colorectal mutant cancer protein

Overview
Namecolorectal mutant cancer protein
Smed IDSMED30006736
Length (bp)3265
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of colorectal mutant cancer protein (SMED30006736) t-SNE clustered cells

Violin plots show distribution of expression levels for colorectal mutant cancer protein (SMED30006736) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of colorectal mutant cancer protein (SMED30006736) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for colorectal mutant cancer protein (SMED30006736) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006736

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30006736SMESG000002794.1 dd_Smed_v4_5396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006736SMESG000002794.1 dd_Smed_v4_5396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006736SMESG000002794.1 dd_Smed_v4_5396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30006736SMESG000002794.1 dd_Smed_v4_5396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30006736SMESG000002794.1 dd_Smed_v4_5396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30006736SMESG000002794.1 dd_Smed_v4_5396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006736SMESG000002794.1 dd_Smed_v4_5396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006736SMESG000002794.1 Contig46890newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006736SMESG000002794.1 Contig46890uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30006736SMESG000002794.1 dd_Smed_v4_5396_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006736SMESG000002794.1 dd_Smed_v4_5396_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30006736SMESG000002794.1 dd_Smed_v4_5396_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of colorectal mutant cancer protein vs. Ensembl Human
Match: MCC (MCC regulator of WNT signaling pathway [Source:HGNC Symbol;Acc:HGNC:6935])

HSP 1 Score: 111.694 bits (278), Expect = 3.237e-24
Identity = 84/270 (31.11%), Postives = 141/270 (52.22%), Query Frame = 3
Query:  138 RLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVL-----------ALNEGECSRK---KSAEYLVHSNFXXXXXXXXXXLAGSCSDVSQIYSSVDYDSGTQEIQEEPLNLFAMLQQF--YG--DLYCQWTASERDNASP----SLSQQLLQCANQIHLSRINRLYSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQE---LQNQTS-RYEDRLTELHSVIAELQKKIERKDRNTI 869
            R++ LF +CD + DG + + DL+M+CR++NM +   EI++ LGA+ NG  ISFQ+F +CR +++           A ++  C++K   + A +   S+              S   +S    S +YDSG +++Q   +   + LQ+   YG   L+ Q    +    SP    S+    L+ AN +H + +  L  ++    KR       +D  +K++ + Q ++  L +E   +Q +T+ RYE+R+TELHSVIAEL KKI+R    TI
Sbjct:   39 RMRRLFQTCDGDGDGYISRNDLLMVCRQLNMEESVAEIMNQLGADENG-KISFQDFTRCRMQLVREIRKEEVDLSAKSDNSCTKKLRDRIASWPTSSD-------------NSLGALSAARESWEYDSGARDLQSPDVQSQSALQKLLEYGGSSLHQQAALHKLLTQSPHIGNSVGGSYLELANTLHSAALASLKGDIVELNKRLQQTERERDLLEKKLAKAQCEQSHLMREHEDVQERTTLRYEERITELHSVIAELNKKIDRLQGTTI 294          

HSP 2 Score: 82.8037 bits (203), Expect = 2.994e-15
Identity = 116/451 (25.72%), Postives = 205/451 (45.45%), Query Frame = 3
Query: 1689 KRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRST-SSCGD---------FRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIV---GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKS-------LKVQLNQMMQHR------------------------------------------TDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            +   +E +RL +  +   +   LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++                      SLI+   +     SS GD           +  H  R+  E+AAK L+ + +   S G     +G  V    S    S    +    +S   ++TK DE +L+    QL+ +R   +L+++     H++   Y               D+   P  D        +Q L +E+A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++       LK ++ +  + R                                           +F +     ++LKA++++L+ ALE L +  +++ +Q+ EFVNDLK+AN+ L+ A++KAKKK+QNK+ +LE Q+ A
Sbjct:  584 REFEVETERLNSRIEHLKSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESE---------------------QSLILGQFRAAGVGSSPGDQSGDENITQMLKRAHDCRKTAENAAKALLMKLD--GSCGGAFAVAGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSY---------------DVK--PRGD--------SQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTREAQEQAYLVHIEHLKSEVEEQKEQRMRSLSSTSSGSKDKPGKECADAASPALSLAELRTTCSENELAAEFTNAIRREKKLKARVQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMA 986          
BLAST of colorectal mutant cancer protein vs. Ensembl Human
Match: MCC (MCC regulator of WNT signaling pathway [Source:HGNC Symbol;Acc:HGNC:6935])

HSP 1 Score: 83.1889 bits (204), Expect = 1.793e-15
Identity = 116/451 (25.72%), Postives = 205/451 (45.45%), Query Frame = 3
Query: 1689 KRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRST-SSCGD---------FRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIV---GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKS-------LKVQLNQMMQHR------------------------------------------TDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            +   +E +RL +  +   +   LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++                      SLI+   +     SS GD           +  H  R+  E+AAK L+ + +   S G     +G  V    S    S    +    +S   ++TK DE +L+    QL+ +R   +L+++     H++   Y               D+   P  D        +Q L +E+A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++       LK ++ +  + R                                           +F +     ++LKA++++L+ ALE L +  +++ +Q+ EFVNDLK+AN+ L+ A++KAKKK+QNK+ +LE Q+ A
Sbjct:  331 REFEVETERLNSRIEHLKSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESE---------------------QSLILGQFRAAGVGSSPGDQSGDENITQMLKRAHDCRKTAENAAKALLMKLD--GSCGGAFAVAGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSY---------------DVK--PRGD--------SQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTREAQEQAYLVHIEHLKSEVEEQKEQRMRSLSSTSSGSKDKPGKECADAASPALSLAELRTTCSENELAAEFTNAIRREKKLKARVQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMA 733          
BLAST of colorectal mutant cancer protein vs. Ensembl Human
Match: MCC (MCC regulator of WNT signaling pathway [Source:HGNC Symbol;Acc:HGNC:6935])

HSP 1 Score: 82.8037 bits (203), Expect = 2.095e-15
Identity = 116/451 (25.72%), Postives = 205/451 (45.45%), Query Frame = 3
Query: 1689 KRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRST-SSCGD---------FRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIV---GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKS-------LKVQLNQMMQHR------------------------------------------TDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            +   +E +RL +  +   +   LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++                      SLI+   +     SS GD           +  H  R+  E+AAK L+ + +   S G     +G  V    S    S    +    +S   ++TK DE +L+    QL+ +R   +L+++     H++   Y               D+   P  D        +Q L +E+A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++       LK ++ +  + R                                           +F +     ++LKA++++L+ ALE L +  +++ +Q+ EFVNDLK+AN+ L+ A++KAKKK+QNK+ +LE Q+ A
Sbjct:  394 REFEVETERLNSRIEHLKSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESE---------------------QSLILGQFRAAGVGSSPGDQSGDENITQMLKRAHDCRKTAENAAKALLMKLD--GSCGGAFAVAGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSY---------------DVK--PRGD--------SQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTREAQEQAYLVHIEHLKSEVEEQKEQRMRSLSSTSSGSKDKPGKECADAASPALSLAELRTTCSENELAAEFTNAIRREKKLKARVQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMA 796          
BLAST of colorectal mutant cancer protein vs. Ensembl Human
Match: MCC (MCC regulator of WNT signaling pathway [Source:HGNC Symbol;Acc:HGNC:6935])

