SJCHGC04139 protein

Overview
NameSJCHGC04139 protein
Smed IDSMED30006740
Length (bp)1162
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SJCHGC04139 protein (SMED30006740) t-SNE clustered cells

Violin plots show distribution of expression levels for SJCHGC04139 protein (SMED30006740) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SJCHGC04139 protein (SMED30006740) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SJCHGC04139 protein (SMED30006740) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006740

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30006740h1SMcG0002513 Contig1156GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30006740h1SMcG0002513 Contig1156GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30006740h1SMcG0002513 Contig1156GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30006740h1SMcG0020210 Contig1156GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30006740h1SMcG0020210 Contig1156GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30006740h1SMcG0020210 Contig1156GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30006740h1SMcG0020211 Contig43423newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006740h1SMcG0020211 Contig43423uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30006740h1SMcG0020210 dd_Smed_v4_5091_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006740h1SMcG0020210 Contig43423newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006740h1SMcG0020210 Contig43423uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30006740h1SMcG0020210 dd_Smed_v4_5091_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30006740h1SMcG0020210 dd_Smed_v4_5091_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SJCHGC04139 protein vs. TrEMBL
Match: A0A267E0J3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007171g1 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.454e-33
Identity = 79/174 (45.40%), Postives = 112/174 (64.37%), Query Frame = 3
Query:  414 STMGQRIASKASLASMSRSLGASKASIASQ---KSTIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVXXXXXXXXXXXXXXXXNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVTK---GEITKRPQEKLVTGTNTKEAISR 917
            STMG R  S+++LA  SRSLGASKAS+ S+   K+ I++EY D K+++ L SP +G  R PF +A+  F L  + + +G+ +L LR   NI LS+D GEIIGP+ I+L I  LA GIKF+ DAY I+  ER +IKF   + ++I  T    G +   P E L++GT +  A+SR
Sbjct:   72 STMGGRTGSRSNLARQSRSLGASKASVVSERGGKTNIRREYQDKKLRRNLQSPMYGKGRTPFFIAVALFVLGSVLILLGVVVLLLRFHNNIMLSIDKGEIIGPLLISLGIASLAGGIKFLYDAYVISNNERNRIKFTSASDSLIQATTNRAGPVKAPPTEMLMSGTVSANAVSR 245          
BLAST of SJCHGC04139 protein vs. TrEMBL
Match: A0A267EJ81 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032634g1 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 4.125e-33
Identity = 79/174 (45.40%), Postives = 112/174 (64.37%), Query Frame = 3
Query:  414 STMGQRIASKASLASMSRSLGASKASIASQ---KSTIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVXXXXXXXXXXXXXXXXNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVT---KGEITKRPQEKLVTGTNTKEAISR 917
            STMG R  S+++LA  SRSLGASKAS+ S+   K+ I++EY D K+++ L SP +G  R PF +A+  F L  + + +G+ +L LR   NI LS+D GEIIGP+ I+L I  LA GIKF+ DAY I+  ER +IKF   + ++I  T    G +   P E L++GT +  A+SR
