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    + +     IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   82 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDI-------DKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDR 439          
BLAST of EED-1 vs. Ensembl Mouse
Match: Eed (embryonic ectoderm development [Source:MGI Symbol;Acc:MGI:95286])

HSP 1 Score: 302.753 bits (774), Expect = 5.044e-98
Identity = 158/400 (39.50%), Postives = 221/400 (55.25%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPS-----ILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+MN+I +S  Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KPS     IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    + +     IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   82 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDI-------DKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDR 439          
BLAST of EED-1 vs. Ensembl Mouse
Match: Eed (embryonic ectoderm development [Source:MGI Symbol;Acc:MGI:95286])

HSP 1 Score: 302.368 bits (773), Expect = 3.505e-97
Identity = 158/400 (39.50%), Postives = 221/400 (55.25%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPS-----ILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+MN+I +S  Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KPS     IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    + +     IRQT F+ D+ IL+  CD   I R+DR
Sbjct:  141 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDI-------DKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDR 498          
BLAST of EED-1 vs. Ensembl Mouse
Match: Eed (embryonic ectoderm development [Source:MGI Symbol;Acc:MGI:95286])

HSP 1 Score: 172.555 bits (436), Expect = 1.174e-50
Identity = 84/208 (40.38%), Postives = 117/208 (56.25%), Query Frame = 1
Query:  226 ESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLM 849
            E HN  +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+M
Sbjct:   39 EDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYEC---HSQGEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMM 220          
BLAST of EED-1 vs. Ensembl Mouse
Match: Eed (embryonic ectoderm development [Source:MGI Symbol;Acc:MGI:95286])

HSP 1 Score: 102.064 bits (253), Expect = 1.429e-25
Identity = 45/101 (44.55%), Postives = 65/101 (64.36%), Query Frame = 1
Query:  787 LLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLN---SSLLPTFKIGQ 1080
            ++SCGMDH++K+W+++  R+MN+I +S  Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +      + P   IGQ
Sbjct:    2 IMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPNACIGQ 102          
BLAST of EED-1 vs. UniProt/SwissProt
Match: sp|Q921E6|EED_MOUSE (Polycomb protein EED OS=Mus musculus OX=10090 GN=Eed PE=1 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 3.528e-97
Identity = 158/400 (39.50%), Postives = 221/400 (55.25%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPS-----ILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+MN+I +S  Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KPS     IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    + +     IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   82 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDI-------DKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDR 439          
BLAST of EED-1 vs. UniProt/SwissProt
Match: sp|O75530|EED_HUMAN (Polycomb protein EED OS=Homo sapiens OX=9606 GN=EED PE=1 SV=2)

HSP 1 Score: 302.753 bits (774), Expect = 3.528e-97
Identity = 158/400 (39.50%), Postives = 221/400 (55.25%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPS-----ILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+MN+I +S  Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KPS     IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    + +     IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   82 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDI-------DKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDR 439          
BLAST of EED-1 vs. UniProt/SwissProt
Match: sp|Q3SZ25|EED_BOVIN (Polycomb protein EED OS=Bos taurus OX=9913 GN=EED PE=2 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 3.684e-97
Identity = 158/400 (39.50%), Postives = 221/400 (55.25%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPS-----ILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+MN+I +S  Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KPS     IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    + +     IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   82 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDI-------DKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDR 439          
BLAST of EED-1 vs. UniProt/SwissProt
Match: sp|Q6AZS2|EEDB_XENLA (Polycomb protein eed-B OS=Xenopus laevis OX=8355 GN=eed-b PE=1 SV=2)

HSP 1 Score: 300.056 bits (767), Expect = 3.200e-96
Identity = 154/395 (38.99%), Postives = 219/395 (55.44%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC    P  +I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+  +I +S  Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +        +V  +IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    +       IRQT F+ D+ +L+  CD   I R+DR
Sbjct:   79 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYEC---HPQGDIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSLRMKTAIKESYDYNPNKTNRPFVSQKVHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIEKIKASESNV--TILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTYPKCASAIRQTSFSRDSSVLIAVCDDSTIWRWDR 436          
BLAST of EED-1 vs. UniProt/SwissProt
Match: sp|Q28DT7|EED_XENTR (Polycomb protein eed OS=Xenopus tropicalis OX=8364 GN=eed PE=2 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 3.603e-96
Identity = 155/395 (39.24%), Postives = 219/395 (55.44%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE HN  +FG+  N      + DP++F +VG   VT YEC    P   I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIRII+P     I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+  +I +S +Y  ++    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +        +V  +IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    +       IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   79 FKCVNSLKEDHNQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYEC---HPQGEIRLLQSYVDADADENFYTCAWTY---------------------DSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSLRMKTAIRESYEYNPNKTNRPFVSQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKASESNV--TILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTYPKCASAIRQTSFSRDSSILVAVCDDATIWRWDR 436          
BLAST of EED-1 vs. TrEMBL
Match: H9CXT3 (EED-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 875.159 bits (2260), Expect = 0.000e+0
Identity = 446/446 (100.00%), Postives = 446/446 (100.00%), Query Frame = 1
Query:   52 MFKEETKLDAKRKLIKAKRKGPLHLEIDKEXXXXXXXXXXXXXXXXXXXXFKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDRT 1389
            MFKEETKLDAKRKLIKAKRKGPLHLEIDKESVSNSSKSLSDSILNSSQLNFKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDRT
Sbjct:    1 MFKEETKLDAKRKLIKAKRKGPLHLEIDKESVSNSSKSLSDSILNSSQLNFKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDRT 446          
BLAST of EED-1 vs. TrEMBL
Match: A0A5B9BXU8 (Embryonic ectoderm development-like protein OS=Dugesia japonica OX=6161 GN=eed PE=2 SV=1)