HSP 1 Score: 53.1434 bits (126), Expect = 2.751e-7
Identity = 41/129 (31.78%), Postives = 70/129 (54.26%), Query Frame = 3
Query: 2226 DWTKADELKLRQLFDQLRLERHRARLSIVGFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNLIESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLNQM 2612
            ++TK DE +L+    QL+ +R   +L+++     +S +   LS   +    R D  +L   D EN            A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++  V +  +
Sbjct:   32 EFTKEDEQRLKDYIQQLKNDRAAVKLTMLEL---ESIHIDPLSYDVKP---RGDSQRL---DLEN------------AVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTREAQEQAYLVHIEHL 139          
BLAST of colorectal mutant cancer protein vs. Ensembl Human
Match: MCC (MCC regulator of WNT signaling pathway [Source:HGNC Symbol;Acc:HGNC:6935])

HSP 1 Score: 54.6842 bits (130), Expect = 1.023e-6
Identity = 81/322 (25.16%), Postives = 144/322 (44.72%), Query Frame = 3
Query: 1689 KRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRST-SSCGD---------FRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIV---GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLNQM 2612
            +   +E +RL +  +   +   LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++                      SLI+   +     SS GD           +  H  R+  E+AAK L+ + +   S G     +G  V    S    S    +    +S   ++TK DE +L+    QL+ +R   +L+++     H++   Y               D+   P  D        +Q L +E+A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++  V +  +
Sbjct:  394 REFEVETERLNSRIEHLKSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESE---------------------QSLILGQFRAAGVGSSPGDQSGDENITQMLKRAHDCRKTAENAAKALLMKLD--GSCGGAFAVAGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSY---------------DVK--PRGD--------SQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTREAQEQAYLVHIEHL 667          
BLAST of colorectal mutant cancer protein vs. Ensembl Zebrafish
Match: mcc (MCC regulator of WNT signaling pathway [Source:ZFIN;Acc:ZDB-GENE-141210-1])

HSP 1 Score: 86.6557 bits (213), Expect = 9.931e-17
Identity = 113/419 (26.97%), Postives = 190/419 (45.35%), Query Frame = 3
Query: 1755 LLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRSTSSCGD------FRQL---RHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIVGFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNLIESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKS-------LKVQLNQMMQHR-------------------------------------TDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++                       L++   +    S+ G+        QL    H  R+  E+AAK L+ R +   S G     +G       S    S    +    +S   D++K DE +L+    QL+ +R   +L+++     +S + + LS      L     G     D EN            A+L+QEL ++KEE A LK ++YLLEKE K+++L L S+ A E++       LK +L +  + R                                      +        ++LKA++++L+ ALE L +  +V+ +Q+ EFVNDLK+AN+ L+ A++KAKKK+QNK+ +LE Q+ A
Sbjct:  566 LLTITLEECKSNAERMSMLLGKYESNSTALRLALQYSEQCIEAYELLLALAESE---------------------QGLVLGQFRAAGVSAVGEHAGEESISQLLKKAHDSRKTAENAAKDLLTRLD--GSCGAAFAVTGCSAQPWESLSSNSHTSTTSSTASSCDTDFSKEDEQRLKDYVQQLKNDRAAVKLTMLDL---ESVHIEPLSPE----LRTRGGGDAQRLDLEN------------AVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSSREAQEQAYLVHIEHLKAELEEHQEQRHTALTSTSTCSSSSKDCGDSPSVSVCDLRNLSDGDLAAELTGALRREKKLKARVQELVSALERLTKSSEVRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLECQMMA 942          

HSP 2 Score: 78.9518 bits (193), Expect = 2.582e-14
Identity = 73/253 (28.85%), Postives = 119/253 (47.04%), Query Frame = 3
Query:  138 RLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVLA---LNEGECSRKKSAEYLVHSNFXXXXXXXXXXLAGSCSDVSQIYSSVDYDSGTQEIQEEPLNLFAMLQQFYGDLYCQWTASERDNASPSLSQQLLQCANQIHLSR-INRLYSELKFA-----IKRFNNCHASQDNYQKEITRHQKDRERLKQELQNQTSRYEDRLTELHSVIAELQKKIERKDRNTI 869
            RL+ LF +CD + DG +++ DL+M+CR++NM D   EI+  LGA+  G  ISF++F +CR ++L      EG+ S + S       +   +   +      S  +      S ++DSG +++Q         LQ                  S  L Q+LL+  + +  S  + +L  +  F+     ++  N C  S       +  H++ +ER        T  YE+R+TELHS+IAEL KKI+     TI
Sbjct:   25 RLQRLFQTCDGDGDGFINRNDLLMVCRQLNMEDSVAEIMGQLGADERGK-ISFEDFTRCRMQLLTEIQKEEGQLSLRSS------DSDKQKLRERIASWPTSSENSLGARESWEFDSGARDLQS------PELQSPTQTHPHLHPHLHHHQQSSPLLQKLLEQPSVLEPSSGVQQLLCQPAFSRSGGYLELANTCEQSH-----LLREHEEVQER-------TTLCYEERITELHSIIAELNKKIDLLQGATI 252          
BLAST of colorectal mutant cancer protein vs. Ensembl Xenopus
Match: mcc (mutated in colorectal cancers [Source:NCBI gene;Acc:100216150])

HSP 1 Score: 85.8853 bits (211), Expect = 2.481e-16
Identity = 113/440 (25.68%), Postives = 205/440 (46.59%), Query Frame = 3
Query:  138 RLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVLA--------LNEGECSRKKSAEYLVHSNFXXXXXXXXXXLAGSCSDVSQIYSSVDYDSGTQEIQEEPLNLFAMLQQF--YGDLYCQWTA-----SERDNASPSLSQQLLQCANQIHLSRINRLYSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQE---LQNQTS-RYEDRLTELHSVIAELQKKIERKDRNTIMXXXXXXXXXXXXX---------XXXADYEKLNL---RNQSELVK--ESTPGNTFHQLSCSTSFVESSIFGADKST-----APSEKPMSNVNFVEVQTDIACAMDSRTFNIQKNDRSNEKLQEAT--EKQLKAFHHNHIFLQEKLSNYENVVCSLRTQLGSVLEERESLRKQLKDLQ 1337
            R++ LF +CD + DG + + DL+M+CR++NM     EI+  LGA+ +G  ISFQ+F +CR +++         L++  C  KK            +  +       S    S    S +YDSG +++Q       +++Q+F  +G       A     S+  ++S ++    L+ AN +HL+ +  L  ++    KR       +D  +K++ + Q ++  L +E   +Q +T+ RYE+R+TELHS+IAEL KKI+R    TI EEDE                    + D ++ ++    NQS +V     T  +   +L    + +E++I G  KS+     A  ++ +  +       D+A         +   D      +E +  EK+L      +  L   L + E  +   +  + ++ EER+ LR+++++LQ
Sbjct:   27 RMRRLFQTCDGDGDGYISRNDLMMVCRQLNMEGSVAEIMHQLGADESGK-ISFQDFTRCRMQLVREIQKEEVDLSDDSCKNKK---------LRGRITSWPTGSENSIGAFSGARESWEYDSGARDLQSPDPQNHSIMQKFLEFGSKATTQAALQKLLSQTSSSSNNMGGSYLELANTLHLAALASLRGDIVELNKRLQQTERERDMLEKKLAKSQCEQAHLMREHEDVQERTTLRYEERITELHSIIAELNKKIDRLQGTTIREEDEYSELRSEHSHSQLETNDDSRSMDQDQTSVSVQENQSTMVTVDMDTCSDLNSELQRVLTGLENAICGRKKSSCNLSVADVDRHIEQLTTASEHCDLAIKTVEEIEGVLGRDLYPNIAEERSRWEKELAGLREENESLTAMLCSKEEDLNRTKATMNAIREERDRLRRRVRELQ 456          