Sbjct:   72 STMGGRTGSRSNLARQSRSLGASKASVVSERGGKTNIRREYQDKKLRRNLQSPMYGKGRTPFFIAVALFVLGSVLILLGVVVLLLRFHNNIMLSIDKGEIIGPLLISLGIASLAGGIKFLYDAYIISNNERNRIKFTSASDSLIQATTNRAGPVKAPPTEMLMSGTVSANAVSR 245          
BLAST of SJCHGC04139 protein vs. TrEMBL
Match: A0A267H992 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005923g1 PE=4 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.892e-32
Identity = 79/174 (45.40%), Postives = 112/174 (64.37%), Query Frame = 3
Query:  414 STMGQRIASKASLASMSRSLGASKASIASQ---KSTIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVXXXXXXXXXXXXXXXXNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVT---KGEITKRPQEKLVTGTNTKEAISR 917
            STMG R  S+++LA  SRSLGASKAS+ S+   K+ I++EY D K+++ L SP +G  R PF +A+  F L  + + +G+ +L LR   NI LS+D GEIIGP+ I+L I  LA GIKF+ DAY I+  ER +IKF   + ++I  T    G +   P E L++GT +  A+SR
Sbjct:   72 STMGGRTGSRSNLARQSRSLGASKASVVSERGGKTNIRREYQDKKLRRNLQSPMYGKGRTPFFIAVALFVLGGVLILLGVVVLLLRFHNNIMLSIDKGEIIGPLLISLGIASLAGGIKFLYDAYIISNNERNRIKFTSASDSLIQATTNRAGPVKAPPTEMLMSGTVSANAVSR 245          
BLAST of SJCHGC04139 protein vs. TrEMBL
Match: A0A504Y5W8 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_11257 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.600e-29
Identity = 95/229 (41.48%), Postives = 135/229 (58.95%), Query Frame = 3
Query:  273 PKDLKDFDMRRSKSQDLLKAPDDASFRGSNRNLQHTYAPSLRSLKLGSTMGQRIASKASLASMSRSLGASKASIASQKS---TIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVXXXXXXXXXXXXXX-XXNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVTK-GEITKRPQEKLVTGTNTKEAISRKLMTSKTEL 944
            P+ ++       +S D    P  A+ R S+     +Y PS  ++   S  G R    AS   MSRSL ASKAS+A+ KS   TIQ E+HD KVQ+++ S  FG ARK + +++I F L +L L +GL I  LR  + NI LS DVGE+ GPI IA S ++  LG+KF  DAY I   ER++IK++  + + + VT   E T   QEKLV+G  +K+A++R  + S+T L
Sbjct:   91 PESVRSISFAEQRSLDR-GTPSVAADRASHLGSMASYQPS--TMMGKSVYGTRSLYGASQLKMSRSLKASKASLATYKSGRTTIQAEHHDRKVQREINSVKFGRARKLYWISVICFVLFLLVLFVGLLITCLRHIYMNIILSTDVGEMTGPILIAGSFLFFGLGMKFYYDAYRIGSEERKRIKYKAASPSTVAVTTVSEPTADDQEKLVSGQTSKDALTRAPIGSRTTL 316          
BLAST of SJCHGC04139 protein vs. TrEMBL
Match: A0A2H1BXE9 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_008959 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 5.548e-28
Identity = 97/232 (41.81%), Postives = 134/232 (57.76%), Query Frame = 3
Query:  273 PKDLKDFDMRRSKSQDL---LKAPDDASFRGSNRNLQHTYAPSLRSLKLGSTMGQRIASKASLASMSRSLGASKASIASQKS---TIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVXXXXXXXXXXXXXX-XXNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVTK-GEITKRPQEKLVTGTNTKEAISRKLMTSKTEL 944
            P+ ++       +S D    L   D AS  GS      +Y PS  ++   S  G R    AS   MSRSL ASKAS+A+ KS   TIQ E+HD KVQ+++ S  FG ARK + +++I F L +L L  GL I  LR  + NI LS DVGE+ GPI IA S ++  LG+KF  DAY I   ER++IK++  + + + VT   E T   QEKLV+G  +K+A++R  + S+T L
Sbjct:   91 PESVRSISFAEQRSLDRGTPLVLADRASHLGS----MGSYQPS--TMMGKSVYGTRSLYGASQLKMSRSLKASKASLATYKSGRTTIQAEHHDRKVQREINSVKFGRARKLYWISVICFVLFLLVLFFGLLITCLRHIYMNIILSTDVGEMTGPILIAGSFLFFGLGMKFYYDAYRIGSEERKRIKYKAASPSTVAVTTVSEPTADNQEKLVSGQTSKDALTRAPIGSRTTL 316          
BLAST of SJCHGC04139 protein vs. Planmine SMEST
Match: SMESG000035447.1 (SMESG000035447.1)