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 387/445 (86.97%), Postives = 414/445 (93.03%), Query Frame = 1
Query:   52 MFKEETKLDAKRKLIKAKRKGPLHLEIDKEXXXXXXXXXXXXXXXXXXXXFKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            M KEE K D KRKLIK KRK   + E+DKES SNSSKS+SD+  N + LNFKQTALIKESHNNSIFGISVN+ IRKNKSDPILFVSVGGQNVTFYECLLDT +NNIKFLHAYKDSDPNEEFYCC WSYYVP+QNR+ +Y D M ESYLE+C  GQQIVACAGKKGIIRIISPNM GVI NL GHGQSINE+IFHPLYPDLLFSFSKDYT+RLWNVWNSVLVCIFGGSEGHRSEILHGDVDM G+FLLSCGMDHTIKIWKLDD+RL N+IAKSRKYLHHENE VFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNS+L PTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLG IY+WNLRD++ITEGNSIFDLKPQ+F++N+KNGLPVTIRQTRFT++AKILLCACDGG+IARFDR
Sbjct:    1 MTKEELKNDTKRKLIKPKRKIISNNELDKESGSNSSKSVSDNNKNLNNLNFKQTALIKESHNNSIFGISVNEHIRKNKSDPILFVSVGGQNVTFYECLLDTTVNNIKFLHAYKDSDPNEEFYCCTWSYYVPYQNRSSSYADSMIESYLENCVAGQQIVACAGKKGIIRIISPNMGGVILNLAGHGQSINEVIFHPLYPDLLFSFSKDYTVRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMTGQFLLSCGMDHTIKIWKLDDTRLTNAIAKSRKYLHHENEFVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSNLTPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGRIYIWNLRDKRITEGNSIFDLKPQEFVVNNKNGLPVTIRQTRFTNEAKILLCACDGGVIARFDR 445          
BLAST of EED-1 vs. TrEMBL
Match: G4VT41 (Putative embryonic ectoderm development protein OS=Schistosoma mansoni OX=6183 GN=Smp_165220 PE=4 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 5.763e-117
Identity = 189/434 (43.55%), Postives = 260/434 (59.91%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLL----------DTPINNIKFLHAYKD-SDPNEEFYCCAWSYYVPFQNRNENYRD---------------GMFESYLES-CTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLN--SSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLG--HIYVWNLRDRKITEGNSIFDLKPQKFMINS-----KNGLPVT---IRQTRFTDDAKILLCACDGGLIARFDR 1386
            +K T +I+E+H+ S+FG++ N   R   +DP+LF +V    VT Y+C L           + ++++  L ++ D +   EEFYCCAWS        +  + D               G   S   S     QQ+VA AGK+G+IRI+ P+M+    +L GHG SINE+ FHP  P LLFSFSKDYTIRLWN+ + VLVCIFGG+EGHR+E+LHGD+ + G  LLS GMDH +KIW+L+   L N++  S  Y    N   F   +QHFP+FSS  +HGNY+DC RWFG LV SKSCE  + LWKPG L+  S+ +PT  +  + K SI+HQ +  DC++WY+RFDID+K  +LALG   G   +Y+W+L+  +     +  +L  Q     +       G+P++   IRQTRF DD  ILLC  D GLI RFD+
Sbjct:   78 YKPTCIIRETHSQSVFGVAFNSVNRSQPTDPLLFATVASHYVTVYQCSLKNDLEDKSTQSSDMSSVCLLQSFADPAGDKEEFYCCAWSRDTSGNVASSWWTDCCESRRPRPTLHPHQGPISSSSGSLLPAHQQVVAAAGKRGVIRILCPSMASCPASLVGHGSSINELRFHPRDPALLFSFSKDYTIRLWNIASHVLVCIFGGAEGHRAEVLHGDLSLTGDLLLSAGMDHCVKIWRLNTPELANAVIDSFNYRSRSNPKPFPVLVQHFPEFSSRDVHGNYVDCARWFGSLVISKSCENSVTLWKPGGLDDSSANIPTPGVPTEHKTSIIHQLKATDCNLWYIRFDIDLKNHVLALGTGTGPSRVYLWDLKYPE-----NALNLPAQVLHFPTVSGVGPGGMPLSHSAIRQTRFADDGDILLCVGDNGLIVRFDK 506          
BLAST of EED-1 vs. TrEMBL
Match: W6UDL5 (Polycomb protein EED OS=Echinococcus granulosus OX=6210 GN=EGR_06227 PE=4 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 8.031e-117
Identity = 190/440 (43.18%), Postives = 257/440 (58.41%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINN---------IKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKP------------------------------SILHQFELDDCDIWYVRFDIDVKRGLLALGNRLG--HIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPV----TIRQTRFTDDAKILLCACDGGLIARFDR 1386
            F QTA I+ESH   IFG++ N   R + SDP+LF +VG  +VT Y+C    P            I  L ++ D+  +EEFYCCAWS        N + R G+ ++     +  QQI+A AGK+G+IRI+ P++S  + +L GHGQ++NE+ FHP +P LLFSFSKD+T+RLWN+   V+VCIFGG EGHR+E+LHGD+ + G FLL+  MDHTIKIW+LD   + N++  S +Y   +    F T LQHFPDFS+   HGNY+DC RWFG LV SKSCE  +V+W PG + S+  P      D+ P                              S+LHQ  L DCD+WYVRFD+ +++ LLALG  +G   I++W+L D       S   L P+   I +     +     IRQTRFT D +IL+   D GL+ RFDR
Sbjct:   51 FAQTAFIRESHGRPIFGVAFNCDNRSSSSDPLLFATVGANHVTIYQCRELPPPPEGQDATSNPPIHLLQSFSDASSDEEFYCCAWSC-------NLDARRGVAKA-----SSRQQILAVAGKRGVIRILCPSLSKCLDSLIGHGQAVNELKFHPNHPSLLFSFSKDFTVRLWNIATHVMVCIFGGVEGHRAEVLHGDISLTGDFLLTASMDHTIKIWRLDIPEMRNAVRASFEYT--DKRKPFHTLLQHFPDFSTRDAHGNYVDCARWFGSLVISKSCENAVVVWMPGDIESATSPASLDLHDLLPPRLVAIDNSSGRGSGARARQMTGVPLETHCSLLHQLRLPDCDLWYVRFDLHLQQRLLALGTGVGLPRIFLWDLSDL-----GSTLSLVPKVLHITATGAGNLNNFGAIRQTRFTGDGRILVAVGDNGLVVRFDR 471          
BLAST of EED-1 vs. TrEMBL
Match: A0A068Y217 (Polycomb protein EED OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 8.912e-117
Identity = 190/440 (43.18%), Postives = 258/440 (58.64%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINN---------IKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKP------------------------------SILHQFELDDCDIWYVRFDIDVKRGLLALGNRLG--HIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPV----TIRQTRFTDDAKILLCACDGGLIARFDR 1386
            F QTA I+ESH   IFG++ N   R + SDP+LF +VG  +VT Y+C    P +          I  L ++ D+  +EEFYCCAWS        N + R G+ ++     +  QQI+A AGK+G+IRI+ P++S  + +L GHGQ++NE+ FHP +P LLFSFSKD+T+RLWN+   V+VCIFGG EGHR+E+LHGD+ + G FLL+  MDHTIKIW+LD   + N++  S +Y   +    F T LQHFPDFS+   HGNY+DC RWFG LV SKSCE  +V+W PG + S+  P      D+ P                              S+LHQ  L DCD+WYVRFD+ +++ LLALG  +G   I++W+L D       S   L P+   I +     +     IRQTRFT D +IL+   D GL+ RFDR
Sbjct:   45 FTQTAFIRESHGRPIFGVAFNCDNRSSSSDPLLFATVGANHVTIYQCRELPPPSEGQDATSNPPIHLLQSFSDAASDEEFYCCAWSC-------NLDARRGVAKA-----SSRQQILAVAGKRGVIRILCPSLSKCLDSLIGHGQAVNELKFHPNHPSLLFSFSKDFTVRLWNIATHVMVCIFGGVEGHRAEVLHGDISLTGDFLLTASMDHTIKIWRLDIPEMRNAVRASFEYT--DKRKPFHTLLQHFPDFSTRDAHGNYVDCARWFGSLVISKSCENAVVVWMPGDIESATSPASLDLHDLLPPRLVAIDNSSGRGSGARTRQMTGVPLETHCSLLHQLRLPDCDLWYVRFDLHLQQRLLALGTGVGLPRIFLWDLSDL-----GSTLSLVPKVLHITATGAGNLNNFGAIRQTRFTGDGRILVAVGDNGLVVRFDR 465          
BLAST of EED-1 vs. Ensembl Cavefish
Match: eed (embryonic ectoderm development [Source:NCBI gene;Acc:103041188])