HSP 2 Score: 83.1889 bits (204), Expect = 1.657e-15
Identity = 111/421 (26.37%), Postives = 195/421 (46.32%), Query Frame = 3
Query: 1755 LLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRSTSSCG------DFRQL---RHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIV---GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKS-------LKVQLNQMMQHR-----------------------------------TDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++                      SLI+   +     S G      +  Q+    H  R+  E+AAK L+ + +   S G     +G  V    S    S    +    +S   ++TK DE +L+    QL+ +R   +L+++     H++   Y               D+   P  D        +Q L +E+A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++       LK ++ +  + R                                   ++  S     ++LK++ ++L+ ALE L +  +++ +Q+ EFVNDLK+AN+ L+ A++KAKKK+QNK+ +LE Q+ A
Sbjct:  583 LLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESE---------------------QSLILGQFRAAGVGSVGKKSGDENVTQMLKRAHDCRKTAENAAKALLMKLD--GSCGGAFAVTGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSY---------------DVK--PRGD--------SQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTRDAQEQAYLVHIEHLKSEVEEQKEQRMRSLSSTSSSSKDKLGKGSALSLSELRTYNESELASELTSALRREKKLKSRAQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMA 955          
BLAST of colorectal mutant cancer protein vs. Ensembl Xenopus
Match: mcc (mutated in colorectal cancers [Source:NCBI gene;Acc:100216150])

HSP 1 Score: 85.8853 bits (211), Expect = 2.777e-16
Identity = 113/440 (25.68%), Postives = 205/440 (46.59%), Query Frame = 3
Query:  138 RLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVLA--------LNEGECSRKKSAEYLVHSNFXXXXXXXXXXLAGSCSDVSQIYSSVDYDSGTQEIQEEPLNLFAMLQQF--YGDLYCQWTA-----SERDNASPSLSQQLLQCANQIHLSRINRLYSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQE---LQNQTS-RYEDRLTELHSVIAELQKKIERKDRNTIMXXXXXXXXXXXXX---------XXXADYEKLNL---RNQSELVK--ESTPGNTFHQLSCSTSFVESSIFGADKST-----APSEKPMSNVNFVEVQTDIACAMDSRTFNIQKNDRSNEKLQEAT--EKQLKAFHHNHIFLQEKLSNYENVVCSLRTQLGSVLEERESLRKQLKDLQ 1337
            R++ LF +CD + DG + + DL+M+CR++NM     EI+  LGA+ +G  ISFQ+F +CR +++         L++  C  KK            +  +       S    S    S +YDSG +++Q       +++Q+F  +G       A     S+  ++S ++    L+ AN +HL+ +  L  ++    KR       +D  +K++ + Q ++  L +E   +Q +T+ RYE+R+TELHS+IAEL KKI+R    TI EEDE                    + D ++ ++    NQS +V     T  +   +L    + +E++I G  KS+     A  ++ +  +       D+A         +   D      +E +  EK+L      +  L   L + E  +   +  + ++ EER+ LR+++++LQ
Sbjct:   34 RMRRLFQTCDGDGDGYISRNDLMMVCRQLNMEGSVAEIMHQLGADESGK-ISFQDFTRCRMQLVREIQKEEVDLSDDSCKNKK---------LRGRITSWPTGSENSIGAFSGARESWEYDSGARDLQSPDPQNHSIMQKFLEFGSKATTQAALQKLLSQTSSSSNNMGGSYLELANTLHLAALASLRGDIVELNKRLQQTERERDMLEKKLAKSQCEQAHLMREHEDVQERTTLRYEERITELHSIIAELNKKIDRLQGTTIREEDEYSELRSEHSHSQLETNDDSRSMDQDQTSVSVQENQSTMVTVDMDTCSDLNSELQRVLTGLENAICGRKKSSCNLSVADVDRHIEQLTTASEHCDLAIKTVEEIEGVLGRDLYPNIAEERSRWEKELAGLREENESLTAMLCSKEEDLNRTKATMNAIREERDRLRRRVRELQ 463          

HSP 2 Score: 80.4925 bits (197), Expect = 1.226e-14
Identity = 111/424 (26.18%), Postives = 194/424 (45.75%), Query Frame = 3
Query: 1755 LLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRSTSSC---GD-----FRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIV---GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKS-------LKVQLNQMMQHR---------------------------------------TDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++                      SLI+   +     S    GD       +  H  R+  E+AAK L+ + +   S G     +G  V    S    S    +    +S   ++TK DE +L+    QL+ +R   +L+++     H++   Y               D+   P  D        +Q L +E+A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++       LK ++ +  + R                                       ++  S     ++LK++ ++L+ ALE L +  +++ +Q+ EFVNDLK+AN+ L+ A++KAKKK+QNK+ +LE Q+ A
Sbjct:  598 LLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESE---------------------QSLILGQFRAAGVGSVAESGDENVTQMLKRAHDCRKTAENAAKALLMKLD--GSCGGAFAVTGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSY---------------DVK--PRGD--------SQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTRDAQEQAYLVHIEHLKSEVEEQKEQRMRSLSSTSSSSKDKLGKDSTEGSALSLSELRTYNESELASELTSALRREKKLKSRAQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMA 973          
BLAST of colorectal mutant cancer protein vs. Ensembl Xenopus
Match: mcc (mutated in colorectal cancers [Source:NCBI gene;Acc:100216150])

HSP 1 Score: 83.5741 bits (205), Expect = 1.303e-15
Identity = 111/421 (26.37%), Postives = 195/421 (46.32%), Query Frame = 3
Query: 1755 LLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRSTSSCG------DFRQL---RHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIV---GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKS-------LKVQLNQMMQHR-----------------------------------TDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++                      SLI+   +     S G      +  Q+    H  R+  E+AAK L+ + +   S G     +G  V    S    S    +    +S   ++TK DE +L+    QL+ +R   +L+++     H++   Y               D+   P  D        +Q L +E+A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++       LK ++ +  + R                                   ++  S     ++LK++ ++L+ ALE L +  +++ +Q+ EFVNDLK+AN+ L+ A++KAKKK+QNK+ +LE Q+ A
Sbjct:  404 LLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESE---------------------QSLILGQFRAAGVGSVGKKSGDENVTQMLKRAHDCRKTAENAAKALLMKLD--GSCGGAFAVTGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSY---------------DVK--PRGD--------SQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTRDAQEQAYLVHIEHLKSEVEEQKEQRMRSLSSTSSSSKDKLGKGSALSLSELRTYNESELASELTSALRREKKLKSRAQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMA 776          
BLAST of colorectal mutant cancer protein vs. Ensembl Xenopus
Match: mcc (mutated in colorectal cancers [Source:NCBI gene;Acc:100216150])

HSP 1 Score: 82.8037 bits (203), Expect = 1.870e-15
Identity = 111/421 (26.37%), Postives = 195/421 (46.32%), Query Frame = 3
Query: 1755 LLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRSTSSCG------DFRQL---RHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIV---GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKS-------LKVQLNQMMQHR-----------------------------------TDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++                      SLI+   +     S G      +  Q+    H  R+  E+AAK L+ + +   S G     +G  V    S    S    +    +S   ++TK DE +L+    QL+ +R   +L+++     H++   Y               D+   P  D        +Q L +E+A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++       LK ++ +  + R                                   ++  S     ++LK++ ++L+ ALE L +  +++ +Q+ EFVNDLK+AN+ L+ A++KAKKK+QNK+ +LE Q+ A
Sbjct:  389 LLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESE---------------------QSLILGQFRAAGVGSVGKKSGDENVTQMLKRAHDCRKTAENAAKALLMKLD--GSCGGAFAVTGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSY---------------DVK--PRGD--------SQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTRDAQEQAYLVHIEHLKSEVEEQKEQRMRSLSSTSSSSKDKLGKGSALSLSELRTYNESELASELTSALRREKKLKSRAQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMA 761          
BLAST of colorectal mutant cancer protein vs. Ensembl Xenopus
Match: mcc (mutated in colorectal cancers [Source:NCBI gene;Acc:100216150])