HSP 1 Score: 505.368 bits (1300), Expect = 0.000e+0
Identity = 287/288 (99.65%), Postives = 287/288 (99.65%), Query Frame = 3
Query:   90 MSAHSHVTRIQMLEKNKMGTHQGRYVPITNSQXXXXXXXXXXXXXXXXXESVLSSGSHRQNPKDLKDFDMRRSKSQDLLKAPDDASFRGSNRNLQHTYAPSLRSLKLGSTMGQRIASKASLASMSRSLGASKASIASQKSTIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVXXXXXXXXXXXXXXXXNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVTKGEITKRPQEKLVTGTNTKEAISRKLMTSKTELREF 953
            MSAHSHVTRIQMLEKNKMGTHQGRYVPITN QSPPSIICSDINDSSIPPESVLSSGSHRQNPKDLKDFDMRRSKSQDLLKAPDDASFRGSNRNLQHTYAPSLRSLKLGSTMGQRIASKASLASMSRSLGASKASIASQKSTIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVLFLGIGLTILFLRGFGNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVTKGEITKRPQEKLVTGTNTKEAISRKLMTSKTELREF
Sbjct:    1 MSAHSHVTRIQMLEKNKMGTHQGRYVPITNPQSPPSIICSDINDSSIPPESVLSSGSHRQNPKDLKDFDMRRSKSQDLLKAPDDASFRGSNRNLQHTYAPSLRSLKLGSTMGQRIASKASLASMSRSLGASKASIASQKSTIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVLFLGIGLTILFLRGFGNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVTKGEITKRPQEKLVTGTNTKEAISRKLMTSKTELREF 288          
BLAST of SJCHGC04139 protein vs. Planmine SMEST
Match: SMESG000035447.1 (SMESG000035447.1)

HSP 1 Score: 481.871 bits (1239), Expect = 3.171e-172
Identity = 276/277 (99.64%), Postives = 276/277 (99.64%), Query Frame = 3
Query:  123 MLEKNKMGTHQGRYVPITNSQXXXXXXXXXXXXXXXXXESVLSSGSHRQNPKDLKDFDMRRSKSQDLLKAPDDASFRGSNRNLQHTYAPSLRSLKLGSTMGQRIASKASLASMSRSLGASKASIASQKSTIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVXXXXXXXXXXXXXXXXNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVTKGEITKRPQEKLVTGTNTKEAISRKLMTSKTELREF 953
            MLEKNKMGTHQGRYVPITN QSPPSIICSDINDSSIPPESVLSSGSHRQNPKDLKDFDMRRSKSQDLLKAPDDASFRGSNRNLQHTYAPSLRSLKLGSTMGQRIASKASLASMSRSLGASKASIASQKSTIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVLFLGIGLTILFLRGFGNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVTKGEITKRPQEKLVTGTNTKEAISRKLMTSKTELREF
Sbjct:    1 MLEKNKMGTHQGRYVPITNPQSPPSIICSDINDSSIPPESVLSSGSHRQNPKDLKDFDMRRSKSQDLLKAPDDASFRGSNRNLQHTYAPSLRSLKLGSTMGQRIASKASLASMSRSLGASKASIASQKSTIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVLFLGIGLTILFLRGFGNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVTKGEITKRPQEKLVTGTNTKEAISRKLMTSKTELREF 277          
BLAST of SJCHGC04139 protein vs. Planmine SMEST
Match: SMESG000035447.1 (SMESG000035447.1)

HSP 1 Score: 469.544 bits (1207), Expect = 1.843e-167
Identity = 270/271 (99.63%), Postives = 270/271 (99.63%), Query Frame = 3
Query:  141 MGTHQGRYVPITNSQXXXXXXXXXXXXXXXXXESVLSSGSHRQNPKDLKDFDMRRSKSQDLLKAPDDASFRGSNRNLQHTYAPSLRSLKLGSTMGQRIASKASLASMSRSLGASKASIASQKSTIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVXXXXXXXXXXXXXXXXNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVTKGEITKRPQEKLVTGTNTKEAISRKLMTSKTELREF 953
            MGTHQGRYVPITN QSPPSIICSDINDSSIPPESVLSSGSHRQNPKDLKDFDMRRSKSQDLLKAPDDASFRGSNRNLQHTYAPSLRSLKLGSTMGQRIASKASLASMSRSLGASKASIASQKSTIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVLFLGIGLTILFLRGFGNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVTKGEITKRPQEKLVTGTNTKEAISRKLMTSKTELREF
Sbjct:    1 MGTHQGRYVPITNPQSPPSIICSDINDSSIPPESVLSSGSHRQNPKDLKDFDMRRSKSQDLLKAPDDASFRGSNRNLQHTYAPSLRSLKLGSTMGQRIASKASLASMSRSLGASKASIASQKSTIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVLFLGIGLTILFLRGFGNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVTKGEITKRPQEKLVTGTNTKEAISRKLMTSKTELREF 271          
BLAST of SJCHGC04139 protein vs. Planmine SMEST
Match: SMESG000078527.1 (SMESG000078527.1)