HSP 1 Score: 286.96 bits (733), Expect = 4.432e-92
Identity = 152/400 (38.00%), Postives = 216/400 (54.00%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKP-----SILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE H   +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                       +    ++A AG +GIIRII+      + +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+  +I  S +Y   +    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KP     +IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    +       IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   82 FKCVNSLKEDHGQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYEC---HSHGEIRLLQSYVDADADENFYTCAWTY---------------------DTSTSHPLLAVAGSRGIIRIINHITMQCVKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADFDLLGEKIMSCGMDHSLKLWRINSERMQKAIRCSYEYNPSKTNRPFVSQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDI-------DHIKPNESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTLPKCTSAIRQTSFSRDSSILIAVCDDASIWRWDR 439          
BLAST of EED-1 vs. Ensembl Cavefish
Match: eed (embryonic ectoderm development [Source:NCBI gene;Acc:103041188])

HSP 1 Score: 269.24 bits (687), Expect = 1.156e-85
Identity = 136/344 (39.53%), Postives = 194/344 (56.40%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKP-----SILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLR 1218
            FK    +KE H   +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                       +    ++A AG +GIIRII+      + +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  R+  +I  S +Y   +    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KP     +IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L 
Sbjct:   82 FKCVNSLKEDHGQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYEC---HSHGEIRLLQSYVDADADENFYTCAWTY---------------------DTSTSHPLLAVAGSRGIIRIINHITMQCVKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADFDLLGEKIMSCGMDHSLKLWRINSERMQKAIRCSYEYNPSKTNRPFVSQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDI-------DHIKPNESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE 392          
BLAST of EED-1 vs. Ensembl Cavefish
Match: pafah1b1a (lissencephaly-1 homolog A-like [Source:NCBI gene;Acc:103030333])

HSP 1 Score: 51.9878 bits (123), Expect = 6.883e-7
Identity = 25/80 (31.25%), Postives = 42/80 (52.50%), Query Frame = 1
Query:  586 FNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIW 825
            ++L GH   + ++IFHP++  ++ S S+D TI++W+             +GH   +     D  G+ L SC  D TIK+W
Sbjct:  102 YSLSGHRSPVTKVIFHPVF-SVMVSASEDATIKVWDYETGDFERTL---KGHTDSVQDISFDQTGKLLASCSADMTIKLW 177          
BLAST of EED-1 vs. Ensembl Cavefish
Match: pafah1b1a (lissencephaly-1 homolog A-like [Source:NCBI gene;Acc:103030333])

HSP 1 Score: 51.9878 bits (123), Expect = 8.409e-7
Identity = 25/80 (31.25%), Postives = 42/80 (52.50%), Query Frame = 1
Query:  586 FNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIW 825
            ++L GH   + ++IFHP++  ++ S S+D TI++W+             +GH   +     D  G+ L SC  D TIK+W
Sbjct:  106 YSLSGHRSPVTKVIFHPVF-SVMVSASEDATIKVWDYETGDFERTL---KGHTDSVQDISFDQTGKLLASCSADMTIKLW 181          
BLAST of EED-1 vs. Ensembl Cavefish
Match: pafah1b1b (lissencephaly-1 homolog B [Source:NCBI gene;Acc:103047044])

HSP 1 Score: 50.8322 bits (120), Expect = 2.085e-6
Identity = 25/80 (31.25%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  586 FNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIW 825
            + L GH   +  +IFHP++  ++ S S+D TI++W+             +GH   +     D  G+ L SC  D TIK+W
Sbjct:  102 YALSGHRSPVTRVIFHPVF-SVMVSASEDATIKVWDYEAGDFERTL---KGHTDSVQDISFDQTGKLLASCSADMTIKLW 177          
BLAST of EED-1 vs. Ensembl Sea Lamprey
Match: eed (embryonic ectoderm development [Source:NCBI gene;Acc:550463])