HSP 1 Score: 81.6481 bits (200), Expect = 5.272e-15
Identity = 111/425 (26.12%), Postives = 195/425 (45.88%), Query Frame = 3
Query: 1755 LLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRSTSSCG------DFRQL---RHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIV---GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKS-------LKVQLNQMMQHR---------------------------------------TDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++                      SLI+   +     S G      +  Q+    H  R+  E+AAK L+ + +   S G     +G  V    S    S    +    +S   ++TK DE +L+    QL+ +R   +L+++     H++   Y               D+   P  D        +Q L +E+A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++       LK ++ +  + R                                       ++  S     ++LK++ ++L+ ALE L +  +++ +Q+ EFVNDLK+AN+ L+ A++KAKKK+QNK+ +LE Q+ A
Sbjct:  396 LLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESE---------------------QSLILGQFRAAGVGSVGKKSGDENVTQMLKRAHDCRKTAENAAKALLMKLD--GSCGGAFAVTGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSY---------------DVK--PRGD--------SQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTRDAQEQAYLVHIEHLKSEVEEQKEQRMRSLSSTSSSSKDKLGKDSTEGSALSLSELRTYNESELASELTSALRREKKLKSRAQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMA 772          
BLAST of colorectal mutant cancer protein vs. Ensembl Mouse
Match: Mcc (mutated in colorectal cancers [Source:MGI Symbol;Acc:MGI:96930])

HSP 1 Score: 100.908 bits (250), Expect = 4.905e-21
Identity = 78/259 (30.12%), Postives = 132/259 (50.97%), Query Frame = 3
Query:  138 RLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKV---LALNEGECSRKKSAEYLVHSNFXXXXXXXXXXLAGSCSDVSQIYSSVDYDSGTQEIQEEPLNLFAMLQQF--YGDLYCQWTA------SERDNASPSLSQQLLQCANQIHLSRINRLYSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQE---LQNQTS-RYEDRLTELHSVIAELQKKIERKDRNTI 869
            RL+ LF +CD + DG + + DL+M+CR+++M +   EI++ LG++ NG  ISFQ+F +C  ++   +   EG+ S K  ++         +  +       S   +S    S + DSG +++Q   L     LQ+   YG       A      +   N   S     L+ A+ +HL+ +  L  ++    KR       +D  +K++ + Q ++  L +E   +Q +T+ RYE+R+TELHS+IAEL KKI+R    TI
Sbjct:   24 RLRRLFQTCDGDGDGYISRNDLLMVCRQLSMEESVAEIMNQLGSDENG-KISFQDFTRCHTQLVREIRKEEGDLSMK--SDMSSTKRLSERITSWPTSSDNSLGALSAARESWEDDSGARDLQSPDLQSQRPLQKLLEYGGSSLPQQAVLHKLLTHAPNFGTSTGGSYLELASTLHLAALASLKGDIVELNKRLQQTERERDLLEKKLAKAQCEQSHLMREHEDVQERTTLRYEERITELHSIIAELNKKIDRLQGTTI 279          

HSP 2 Score: 83.5741 bits (205), Expect = 9.972e-16
Identity = 115/450 (25.56%), Postives = 202/450 (44.89%), Query Frame = 3
Query: 1689 KRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRST-SSCGD---------FRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIV---GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLNQMMQH------------------------------------------------RTDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            +   +E +RL +  +   +   LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++                      SLI+   +     SS GD           +  H  R+  E+AAK L+ + +   S G     +G  V    S    S    +    +S   ++TK DE +L+    QL+ +R   +L+++     H++   Y               D+   P  D        +Q L +E+A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++  V +  +                                                    T+F +     ++LKA++++L+ ALE L +  +++ +Q+ EFVNDLK+AN+ L+ A++KAKKK+QNK+ +LE Q+ A
Sbjct:  569 REFEVETERLNSRIEHLKSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESE---------------------QSLILGQFRAAGVGSSPGDQSGDENITQMLKRAHDCRKTAENAAKALLMKLD--GSCGGAFAVAGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSY---------------DVK--PRGD--------SQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTREAQEQAYLVHIEHLKSEVEEQKEQRTRSLSSTSSSGKEKPGKECADAASPALSLAELRTNSDSELATEFANAIRREKKLKARVQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMA 970          
BLAST of colorectal mutant cancer protein vs. Ensembl Mouse
Match: Mcc (mutated in colorectal cancers [Source:MGI Symbol;Acc:MGI:96930])