HSP 1 Score: 121.324 bits (303), Expect = 1.395e-31
Identity = 74/162 (45.68%), Postives = 109/162 (67.28%), Query Frame = 3
Query:  456 SMSRSLGASKASIASQKS---TIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVXXXXXXXXXXXXXXXXNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFR--GDNATMINVTKGE-ITKRPQEKLVTGTNTKEAISRKL 923
            S SRSLG SKAS+AS KS   +IQQE+HDIKVQKK+ S  +G A++PF  ++I F +  +F  IGLT++  R +G +FLS+D GEIIGPIFI   +I L++GIKF++DAY   ++ER+++ FR  G N  ++  T    +T      + +G+   +AI++ L
Sbjct:  112 SASRSLGGSKASLASAKSYKSSIQQEFHDIKVQKKINSLAYGHAKRPFRYSIICFVIGGVFFLIGLTVIMFRLYGQLFLSMDKGEIIGPIFIVSGVILLSVGIKFMVDAYRYGQLERKRLGFRAAGPNMVVLKTTPNHNVTPTANNYVQSGSAGAQAINKVL 273          
BLAST of SJCHGC04139 protein vs. Planmine SMEST
Match: SMESG000064318.1 (SMESG000064318.1)

HSP 1 Score: 110.923 bits (276), Expect = 2.841e-28
Identity = 79/228 (34.65%), Postives = 126/228 (55.26%), Query Frame = 3
Query:  246 LSSGSHRQNPKDLKDFDMRRSKSQDLLKAPDDASFRGSNRNLQHTYAPSLRSLKLGSTMGQRIASKASLASMSRSLGAS---KASIASQKSTIQQEYHDIKVQKKLTSPWFGAARKPFMLAMIFFSLAVXXXXXXXXXXXXXXXXNIFLSLDVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMINVTKGEITKRPQEKLVTGTNTKEAISRK 920
            +S  SH+   K LK  D   S S +         F G+   L  +Y  +  S  + S+    ++ + S+ S  R L  +    A +      IQQE HDI++ +K+  PW+G  + PF +A+ F+ L + FL  GLT++ L  FGNIFLS+D G+I+GP F+ L+II  A+GIK    +Y I+E  R K+KFRG +  M+++T        ++ LV+GT ++ A+++K
Sbjct:    1 MSEFSHKNKLKQLKK-DHSTSSSHNY-----QNDFHGNQSIL--SYNSTRSSNDILSSQPSFLSGEISIKSKDRDLATNFTNSAHVIGISYNIQQESHDIQLHRKIRQPWYGVGKYPFRIAVAFYILFLTFLITGLTLIVLTSFGNIFLSMDTGQILGPSFVVLAIICFAIGIKSHYKSYLISEKSRSKLKFRGVDGKMVSMTTKLPESNTRDTLVSGTQSEMAVTKK 220          
The following BLAST results are available for this feature:
BLAST of SJCHGC04139 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04139 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04139 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04139 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04139 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04139 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04139 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04139 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E0J33.454e-3345.40Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EJ814.125e-3345.40Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H9921.892e-3245.40Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A504Y5W82.600e-2941.48Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A2H1BXE95.548e-2841.81Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
back to top