HSP 1 Score: 209.149 bits (531), Expect = 3.554e-64
Identity = 103/267 (38.58%), Postives = 152/267 (56.93%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSK 1002
            FK    +KE H   +FG+  N      + DP++F +VG   VT YEC        ++ + +Y D + +E FY CAW+Y     +RN ++                 ++  AG +GIIRII+P     + +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    +V +FGG EGHR E+L  D D+ G  ++SCGMDH++K+W+LD  R+  +I  S +Y  ++    F +   H+PDFS+  IH NY+DC RW G L+ SK
Sbjct:   79 FKCVNSLKEDHGQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEVRLMQSYVDVEADENFYTCAWTY-----DRNTSH----------------PLLGIAGSRGIIRIINPITMQCVKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTMVAVFGGVEGHRDEVLSADFDLYGDKIMSCGMDHSLKLWRLDSERMQRAIRGSYEYNPNKTNRPFPSQKVHYPDFSTRDIHRNYVDCVRWLGDLILSK 319          
BLAST of EED-1 vs. Ensembl Sea Lamprey
Match: ciao1 (cytosolic iron-sulfur assembly component 1 [Source:NCBI gene;Acc:795104])

HSP 1 Score: 53.9138 bits (128), Expect = 3.013e-8
Identity = 32/83 (38.55%), Postives = 46/83 (55.42%), Query Frame = 1
Query:  592 LGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLW----NVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWK 828
            L  H Q +  +++HP   ++L S S D +IRL+    + W+S     F   EGH S +   D D  GR L+SCG D TI+IW+
Sbjct:  145 LNSHTQDVKHVVWHP-NSEVLASASYDNSIRLYREDGDDWSS-----FATLEGHESTVWSIDFDATGRRLVSCGDDKTIRIWQ 221          
BLAST of EED-1 vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 50.8322 bits (120), Expect = 2.804e-7
Identity = 24/80 (30.00%), Postives = 42/80 (52.50%), Query Frame = 1
Query:  586 FNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIW 825
            + L GH   +  +IFHP++  ++ S S+D TI++W+             +GH   +     D++G+ L SC  D T+K+W
Sbjct:   41 YALSGHRSPVTRVIFHPVF-SVIVSASEDATIKVWDYETGDFERTL---KGHTDSVQDISFDLSGKMLASCSADMTVKLW 116          
BLAST of EED-1 vs. Ensembl Yeast
Match: CRN1 (Coronin; cortical actin cytoskeletal component that associates with the Arp2p/Arp3p complex to regulate its activity; plays a role in regulation of actin patch assembly [Source:SGD;Acc:S000004421])

HSP 1 Score: 49.2914 bits (116), Expect = 9.044e-7
Identity = 20/87 (22.99%), Postives = 43/87 (49.43%), Query Frame = 1
Query:  592 LGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMN 852
            L GH + +  +++HP+  ++L S S DYT++LWNV     +        H   +        G +L +   D  +++W + + ++++
Sbjct:  136 LTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITL----KHPDMVTSMSFSYDGNYLATVARDKKLRVWNIREEKIVS 218          
BLAST of EED-1 vs. Ensembl Yeast
Match: COP1 (Alpha subunit of COPI vesicle coatomer complex; complex surrounds transport vesicles in the early secretory pathway [Source:SGD;Acc:S000002304])

HSP 1 Score: 48.521 bits (114), Expect = 1.810e-6
Identity = 32/115 (27.83%), Postives = 52/115 (45.22%), Query Frame = 1
Query:  514 QQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWN-SVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNS 855
            Q I   AG    I++ S + +  ++ L GH   +  + FH   P  + S S D TIR+WN  N   + C+     GH   ++          ++S  +D TI+IW +   R  +S
Sbjct:   65 QPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELP-WIISASDDQTIRIWNWQNRKEIACL----TGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHS 174          
BLAST of EED-1 vs. Ensembl Nematostella
Match: EDO42020 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2L1])

HSP 1 Score: 237.654 bits (605), Expect = 3.120e-75
Identity = 123/328 (37.50%), Postives = 183/328 (55.79%), Query Frame = 1
Query:  403 NEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
             E FYCCAW+                      S T G+ ++A AG++ +IR ISP     I +  GHG +IN++ FHPL    L S S+D+++RLWNV    L+ IF G EGHR E+L+ D D+ G  ++SCGMDH++KIW L+  ++  +  +S  Y   +++ VF T   H+PDF++  IH NY+DC RW G LV SKSCE  +V WKP      +     I + +   +   F+   C+IWY+RF +D ++ L+A GN+ G ++VW++          + D    + +    N     +RQT F+ D KIL+C CDGG + R+DR
Sbjct:    1 EESFYCCAWTC---------------------SPTTGELMLAVAGQRAVIRFISPITMSCIKHYIGHGGAINDLKFHPLDQCFLLSGSRDHSLRLWNVKTDALIAIFAGVEGHRDEVLNLDFDILGTRIISCGMDHSLKIWSLETEQIQKACDESYLYDASKSKRVFPTANVHYPDFTTRDIHRNYVDCVRWLGDLVLSKSCENCIVCWKPQDPLDEIFQKVHIDK-IFLVLCILFDFSQCEIWYMRFSLDFEQRLVAAGNQQGKVFVWDI---------GVEDPSKARCITLVHNKCVSAVRQTAFSRDGKILVCVCDGGTVWRWDR 297          
BLAST of EED-1 vs. Ensembl Nematostella
Match: KATNB1 (Katanin p80 WD40 repeat-containing subunit B1 [Source:UniProtKB/TrEMBL;Acc:A7SV12])