HSP 1 Score: 83.1889 bits (204), Expect = 1.103e-15
Identity = 115/450 (25.56%), Postives = 202/450 (44.89%), Query Frame = 3
Query: 1689 KRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRST-SSCGD---------FRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIV---GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLNQMMQH------------------------------------------------RTDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            +   +E +RL +  +   +   LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++                      SLI+   +     SS GD           +  H  R+  E+AAK L+ + +   S G     +G  V    S    S    +    +S   ++TK DE +L+    QL+ +R   +L+++     H++   Y               D+   P  D        +Q L +E+A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++  V +  +                                                    T+F +     ++LKA++++L+ ALE L +  +++ +Q+ EFVNDLK+AN+ L+ A++KAKKK+QNK+ +LE Q+ A
Sbjct:  394 REFEVETERLNSRIEHLKSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESE---------------------QSLILGQFRAAGVGSSPGDQSGDENITQMLKRAHDCRKTAENAAKALLMKLD--GSCGGAFAVAGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSY---------------DVK--PRGD--------SQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTREAQEQAYLVHIEHLKSEVEEQKEQRTRSLSSTSSSGKEKPGKECADAASPALSLAELRTNSDSELATEFANAIRREKKLKARVQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMA 795          
BLAST of colorectal mutant cancer protein vs. UniProt/SwissProt
Match: sp|P23508|CRCM_HUMAN (Colorectal mutant cancer protein OS=Homo sapiens OX=9606 GN=MCC PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 1.006e-14
Identity = 116/451 (25.72%), Postives = 205/451 (45.45%), Query Frame = 3
Query: 1689 KRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRST-SSCGD---------FRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIV---GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKS-------LKVQLNQMMQHR------------------------------------------TDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            +   +E +RL +  +   +   LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++                      SLI+   +     SS GD           +  H  R+  E+AAK L+ + +   S G     +G  V    S    S    +    +S   ++TK DE +L+    QL+ +R   +L+++     H++   Y               D+   P  D        +Q L +E+A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++       LK ++ +  + R                                           +F +     ++LKA++++L+ ALE L +  +++ +Q+ EFVNDLK+AN+ L+ A++KAKKK+QNK+ +LE Q+ A
Sbjct:  394 REFEVETERLNSRIEHLKSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESE---------------------QSLILGQFRAAGVGSSPGDQSGDENITQMLKRAHDCRKTAENAAKALLMKLD--GSCGGAFAVAGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSY---------------DVK--PRGD--------SQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTREAQEQAYLVHIEHLKSEVEEQKEQRMRSLSSTSSGSKDKPGKECADAASPALSLAELRTTCSENELAAEFTNAIRREKKLKARVQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMA 796          
BLAST of colorectal mutant cancer protein vs. TrEMBL
Match: A0A183NFG5 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS851 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.528e-31
Identity = 111/343 (32.36%), Postives = 155/343 (45.19%), Query Frame = 3
Query:  138 RLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVLAL-NEGE---CSRKKSAEYL---------------------------VHSNFXXXXXXXXXXLAGSCSDVSQIYSSVDYDSGTQEIQEE--------------------PLNLFAMLQQFYGDL----YCQWTASERDNASPSLSQQ--------------------------------------------LLQCANQIHLSRINRLYSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQELQNQTSRYEDRLTELHSVIAELQKKIERKDRNTI 869
            RL+ LF+SCDSNNDG LD +DL  MC+K+NM + AEEII+ LGAN+ G  I+F EFL CR KV  +  E +   CSR     +L                           V+ N   +  N+   L  S S+ S + S  +YDSG Q++  E                    PL L +M   F  D     +   + S  DN++  L  Q                                            L +CAN +H+ R  +L SE++    R      S+D   +E+ R Q+++E+L+ EL NQ SRYEDRLTELHSVIAEL++++E  + N I
Sbjct:   25 RLRQLFLSCDSNNDGCLDCEDLYNMCKKLNMAECAEEIINTLGANTKGC-ITFDEFLSCREKVFQMQTEADNIYCSRSGLPHHLNYKQPGFSWPVYTTGKLHIGVKNDGQEVNEN-SVRKMNENVNLESSASETSLVNSGAEYDSGAQDLCGEPQSLHLLMQRDFPDLYKIIFPLPLNSMRNNFENDTMTNEFNLLSVSNMDNSTKDLQNQKLTNAINIQCVDKLSNLPRHIEAESLGIKSKEVESNHFLDNVRHLFECANTLHVQRTAQLRSEIRDLSHRLQGLQTSRDMNYREVQRLQREKEQLRNELTNQVSRYEDRLTELHSVIAELRRRLEHSESNII 365          
BLAST of colorectal mutant cancer protein vs. TrEMBL
Match: A0A183QQ54 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 3.297e-30
Identity = 103/344 (29.94%), Postives = 155/344 (45.06%), Query Frame = 3
Query:  138 RLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVL--------------ALNEGECSRKKSAEYLVHSN----------------FXXXXXXXXXXLAGSCSDVSQIYSSVDYDSGTQEIQEEPLNLFAMLQQFYGDLY------------------------CQWTASERDNASPSLSQQLLQCANQIHLSRINRL----------------------------------------------YSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQELQNQTSRYEDRLTELHSVIAELQKKIERKDRNTI 869
            RL+ LF+SCDSNNDG LD +DL  MC+K+NM + AEEII+ LGAN+ G  I+F EFL CR KV                L+  +  +     +  H+                    +  N+   L  S S+ S + S  +YDSG Q++  EP +L+ ++Q+ + DLY                           + +++DN++  L  Q L   N I++  +N+L                                               SE++    R      S+D   +E+ R Q+++E+L+ EL NQ SRYEDRLTELHSVIAEL++++E  + N I
Sbjct:   16 RLRQLFLSCDSNNDGCLDCEDLYNMCKKLNMAECAEEIINTLGANTKG-CITFDEFLSCREKVFQMQTEADNIYFAKSGLSNHQIYKPSGLSWCGHTTDKIHARVQNNGQEVNENSVRKMNENINLESSASETSLVNSGAEYDSGAQDLCGEPQSLYLLMQRDFPDLYKIIFPLPMNSIRNEFENDTMTNEFNLLSVNDKDNSAKDLQNQKL--TNTINIQSVNKLSNLPRHIDKESFCIKSKEIESNHFLDNVRHLFECANTLHVQRTAQLRSEIRDLSHRLQGLQTSRDMNHREVQRLQREKEQLRNELTNQVSRYEDRLTELHSVIAELRRRLEHTESNII 356          
BLAST of colorectal mutant cancer protein vs. TrEMBL
Match: A0A210PMY7 (Colorectal mutant cancer protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22638 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 8.283e-29
Identity = 92/252 (36.51%), Postives = 138/252 (54.76%), Query Frame = 3
Query:  138 RLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVLALNEGECSRKKSAEYLVHSNFXXXXXXXXXXLAGSCSDVSQIYS----SVDYDSGTQEIQEEPLNLFAMLQQFYGDLYCQWTASERDNASPSLSQQLLQCANQIHLSRINRLYSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQE----LQNQTSRYEDRLTELHSVIAELQKKIERKDRNTI 869
            RL+ LF SCD++ DG LD+ D   MCR++NM D + EI++ +G  + GS ISFQ+F++ R++VLA ++       +     HS    Q            SD    +S    SVDYDSG +++  EP +L A+++     +  Q         S S +  +L  AN++HL+ I  L  EL     RF      +D+ +K++ + Q DR   +++    L+  TSRYE+R+TELHSVIAEL+KKIER   N I
Sbjct:   33 RLRKLFDSCDADGDGLLDRHDFEFMCRQLNMEDSSAEIMAQIGMVT-GSRISFQDFIQSRSQVLADSDPGQYMDDTGIESDHSGLVKQPQANITSWPTMSSDSFGAHSGKPDSVDYDSGARDMSPEPSSLQALMETHDPSIVQQA-------HSDSGTNDMLDLANRLHLAAITSLKGELIELNNRFQFLTGERDSLEKQLNKSQTDRLYFQRDCEDRLEQTTSRYEERITELHSVIAELRKKIERHHINVI 276          

HSP 2 Score: 107.071 bits (266), Expect = 1.332e-19
Identity = 67/184 (36.41%), Postives = 113/184 (61.41%), Query Frame = 3
Query: 2415 ENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLNQM---MQHR---------------TDFISGTDE-----------SRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSANNPGYHQQ 2876
            ENQ S+  Q L +E+A+LLQEL ++KEE+  LK+  YLLEKE ++++L L S+ + +++  +Q+  +   +Q R                D++S   +            ++LKA++++L+  LE+L    +++ +Q+ +FVNDLK+AN+ALI AFDK+KKKYQ+K+ R+E Q++A    Y  Q
Sbjct:  784 ENQRSVETQRLDLENAVLLQELMAMKEEKTELKSSNYLLEKEKRALELKLSSRDSEQQANFLQIEHLKCELQEREARLPKDEDNAGFSLVDYMSSNPDLGKELSEAAKREKKLKARVQELVVTLEKLSRNSEIRHQQSADFVNDLKRANSALISAFDKSKKKYQSKLKRMELQMAALTERYDAQ 967          
BLAST of colorectal mutant cancer protein vs. TrEMBL
Match: A0A4E0RQM5 (Colorectal mutant cancer protein OS=Fasciola hepatica OX=6192 GN=D915_000982 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.959e-28
Identity = 95/228 (41.67%), Postives = 131/228 (57.46%), Query Frame = 3
Query: 2229 WTKADELKLRQLFDQLRLERHRARLSIVGFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL--------IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLNQMMQHRTDFISG----TDESRR-----------LKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQ 2843
            W++ADE KLR    QL   R   R +IV  +L        LS  +QS         +    F+    ISN +L        +ES+ILLQELC++KEERA+LK R+YLLEKE  + +L L+S+ A E +L+  L+ +     +   G    TDE R            L+AQ+++LLQALE LR   ++QQ QNEE V+DLK+AN+ALI AF+KAK+KY  +I +LE Q
Sbjct: 1305 WSRADERKLRIWLYQLVHSRRILRSTIV-ENLPNLIEDDGLSDGHQS---------VTKGSFQ---CISNGSLGKRSLNLLLESSILLQELCTVKEERADLKARVYLLEKELHANRLTLESRLAAENALRAHLDALRLSSQETARGPPTPTDEQRDSRVGTGQTEALLRAQVKNLLQALESLRHSSELQQTQNEELVDDLKRANSALIAAFEKAKRKYLTRIKKLEDQ 1519          