BLAST of SJCHGC04139 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04139 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04139 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04139 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04139 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04139 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035447.10.000e+099.65SMESG000035447.1[more]
SMESG000035447.13.171e-17299.64SMESG000035447.1[more]
SMESG000035447.11.843e-16799.63SMESG000035447.1[more]
SMESG000078527.11.395e-3145.68SMESG000078527.1[more]
SMESG000064318.12.841e-2834.65SMESG000064318.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006740 ID=SMED30006740|Name=SJCHGC04139 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1162bp
ACAAAAGGCAATTATTTAAAAACAGGAAATTTTGTGGAGTCTGTTGAAAT
TTTTTAACGCTATTCGACTAGAGTCATACAAATCCAAATATGAGTGCACA
TTCTCATGTAACTCGTATTCAAATGTTAGAAAAGAACAAAATGGGTACTC
ATCAAGGCAGATACGTACCTATTACGAATTCTCAAAGTCCTCCTAGTATT
ATATGCAGTGATATTAATGACTCTAGCATACCACCGGAAAGTGTTTTGAG
TAGTGGTAGTCATAGACAAAATCCAAAAGATTTAAAAGATTTTGATATGC
GTCGAAGTAAAAGCCAAGATTTATTAAAAGCTCCTGACGATGCATCTTTT
CGTGGAAGCAATCGCAATTTGCAGCATACATATGCGCCTAGCTTGCGTAG
CCTAAAATTAGGTTCTACAATGGGGCAAAGAATTGCTTCTAAAGCGAGTT
TAGCTTCAATGTCTCGGAGTTTAGGGGCATCTAAAGCATCAATCGCTAGT
CAAAAAAGTACTATTCAACAGGAATATCACGACATTAAAGTGCAAAAAAA
ATTAACTTCTCCATGGTTTGGTGCTGCTCGTAAACCATTTATGTTAGCTA
TGATATTTTTTTCATTGGCCGTACTGTTTCTCGGTATCGGTTTGACAATT
TTGTTTCTAAGAGGATTTGGAAATATCTTTCTGAGTCTTGATGTTGGTGA
AATTATCGGTCCAATATTTATTGCCTTATCAATTATATGGCTAGCACTTG
GAATCAAATTCATAATTGATGCATATAATATTGCAGAAATGGAACGCCGA
AAAATAAAGTTTAGAGGGGATAACGCAACCATGATCAATGTTACAAAAGG
TGAAATTACAAAGAGACCACAGGAAAAATTAGTTACCGGAACTAACACCA
AAGAAGCAATTAGTCGAAAATTGATGACCTCGAAAACGGAACTAAGAGAA
TTTTAATCTCAGAAATCAGTGTAAATTCTGTTTGTTATTAATCCCCCCAC
ATTTCTCCCTCTCCATATGTTGTGTCCATTCCTAAATTTGACAGTTGTCT
TGATCGTTATTTATTCAATTATGGCCGTGAAATGAATTTTGTACAAAACA
TATCATTATTATTTTTGAATTTTACAAATAACTTTGCTCAATTTTAATTG
GCTGATGAATAC
back to top

protein sequence of SMED30006740-orf-1

>SMED30006740-orf-1 ID=SMED30006740-orf-1|Name=SMED30006740-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=289bp
MSAHSHVTRIQMLEKNKMGTHQGRYVPITNSQSPPSIICSDINDSSIPPE
SVLSSGSHRQNPKDLKDFDMRRSKSQDLLKAPDDASFRGSNRNLQHTYAP
SLRSLKLGSTMGQRIASKASLASMSRSLGASKASIASQKSTIQQEYHDIK
VQKKLTSPWFGAARKPFMLAMIFFSLAVLFLGIGLTILFLRGFGNIFLSL
DVGEIIGPIFIALSIIWLALGIKFIIDAYNIAEMERRKIKFRGDNATMIN
VTKGEITKRPQEKLVTGTNTKEAISRKLMTSKTELREF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 48..70
NoneNo IPR availableTMHMMTMhelixcoord: 167..189
NoneNo IPR availableTMHMMTMhelixcoord: 204..226