HSP 1 Score: 55.0694 bits (131), Expect = 4.259e-8
Identity = 33/114 (28.95%), Postives = 57/114 (50.00%), Query Frame = 1
Query:  511 GQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMN 852
            G+ +V    + G ++I     + ++  L GH  SI  + FHP + D + S S D  ++LW++      CIF   +GH   + H      GR+++S G D   K+W L   +++N
Sbjct:   72 GEDLVVAGSQSGTLKIWDLEAAKILRTLTGHKSSIRSLDFHP-FGDFVASGSLDTNLKLWDIRRK--GCIF-TYKGHTDCVNHLRFSPDGRWIISGGEDGAAKLWDLTAGKIIN 181          
BLAST of EED-1 vs. Ensembl Nematostella
Match: EDO42019 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2L0])

HSP 1 Score: 51.6026 bits (122), Expect = 6.969e-8
Identity = 26/66 (39.39%), Postives = 34/66 (51.52%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSD 399
            FK T  +KE H   +F +  N  I+  +SDP  F +VG   VT Y+C        IK L AY+D D
Sbjct:   95 FKCTNFLKEDHKQPLFAVQFNPFIKDEESDPYFFATVGSNRVTIYQC---EEKGVIKLLQAYEDPD 157          
BLAST of EED-1 vs. Ensembl Nematostella
Match: EDO33837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR29])

HSP 1 Score: 50.447 bits (119), Expect = 1.114e-6
Identity = 31/107 (28.97%), Postives = 50/107 (46.73%), Query Frame = 1
Query:  586 FNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFD 906
            + L GH  S+N I+F P Y + L + S D T+ LW+    +    F    GH +   H   ++ G  + SC     +K+W   D R ++ +A +    H  N + FD
Sbjct:  433 YTLRGHADSVNSIVFLP-YSNTLLTSSADKTLSLWDARTGLCAQTF---YGHMNSCNHCTFNLKGDTVASCDAYGVVKLW---DVRTVSCMATADLGPHPANRVAFD 532          
BLAST of EED-1 vs. Ensembl Nematostella
Match: EDO34676 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNL4])

HSP 1 Score: 49.2914 bits (116), Expect = 2.102e-6
Identity = 59/220 (26.82%), Postives = 87/220 (39.55%), Query Frame = 1
Query:  505 TVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLV-CIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWK-LDDSRLM-NSIAKSRKYLHHENEMVFDTFLQHFPDFS--------------SNKIHGNYIDCG----RWFGGLVFSK---------SCEGYLVLWKPGSLNSSLLPTFKI 1074
            T   + +A  GK  +IRI  P+ S  I    GH   I+ + F       LFS S D T+++WN+     V  +F    GH+  +   D     R   + G D T++IWK +++S+L+ N    S   +   NE   D FL    D S               +  HG   D       W   L   K         SC+  + LW+ G    S+ P F +
Sbjct:  202 TTDGKYLASGGKDKLIRIWDPDTSKHIHTFKGHRDVISGLAFR-RGSHQLFSASHDKTVKIWNLDEMAYVETLF----GHQDAVTGIDSLSRDRAATAGGRDRTLRIWKVVEESQLVFNGAGGSIDCIELINE---DHFLSGSDDGSLTMWNTAKKKPLCTVDNAHGKPSDSTTPDESWITALAAVKSTDLVASAGSCDSCVRLWQCGPGYRSIKPLFSV 413          
BLAST of EED-1 vs. Ensembl Medaka
Match: eed (embryonic ectoderm development [Source:NCBI gene;Acc:100049503])

HSP 1 Score: 288.886 bits (738), Expect = 8.247e-93
Identity = 153/400 (38.25%), Postives = 215/400 (53.75%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKP-----SILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FK    +KE H   +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIR+I+      I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L  D D+ G  ++SCGMDH++K+W+++  RL  +I  S +Y   +    F +   HFPDFS+  IH NY+DC RW G L+ SKSCE  +V WKPG +   +         +KP     +IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    +       IRQT F+ D+ IL+  CD   I R+DR
Sbjct:   85 FKCVNSLKEDHGQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEIRLLQSYVDADADENFYTCAWTY---------------------DTNTSHPLLAVAGSRGIIRVINHITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADFDLLGEKIMSCGMDHSLKLWRINSERLQKAIRGSYEYNPSKTNRPFVSQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDI-------DHIKPNESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTLPKCTSAIRQTSFSRDSSILIAVCDDASIWRWDR 442          
BLAST of EED-1 vs. Ensembl Medaka
Match: eed (embryonic ectoderm development [Source:NCBI gene;Acc:100049503])

HSP 1 Score: 133.65 bits (335), Expect = 9.840e-35
Identity = 72/192 (37.50%), Postives = 98/192 (51.04%), Query Frame = 1
Query:  202 FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMA 777
            FK    +KE H   +FG+  N      + DP++F +VG   VT YEC        I+ L +Y D+D +E FY CAW+Y                            ++A AG +GIIR+I+      I +  GHG +INE+ FHP  P+LL S SKD+ +RLWN+    LV IFGG EGHR E+L    + A
Sbjct:   79 FKCVNSLKEDHGQPLFGVQFN--WHSKEGDPLVFATVGSNRVTLYECHSQ---GEIRLLQSYVDADADENFYTCAWTY---------------------DTNTSHPLLAVAGSRGIIRVINHITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSASCENA 244          

HSP 2 Score: 88.5817 bits (218), Expect = 6.426e-19
Identity = 52/147 (35.37%), Postives = 74/147 (50.34%), Query Frame = 1
Query:  979 FGGL------VFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKP-----SILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDR 1386
            FGG+      V S SCE  +V WKPG +   +         +KP     +IL +F+   CDIWY+RF +D  + +LALGN++G +YVW+L          + D    K    +       IRQT F+ D+ IL+  CD   I R+DR
Sbjct:  226 FGGVEGHRDEVLSASCENAIVCWKPGKMEDDI-------DHIKPNESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLE---------VEDPHKAKCTTLTLPKCTSAIRQTSFSRDSSILIAVCDDASIWRWDR 356          
BLAST of EED-1 vs. Ensembl Medaka
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:101167102])