HSP 2 Score: 77.0258 bits (188), Expect = 2.725e-10
Identity = 38/64 (59.38%), Postives = 45/64 (70.31%), Query Frame = 3
Query:  138 RLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVL 329
            RLK LF+SCDSNNDG LD  DL  MC ++ M D AEE+IS+LGA     +IS +EFL CR KV 
Sbjct:   23 RLKQLFLSCDSNNDGLLDCYDLYEMCSRLRMEDHAEEVISMLGAREK-ENISLEEFLSCRKKVF 85          

HSP 3 Score: 70.0922 bits (170), Expect = 3.140e-8
Identity = 39/99 (39.39%), Postives = 61/99 (61.62%), Query Frame = 3
Query:  579 NASPS--LSQQLLQCANQIHLSRINRLYSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQELQNQTSRYEDRLTELHSVIAELQKKIERKDRNTI 869
            N SPS  L+++L  C + +H  +  RL SE+     R      + ++  ++  R +++R +L+ EL NQ +RYEDRLTELHSVIAEL++++E    N I
Sbjct:  273 NISPSVELARRLFDCMSLLHSQQTARLRSEVFALSSRIRGLQMNYESSFRDWQRLERERNQLRHELSNQIARYEDRLTELHSVIAELRRRLENAGTNMI 371          

HSP 4 Score: 65.855 bits (159), Expect = 7.746e-7
Identity = 34/96 (35.42%), Postives = 56/96 (58.33%), Query Frame = 3
Query: 1629 LVFLQELSENIPYPALVEPCKRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETD 1916
            +  L  L++ +PYP L E      L W+ ++A   R  +D ++LQ  LAE+KS AD++QC + Q  ++  A  R+ ++AD  +E+ D L QL  T+
Sbjct:  781 ITLLHNLAQRVPYPRLAEAMHCAELTWECVLATLARYRSDCVVLQANLAEAKSHADRIQCQLNQIDANWTATMRAAWMADTSLEIMDCLNQLYATE 876          
BLAST of colorectal mutant cancer protein vs. TrEMBL
Match: A0A158R7L1 (MCC-bdg_PDZ domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4029 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 5.624e-28
Identity = 87/235 (37.02%), Postives = 130/235 (55.32%), Query Frame = 3
Query: 2223 GDWTKADELKLRQLFDQLRLERHRARLSIV-----------------GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQN----LIESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLNQMMQHRT-DFISGTDES---RRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            G WT+  E+KLR + DQ+  ER   R +I                   FH  + Y G  L + ++       +G +P+ D  + + ISN+     ++++A LLQELC++KE+RA LK   Y++EKE ++IQL+       E +L+ QLN +   R    +  +D +     L  Q+E L  A E LR+  + QQ Q+EE VNDLK+ANAALI AF+KAK KY  +I +LE Q++A
Sbjct:  710 GGWTRVKEMKLRHILDQIIWERMLVRSTIAVAVNDFEAGCSGVPRSGEFHYMKPYTGSELPAYSEG----GPMG-MPTQDSRDPV-ISNRLNALLMVDTAALLQELCAVKEDRAKLKVHNYIMEKELRAIQLSHQRHCLLESTLRSQLNALQIDRNLQMLKTSDRTGVQNPLTQQVESLQSAFESLRKGAEHQQSQSEELVNDLKQANAALITAFEKAKSKYLARIRKLESQIAA 938          
BLAST of colorectal mutant cancer protein vs. Ensembl Cavefish
Match: mcc (MCC regulator of WNT signaling pathway [Source:ZFIN;Acc:ZDB-GENE-141210-1])

HSP 1 Score: 85.5001 bits (210), Expect = 1.751e-16
Identity = 114/417 (27.34%), Postives = 195/417 (46.76%), Query Frame = 3
Query: 1755 LLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRSTSSCGDFRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIV---GFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNL-IESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKS-------LKVQLNQMMQHRTDFISGTDES----------------------------------------RRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSA 2852
            LL  TL E KS A+++   + + +S+  AL  +   ++Q IE  ++L+ L E++    GL +        +T    S         +  S     +  H  R+  E+AAK L+ R +   S G     +G  V    S    S    +    +S   D++K DE +L+    QL+ ER   +L+++     H++   Y               D+   P  D        +Q L +E+A+L+QEL ++KEE A LK ++YLLEKE K+++L L ++ A E++       LK ++ +  + R   +  T  S                                        ++LK+++++L+ ALE L +  +V+ +Q+ EFVNDLK+AN+ L+ A++KAKKK+QNK+ +LE Q+ A
Sbjct:  383 LLTITLEECKSNAERMSMLVGKYESNATALRMALQYSEQCIEAYELLLALAESE---QGLVLGQFRAAGVSTMGEQS---------AEESITQVLKRAHDCRKTAENAAKDLLVRLD--GSCGAAFSVTGCSVQPWESLSSNSHTSTTSSTASSCDTDFSKEDEQRLKDYVQQLKNERAAVKLTMLELESVHIDPLSY---------------DVK--PRGD--------SQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTREAQEQAYLVHIEHLKSEVEEQQEQRRRSLGSTGSSGAKDKSGKDTGDSSAVSVSELRSLSDSDLAAELTNALRREKKLKSRVQELVTALERLTKSSEVRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMA 760          
BLAST of colorectal mutant cancer protein vs. Planmine SMEST
Match: SMESG000002794.1 (SMESG000002794.1)

HSP 1 Score: 1723.75 bits (4463), Expect = 0.000e+0
Identity = 954/954 (100.00%), Postives = 954/954 (100.00%), Query Frame = 3
Query:   57 MADLKFRKKXXXXXXXXXXXXXXXXXXRLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVLALNEGECSRKKSAEYLVHSNFXXXXXXXXXXLAGSCSDVSQIYSSVDYDSGTQEIQEEPLNLFAMLQQFYGDLYCQWTASERDNASPSLSQQLLQCANQIHLSRINRLYSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQELQNQTSRYEDRLTELHSVIAELQKKIERKDRNTIMXXXXXXXXXXXXXXXXADYEKLNLRNQSELVKESTPGNTFHQLSCSTSFVESSIFGADKSTAPSEKPMSNVNFVEVQTDIACAMDSRTFNIQKNDRSNEKLQEATEKQLKAFHHNHIFLQEKLSNYENVVCSLRTQLGSVLEERESLRKQLKDLQDCVELNSVPLYXXXXXXXXXXXXXXXXXXXXXXXXPARPIMGVRXXXXXXXXXXXXXXETDWVMKVVTKYQKSLSNPTQSIFINHIIDDSHSILTSGLVFLQELSENIPYPALVEPCKRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRSTSSCGDFRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIVGFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNLIESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLNQMMQHRTDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSANNPGYHQQSLLTNNSTSDETAL 2918
            MADLKFRKKSLTETFSSSTDSSHEEEERLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVLALNEGECSRKKSAEYLVHSNFYNQNYNQYDQLAGSCSDVSQIYSSVDYDSGTQEIQEEPLNLFAMLQQFYGDLYCQWTASERDNASPSLSQQLLQCANQIHLSRINRLYSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQELQNQTSRYEDRLTELHSVIAELQKKIERKDRNTIMEEDEDILNDENEVVDNADYEKLNLRNQSELVKESTPGNTFHQLSCSTSFVESSIFGADKSTAPSEKPMSNVNFVEVQTDIACAMDSRTFNIQKNDRSNEKLQEATEKQLKAFHHNHIFLQEKLSNYENVVCSLRTQLGSVLEERESLRKQLKDLQDCVELNSVPLYSQQSSCSMSKISLDSKSTSSSSSSPARPIMGVRQQQSKQNQIKPQNPETDWVMKVVTKYQKSLSNPTQSIFINHIIDDSHSILTSGLVFLQELSENIPYPALVEPCKRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRSTSSCGDFRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDSGAGVSSTLSSGGGSVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIVGFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNLIESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLNQMMQHRTDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSANNPGYHQQSLLTNNSTSDETAL
Sbjct:    1 MADLKFRKKSLTETFSSSTDSSHEEEERLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVLALNEGECSRKKSAEYLVHSNFYNQNYNQYDQLAGSCSDVSQIYSSVDYDSGTQEIQEEPLNLFAMLQQFYGDLYCQWTASERDNASPSLSQQLLQCANQIHLSRINRLYSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQELQNQTSRYEDRLTELHSVIAELQKKIERKDRNTIMEEDEDILNDENEVVDNADYEKLNLRNQSELVKESTPGNTFHQLSCSTSFVESSIFGADKSTAPSEKPMSNVNFVEVQTDIACAMDSRTFNIQKNDRSNEKLQEATEKQLKAFHHNHIFLQEKLSNYENVVCSLRTQLGSVLEERESLRKQLKDLQDCVELNSVPLYSQQSSCSMSKISLDSKSTSSSSSSPARPIMGVRQQQSKQNQIKPQNPETDWVMKVVTKYQKSLSNPTQSIFINHIIDDSHSILTSGLVFLQELSENIPYPALVEPCKRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRSTSSCGDFRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDSGAGVSSTLSSGGGSVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIVGFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNLIESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLNQMMQHRTDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSANNPGYHQQSLLTNNSTSDETAL 954          
BLAST of colorectal mutant cancer protein vs. Planmine SMEST
Match: SMESG000002794.1 (SMESG000002794.1)