HSP 1 Score: 54.299 bits (129), Expect = 1.937e-7
Identity = 36/117 (30.77%), Postives = 57/117 (48.72%), Query Frame = 1
Query:  505 TVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGG-SEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMN 852
            ++ ++ VA   + G IR+     + ++  L GH  SI  + FHP Y   L S S D  I+LW+V     V  F G ++  RS     D    G++L S   D T+K+W L   +++ 
Sbjct:   72 SLSEEQVAAGSQSGSIRVWDLEAAKILQTLMGHKASITSLGFHP-YGQFLASSSMDTNIKLWDVRRKGYVFRFKGHTDAVRSLAFSPD----GKWLASASDDCTVKLWDLSQGKIIT 183          
BLAST of EED-1 vs. Ensembl Medaka
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:101167102])

HSP 1 Score: 54.299 bits (129), Expect = 1.937e-7
Identity = 36/117 (30.77%), Postives = 57/117 (48.72%), Query Frame = 1
Query:  505 TVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGG-SEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMN 852
            ++ ++ VA   + G IR+     + ++  L GH  SI  + FHP Y   L S S D  I+LW+V     V  F G ++  RS     D    G++L S   D T+K+W L   +++ 
Sbjct:   72 SLSEEQVAAGSQSGSIRVWDLEAAKILQTLMGHKASITSLGFHP-YGQFLASSSMDTNIKLWDVRRKGYVFRFKGHTDAVRSLAFSPD----GKWLASASDDCTVKLWDLSQGKIIT 183          
BLAST of EED-1 vs. Ensembl Medaka
Match: PAFAH1B1 (platelet activating factor acetylhydrolase 1b regulatory subunit 1 [Source:NCBI gene;Acc:101169717])

HSP 1 Score: 51.2174 bits (121), Expect = 1.371e-6
Identity = 25/80 (31.25%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  586 FNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIW 825
            + L GH   +  +IFHP++  ++ S S+D TI++W+             +GH   +     D  G+ L SC  D TIK+W
Sbjct:  102 YALSGHRSPVTRVIFHPVF-SVMVSASEDATIKVWDYETGDFERTL---KGHTDSVQDISFDQTGKLLASCSADMTIKLW 177          
BLAST of EED-1 vs. Planmine SMEST
Match: SMESG000045902.1 (SMESG000045902.1)

HSP 1 Score: 875.159 bits (2260), Expect = 0.000e+0
Identity = 446/446 (100.00%), Postives = 446/446 (100.00%), Query Frame = 1
Query:   52 MFKEETKLDAKRKLIKAKRKGPLHLEIDKEXXXXXXXXXXXXXXXXXXXXFKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDRT 1389
            MFKEETKLDAKRKLIKAKRKGPLHLEIDKESVSNSSKSLSDSILNSSQLNFKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDRT
Sbjct:    1 MFKEETKLDAKRKLIKAKRKGPLHLEIDKESVSNSSKSLSDSILNSSQLNFKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLDTPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLESCTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIHGNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSILHQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIFDLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDRT 446          
BLAST of EED-1 vs. Planmine SMEST
Match: SMESG000034899.1 (SMESG000034899.1)

HSP 1 Score: 49.2914 bits (116), Expect = 3.870e-6
Identity = 29/89 (32.58%), Postives = 49/89 (55.06%), Query Frame = 1
Query:  592 LGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSI 858
            L GH + I ++ ++    DLLF+ +K+   +  NVW +V     G  +GH+  +   DVD   RFL++   D ++ IW ++   L+NSI
Sbjct:   23 LQGHERPITQVKYN-REGDLLFTIAKE---KEPNVWYTVNGERLGTYDGHKGAVWCLDVDWETRFLITGAADDSLNIWDIETGTLLNSI 107          
BLAST of EED-1 vs. Planmine SMEST
Match: SMESG000034899.1 (SMESG000034899.1)

HSP 1 Score: 48.9062 bits (115), Expect = 4.177e-6
Identity = 29/89 (32.58%), Postives = 49/89 (55.06%), Query Frame = 1
Query:  592 LGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSI 858
            L GH + I ++ ++    DLLF+ +K+   +  NVW +V     G  +GH+  +   DVD   RFL++   D ++ IW ++   L+NSI
Sbjct:    6 LQGHERPITQVKYN-REGDLLFTIAKE---KEPNVWYTVNGERLGTYDGHKGAVWCLDVDWETRFLITGAADDSLNIWDIETGTLLNSI 90          
BLAST of EED-1 vs. Planmine SMEST
Match: SMESG000034899.1 (SMESG000034899.1)

HSP 1 Score: 48.9062 bits (115), Expect = 4.299e-6
Identity = 29/89 (32.58%), Postives = 49/89 (55.06%), Query Frame = 1
Query:  592 LGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSRLMNSI 858
            L GH + I ++ ++    DLLF+ +K+   +  NVW +V     G  +GH+  +   DVD   RFL++   D ++ IW ++   L+NSI
Sbjct:   17 LQGHERPITQVKYN-REGDLLFTIAKE---KEPNVWYTVNGERLGTYDGHKGAVWCLDVDWETRFLITGAADDSLNIWDIETGTLLNSI 101          
BLAST of EED-1 vs. Planmine SMEST
Match: SMESG000077177.1 (SMESG000077177.1)

HSP 1 Score: 49.2914 bits (116), Expect = 5.853e-6
Identity = 29/110 (26.36%), Postives = 47/110 (42.73%), Query Frame = 1
Query:  514 QQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDLLFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCGMDHTIKIWKLDDSR 843
            Q I    G    I++ +      +F L GH   I    FH  YP  + S S D TIR+WN  +   +C+     GH   ++          ++S  +D T+++W +   R
Sbjct:   65 QPIFVSGGDDYKIKVWNYKTKRCLFTLLGHLDYIRTTFFHKEYP-WIISASDDQTIRIWNWQSRTAICVL---TGHSHYVMCAQFHPKEDLVVSASLDQTVRVWDISGLR 170          
The following BLAST results are available for this feature:
BLAST of EED-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EED7.347e-9839.50embryonic ectoderm development [Source:HGNC Symbol... [more]
EED7.347e-9839.50embryonic ectoderm development [Source:HGNC Symbol... [more]
EED6.171e-9739.50embryonic ectoderm development [Source:HGNC Symbol... [more]
EED3.244e-9237.18embryonic ectoderm development [Source:HGNC Symbol... [more]
EED6.531e-9141.28embryonic ectoderm development [Source:HGNC Symbol... [more]
back to top
BLAST of EED-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mes-61.038e-1821.63Polycomb protein mes-6 [Source:UniProtKB/Swiss-Pr... [more]
wdr-237.290e-727.45DDB1- and CUL4-associated factor 11 homolog [Sour... [more]
wdr-237.290e-727.45DDB1- and CUL4-associated factor 11 homolog [Sour... [more]
wdr-238.615e-727.45DDB1- and CUL4-associated factor 11 homolog [Sour... [more]
wdr-238.615e-727.45DDB1- and CUL4-associated factor 11 homolog [Sour... [more]
back to top
BLAST of EED-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
escl5.958e-9538.75gene:FBgn0032391 transcript:FBtr0342581[more]
escl5.958e-9538.75gene:FBgn0032391 transcript:FBtr0080286[more]
esc2.087e-9037.75gene:FBgn0000588 transcript:FBtr0080325[more]
Lis-15.382e-837.36gene:FBgn0015754 transcript:FBtr0087241[more]
Lis-15.382e-837.36gene:FBgn0015754 transcript:FBtr0304747[more]
back to top
BLAST of EED-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eed5.325e-9438.75embryonic ectoderm development [Source:NCBI gene;A... [more]
pafah1b1b1.039e-632.50platelet-activating factor acetylhydrolase 1b, reg... [more]
pafah1b1b1.039e-632.50platelet-activating factor acetylhydrolase 1b, reg... [more]
copa2.932e-627.43coatomer protein complex, subunit alpha [Source:ZF... [more]
pafah1b1a5.571e-631.25platelet-activating factor acetylhydrolase 1b, reg... [more]
back to top
BLAST of EED-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eed6.801e-9739.24embryonic ectoderm development [Source:NCBI gene;A... [more]
eed6.233e-9539.24embryonic ectoderm development [Source:NCBI gene;A... [more]
eed7.345e-9539.24embryonic ectoderm development [Source:NCBI gene;A... [more]
hnrnpa2b14.190e-724.26heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b14.398e-724.44heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of EED-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eed5.044e-9839.50embryonic ectoderm development [Source:MGI Symbol;... [more]
Eed5.044e-9839.50embryonic ectoderm development [Source:MGI Symbol;... [more]
Eed3.505e-9739.50embryonic ectoderm development [Source:MGI Symbol;... [more]
Eed1.174e-5040.38embryonic ectoderm development [Source:MGI Symbol;... [more]
Eed1.429e-2544.55embryonic ectoderm development [Source:MGI Symbol;... [more]
back to top
BLAST of EED-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q921E6|EED_MOUSE3.528e-9739.50Polycomb protein EED OS=Mus musculus OX=10090 GN=E... [more]
sp|O75530|EED_HUMAN3.528e-9739.50Polycomb protein EED OS=Homo sapiens OX=9606 GN=EE... [more]
sp|Q3SZ25|EED_BOVIN3.684e-9739.50Polycomb protein EED OS=Bos taurus OX=9913 GN=EED ... [more]
sp|Q6AZS2|EEDB_XENLA3.200e-9638.99Polycomb protein eed-B OS=Xenopus laevis OX=8355 G... [more]
sp|Q28DT7|EED_XENTR3.603e-9639.24Polycomb protein eed OS=Xenopus tropicalis OX=8364... [more]
back to top
BLAST of EED-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXT30.000e+0100.00EED-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A5B9BXU80.000e+086.97Embryonic ectoderm development-like protein OS=Dug... [more]
G4VT415.763e-11743.55Putative embryonic ectoderm development protein OS... [more]
W6UDL58.031e-11743.18Polycomb protein EED OS=Echinococcus granulosus OX... [more]
A0A068Y2178.912e-11743.18Polycomb protein EED OS=Echinococcus multiloculari... [more]
back to top
BLAST of EED-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eed4.432e-9238.00embryonic ectoderm development [Source:NCBI gene;A... [more]
eed1.156e-8539.53embryonic ectoderm development [Source:NCBI gene;A... [more]
pafah1b1a6.883e-731.25lissencephaly-1 homolog A-like [Source:NCBI gene;A... [more]
pafah1b1a8.409e-731.25lissencephaly-1 homolog A-like [Source:NCBI gene;A... [more]
pafah1b1b2.085e-631.25lissencephaly-1 homolog B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of EED-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
eed3.554e-6438.58embryonic ectoderm development [Source:NCBI gene;A... [more]
ciao13.013e-838.55cytosolic iron-sulfur assembly component 1 [Source... [more]
pafah1b1b2.804e-730.00platelet-activating factor acetylhydrolase 1b, reg... [more]
back to top
BLAST of EED-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CRN19.044e-722.99Coronin; cortical actin cytoskeletal component tha... [more]
COP11.810e-627.83Alpha subunit of COPI vesicle coatomer complex; co... [more]
back to top
BLAST of EED-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420203.120e-7537.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
KATNB14.259e-828.95Katanin p80 WD40 repeat-containing subunit B1 [So... [more]
EDO420196.969e-839.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO338371.114e-628.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346762.102e-626.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EED-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eed8.247e-9338.25embryonic ectoderm development [Source:NCBI gene;A... [more]
eed9.840e-3537.50embryonic ectoderm development [Source:NCBI gene;A... [more]
katnb11.937e-730.77katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
katnb11.937e-730.77katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
PAFAH1B11.371e-631.25platelet activating factor acetylhydrolase 1b regu... [more]
back to top
BLAST of EED-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045902.10.000e+0100.00SMESG000045902.1[more]
SMESG000034899.13.870e-632.58SMESG000034899.1[more]
SMESG000034899.14.177e-632.58SMESG000034899.1[more]
SMESG000034899.14.299e-632.58SMESG000034899.1[more]
SMESG000077177.15.853e-626.36SMESG000077177.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006748
GenBankAFD29604.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006748 ID=SMED30006748|Name=EED-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1398bp
TTTTTTTTCATTTACACTAATTTAAATTAACCTTGTTTTTATTTAGATTT
AATGTTTAAAGAAGAAACTAAATTAGACGCAAAACGCAAATTAATTAAGG
CTAAACGTAAAGGACCATTACATTTAGAAATAGATAAGGAAAGTGTTTCT
AATTCCTCTAAAAGTTTATCGGATAGTATATTAAATTCAAGCCAACTAAA
TTTCAAGCAAACTGCTTTAATTAAAGAAAGTCATAATAATTCAATTTTTG
GAATATCTGTCAATGATCGCATCCGTAAAAATAAGTCTGATCCTATTTTA
TTCGTCTCCGTAGGTGGTCAAAATGTTACTTTTTATGAATGTCTCCTTGA
CACACCTATAAATAATATTAAATTTCTTCATGCATATAAAGATTCAGACC
CAAATGAAGAGTTTTATTGTTGTGCATGGTCATATTATGTTCCTTTTCAA
AATCGAAATGAAAATTATAGAGACGGCATGTTTGAATCATACCTGGAAAG
TTGTACTGTAGGTCAGCAAATCGTTGCATGTGCCGGCAAAAAAGGAATTA
TTCGAATTATTAGTCCTAACATGAGTGGTGTTATCTTCAATTTAGGAGGT
CATGGTCAATCAATTAATGAGATTATATTTCATCCTCTTTATCCAGATTT
ATTATTTTCATTTAGCAAAGATTATACTATCAGATTATGGAATGTATGGA
ATAGTGTTTTGGTTTGTATTTTTGGTGGATCAGAAGGTCATAGATCCGAG
ATTCTCCACGGTGATGTTGATATGGCTGGCCGATTTTTACTCTCCTGTGG
AATGGACCACACTATAAAAATATGGAAATTGGATGATTCGCGATTAATGA
ATTCTATTGCAAAATCCCGCAAATATTTGCACCATGAAAATGAGATGGTT
TTCGATACGTTCCTGCAACATTTTCCTGATTTCAGTTCTAATAAAATTCA
TGGAAATTATATCGATTGTGGCCGTTGGTTTGGGGGCCTTGTGTTTTCAA
AGTCTTGCGAAGGGTATCTAGTGCTATGGAAACCGGGCTCGTTGAATTCA
AGCCTTTTGCCGACATTTAAAATCGGCCAAGATGTCAAACCCAGCATTCT
TCATCAGTTTGAACTGGATGATTGCGATATTTGGTATGTCAGATTCGATA
TAGATGTCAAGCGGGGTCTACTGGCCCTTGGCAACCGTTTGGGCCACATA
TATGTCTGGAATTTGAGAGACAGAAAGATCACAGAAGGAAATAGTATTTT
CGATTTGAAGCCGCAAAAGTTCATGATCAATAGCAAAAATGGGCTGCCGG
TCACAATTAGACAAACTCGATTTACCGATGATGCTAAGATATTGCTGTGC
GCGTGTGACGGAGGCCTGATTGCTCGCTTTGATCGTACATAATATTTA
back to top