HSP 1 Score: 1717.21 bits (4446), Expect = 0.000e+0
Identity = 949/955 (99.37%), Postives = 950/955 (99.48%), Query Frame = 3
Query:   57 MADLKFRKKXXXXXXXXXXXXXXXXXX-RLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVLALNEGECSRKKSAEYLVHSNFXXXXXXXXXXLAGSCSDVSQIYSSVDYDSGTQEIQEEPLNLFAMLQQFYGDLYCQWTASERDNASPSLSQQLLQCANQIHLSRINRLYSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQELQNQTSRYEDRLTELHSVIAELQKKIERKDRNTIMXXXXXXXXXXXXXXXXADYEKLNLRNQSELVKESTPGNTFHQLSCSTSFVESSIFGADKSTAPSEKPMSNVNFVEVQTDIACAMDSRTFNIQKNDRSNEKLQEATEKQLKAFHHNHIFLQEKLSNYENVVCSLRTQLGSVLEERESLRKQLKDLQDCVELNSVPLYXXXXXXXXXXXXXXXXXXXXXXXXPARPIMGVRXXXXXXXXXXXXXXETDWVMKVVTKYQKSLSNPTQSIFINHIIDDSHSILTSGLVFLQELSENIPYPALVEPCKRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRSTSSCGDFRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDXXXXXXXXXXXXXXXVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIVGFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNLIESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLNQMMQHRTDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSANNPGYHQQSLLTNNSTSDETAL 2918
            MADLKFRKKSLTETFSSS+  S  EEE RLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVLALNEGECSRKKSAEYLVHSNFYNQNYNQYDQLAGSCSDVSQIYSSVDYDSGTQEIQEEPLNLFAMLQQFYGDLYCQWTASERDNASPSLSQQLLQCANQIHLSRINRLYSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQELQNQTSRYEDRLTELHSVIAELQKKIERKDRNTIMEEDEDILNDENEVVDNADYEKLNLRNQSELVKESTPGNTFHQLSCSTSFVESSIFGADKSTAPSEKPMSNVNFVEVQTDIACAMDSRTFNIQKNDRSNEKLQEATEKQLKAFHHNHIFLQEKLSNYENVVCSLRTQLGSVLEERESLRKQLKDLQDCVELNSVPLYSQQSSCSMSKISLDSKSTSSSSSSPARPIMGVRQQQSKQNQIKPQNPETDWVMKVVTKYQKSLSNPTQSIFINHIIDDSHSILTSGLVFLQELSENIPYPALVEPCKRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRSTSSCGDFRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDSGAGVSSTLSSGGGSVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIVGFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNLIESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLNQMMQHRTDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSANNPGYHQQSLLTNNSTSDETAL
Sbjct:    1 MADLKFRKKSLTETFSSSSTDSSHEEEERLKMLFMSCDSNNDGRLDKKDLIMMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVLALNEGECSRKKSAEYLVHSNFYNQNYNQYDQLAGSCSDVSQIYSSVDYDSGTQEIQEEPLNLFAMLQQFYGDLYCQWTASERDNASPSLSQQLLQCANQIHLSRINRLYSELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQELQNQTSRYEDRLTELHSVIAELQKKIERKDRNTIMEEDEDILNDENEVVDNADYEKLNLRNQSELVKESTPGNTFHQLSCSTSFVESSIFGADKSTAPSEKPMSNVNFVEVQTDIACAMDSRTFNIQKNDRSNEKLQEATEKQLKAFHHNHIFLQEKLSNYENVVCSLRTQLGSVLEERESLRKQLKDLQDCVELNSVPLYSQQSSCSMSKISLDSKSTSSSSSSPARPIMGVRQQQSKQNQIKPQNPETDWVMKVVTKYQKSLSNPTQSIFINHIIDDSHSILTSGLVFLQELSENIPYPALVEPCKRISLEWQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSNFLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEKPRSTSSCGDFRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDSGAGVSSTLSSGGGSVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLSIVGFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNLIESAILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLNQMMQHRTDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVNDLKKANAALILAFDKAKKKYQNKISRLEGQLSANNPGYHQQSLLTNNSTSDETAL 955          
The following BLAST results are available for this feature:
BLAST of colorectal mutant cancer protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCC3.237e-2431.11MCC regulator of WNT signaling pathway [Source:HGN... [more]
MCC1.793e-1525.72MCC regulator of WNT signaling pathway [Source:HGN... [more]
MCC2.095e-1525.72MCC regulator of WNT signaling pathway [Source:HGN... [more]
MCC2.751e-731.78MCC regulator of WNT signaling pathway [Source:HGN... [more]
MCC1.023e-625.16MCC regulator of WNT signaling pathway [Source:HGN... [more]
back to top
BLAST of colorectal mutant cancer protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of colorectal mutant cancer protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of colorectal mutant cancer protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mcc9.931e-1726.97MCC regulator of WNT signaling pathway [Source:ZFI... [more]
back to top
BLAST of colorectal mutant cancer protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcc2.481e-1625.68mutated in colorectal cancers [Source:NCBI gene;Ac... [more]
mcc2.777e-1625.68mutated in colorectal cancers [Source:NCBI gene;Ac... [more]
mcc1.303e-1526.37mutated in colorectal cancers [Source:NCBI gene;Ac... [more]
mcc1.870e-1526.37mutated in colorectal cancers [Source:NCBI gene;Ac... [more]
mcc5.272e-1526.12mutated in colorectal cancers [Source:NCBI gene;Ac... [more]
back to top
BLAST of colorectal mutant cancer protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mcc4.905e-2130.12mutated in colorectal cancers [Source:MGI Symbol;A... [more]