protein sequence of SMED30006748-orf-1

>SMED30006748-orf-1 ID=SMED30006748-orf-1|Name=SMED30006748-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=447bp
MFKEETKLDAKRKLIKAKRKGPLHLEIDKESVSNSSKSLSDSILNSSQLN
FKQTALIKESHNNSIFGISVNDRIRKNKSDPILFVSVGGQNVTFYECLLD
TPINNIKFLHAYKDSDPNEEFYCCAWSYYVPFQNRNENYRDGMFESYLES
CTVGQQIVACAGKKGIIRIISPNMSGVIFNLGGHGQSINEIIFHPLYPDL
LFSFSKDYTIRLWNVWNSVLVCIFGGSEGHRSEILHGDVDMAGRFLLSCG
MDHTIKIWKLDDSRLMNSIAKSRKYLHHENEMVFDTFLQHFPDFSSNKIH
GNYIDCGRWFGGLVFSKSCEGYLVLWKPGSLNSSLLPTFKIGQDVKPSIL
HQFELDDCDIWYVRFDIDVKRGLLALGNRLGHIYVWNLRDRKITEGNSIF
DLKPQKFMINSKNGLPVTIRQTRFTDDAKILLCACDGGLIARFDRT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000422tail stripe
PLANA:0002109X1 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR037352Polycomb_EED
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0003682chromatin binding
GO:0042054histone methyltransferase activity
GO:0042802identical protein binding
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006349regulation of gene expression by genetic imprinting
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0016569covalent chromatin modification
GO:0016571histone methylation
GO:0021510spinal cord development
GO:0061087positive regulation of histone H3-K27 methylation
GO:2000011regulation of adaxial/abaxial pattern formation
Vocabulary: cellular component
TermDefinition
GO:0001739sex chromatin
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005694chromosome
GO:0005829cytosol
GO:0035098ESC/E(Z) complex
GO:0045120pronucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 217..259
e-value: 8.9E-4
score: 28.5
coord: 174..214
e-value: 0.0064
score: 25.7
coord: 346..387
e-value: 150.0
score: 3.2
IPR001680WD40 repeatPFAMPF00400WD40coord: 229..259
e-value: 0.0054
score: 17.6
coord: 180..214
e-value: 0.21
score: 12.5
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 227..268
score: 11.11
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 181..215
score: 10.776
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 46..446
e-value: 2.1E-94
score: 318.8
NoneNo IPR availablePANTHERPTHR10253POLYCOMB PROTEINcoord: 36..445
IPR037352Polycomb protein EEDPANTHERPTHR10253:SF5POLYCOMB PROTEIN EEDcoord: 36..445
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 181..268
score: 16.506
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 50..444