Mcc1.103e-1525.56mutated in colorectal cancers [Source:MGI Symbol;A... [more]
back to top
BLAST of colorectal mutant cancer protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P23508|CRCM_HUMAN1.006e-1425.72Colorectal mutant cancer protein OS=Homo sapiens O... [more]
back to top
BLAST of colorectal mutant cancer protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183NFG52.528e-3132.36Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A183QQ543.297e-3029.94Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A210PMY78.283e-2936.51Colorectal mutant cancer protein OS=Mizuhopecten y... [more]
A0A4E0RQM51.959e-2841.67Colorectal mutant cancer protein OS=Fasciola hepat... [more]
A0A158R7L15.624e-2837.02MCC-bdg_PDZ domain-containing protein OS=Taenia as... [more]
back to top
BLAST of colorectal mutant cancer protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mcc1.751e-1627.34MCC regulator of WNT signaling pathway [Source:ZFI... [more]
back to top
BLAST of colorectal mutant cancer protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of colorectal mutant cancer protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of colorectal mutant cancer protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of colorectal mutant cancer protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of colorectal mutant cancer protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000002794.10.000e+0100.00SMESG000002794.1[more]
SMESG000002794.10.000e+099.37SMESG000002794.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006736 ID=SMED30006736|Name=colorectal mutant cancer protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3265bp
AACAGCCAACAGTTGAATTGTTTATTTTTTATCCAAATCTTATGGGAATT
ATCTGAATGGCTGATTTAAAGTTTCGAAAGAAAAGTTTAACAGAAACTTT
TTCAAGCAGTACTGACAGCAGTCATGAAGAAGAAGAACGATTAAAAATGT
TATTTATGAGTTGCGATTCAAATAATGATGGTAGACTGGATAAAAAAGAC
CTAATAATGATGTGCCGAAAAATGAATATGCTAGATTTGGCAGAGGAGAT
CATTTCCGTCTTAGGTGCAAATTCTAATGGAAGCTCAATTTCGTTTCAAG
AGTTTCTAAAATGCCGCGCGAAAGTATTAGCTCTCAATGAGGGTGAATGT
TCACGTAAAAAGAGTGCAGAGTATTTAGTGCACTCGAATTTTTACAACCA
AAATTACAATCAATACGATCAATTAGCCGGCTCGTGTAGTGACGTCAGTC
AGATCTATTCAAGCGTTGATTACGATTCCGGCACTCAAGAAATACAAGAG
GAACCCTTGAATTTATTTGCAATGCTGCAACAATTTTATGGAGATCTTTA
TTGCCAATGGACTGCATCGGAAAGAGACAATGCTTCACCGAGCTTGTCTC
AACAATTGTTGCAATGTGCCAATCAAATCCATCTTTCTAGAATTAATCGT
CTTTATTCTGAATTGAAGTTCGCAATAAAACGTTTCAATAATTGTCATGC
TAGTCAAGATAACTACCAGAAAGAAATCACACGGCATCAAAAAGACCGAG
AGAGATTGAAACAGGAATTACAAAACCAAACTTCTCGGTATGAAGATCGA
CTGACAGAATTGCACAGTGTTATTGCAGAGTTGCAGAAAAAAATCGAAAG
GAAAGATCGAAATACGATAATGGAAGAAGACGAAGATATTCTGAATGATG
AAAATGAAGTGGTTGATAATGCAGACTATGAAAAGTTAAATCTGAGAAAT
CAAAGTGAACTCGTTAAAGAATCCACTCCTGGGAACACATTTCACCAATT
GAGTTGTTCGACGTCTTTTGTGGAAAGCAGTATTTTTGGGGCCGATAAGA
GCACGGCGCCATCTGAAAAACCGATGTCAAATGTCAATTTCGTCGAAGTA
CAGACCGATATTGCCTGCGCAATGGATAGCCGCACTTTCAACATTCAGAA
AAACGATCGGTCCAACGAAAAACTGCAGGAAGCTACTGAGAAACAGTTGA
AAGCTTTTCATCACAACCACATTTTTCTCCAAGAAAAGCTGTCAAATTAT
GAAAATGTCGTCTGCAGCTTGCGTACTCAGTTGGGTAGTGTACTGGAAGA
ACGAGAATCTCTGAGAAAGCAACTGAAAGATTTACAAGACTGTGTTGAAC
TCAACAGTGTCCCATTATACTCTCAACAATCTTCGTGTTCCATGTCAAAA
ATCTCTCTGGATTCGAAATCAACAAGTAGCTCATCCTCGTCTCCAGCCAG
GCCGATAATGGGAGTAAGGCAGCAACAGTCTAAGCAGAACCAAATAAAAC
CTCAGAACCCTGAAACAGACTGGGTAATGAAGGTAGTCACAAAATATCAA
AAAAGCCTCAGCAACCCAACTCAGAGTATCTTCATAAATCACATAATTGA
TGATTCGCATTCAATTCTGACAAGCGGTCTCGTATTCCTGCAAGAATTAT
CAGAGAATATTCCTTACCCAGCCTTAGTAGAGCCTTGCAAACGGATAAGC
CTTGAATGGCAACGATTAGTTGCCAACTCAGATAGAGAATCAGCAGACAA
ACTATTGTTACAGACAACTCTAGCAGAAAGCAAGTCAATAGCTGATCAGC
TGCAGTGCTCCATTGTCCAATCGCAGTCCGACTGTGCTGCTCTTGCCAGA
TCTAACTTTCTAGCGGATCAGATCATCGAGTTGGCAGACATTTTGATACA
ACTGCAAGAAACCGATCCACTAGGCAGCGGTCTCGATATAACTCATCAAT
CTCTTTGCCATGAGGCAACCTACGAGAATAATTCACTGATTATGTCCAAT
GAAAAGCCTCGTTCGACTAGTTCCTGTGGAGATTTTAGACAACTGCGTCA
CGGATTCCGAGAACAAATTGAGTCAGCCGCCAAGTTGTTGATCTATCGAT
TTGAGTGTTACAGCTCAATGGGAAGACAAACTCCAGACAGTGGAGCAGGT
GTCAGTAGCACATTGAGCAGTGGAGGAGGCAGCGTTGACGTAGAAAGCGT
TATGCGGCAAGCTTCGAGCACTGGGGATTGGACCAAGGCAGATGAATTGA
AATTAAGACAATTATTCGACCAGTTACGATTAGAAAGGCACAGAGCTCGT
TTATCTATAGTTGGCTTCCATTTAAATCAATCGTATTACGGCCAATGCCT
TAGTTCATCAAATCAGTCTTCGCTCCATCGAAATGATATCGGAAAGTTGC
CTTCAAACGATTTTGAAAACCAAATTTCCATATCCAATCAAAACTTAATA
GAAAGCGCAATTCTTTTACAGGAACTTTGTAGCCTGAAAGAAGAAAGAGC
GAATTTGAAAACCCGCATTTATTTGCTGGAAAAAGAAGCTAAATCTATTC
AGTTGGCGTTGGACAGCAAATCGGCCTGTGAAAAGTCATTAAAGGTCCAA
CTGAATCAAATGATGCAGCACAGGACGGATTTCATATCAGGAACAGATGA
AAGTCGGCGCCTAAAAGCCCAAATTGAAGATCTACTTCAAGCACTCGAAG
AATTGAGGGAACGCTGCCAGGTCCAACAACGTCAAAATGAAGAGTTTGTC
AACGATCTGAAAAAGGCAAACGCAGCACTAATATTAGCATTTGATAAAGC
AAAGAAAAAGTATCAAAATAAAATCTCGAGGCTGGAAGGCCAGTTGTCGG
CCAACAATCCAGGATATCACCAGCAGTCCTTACTCACAAACAATTCAACA
TCAGACGAAACAGCATTGTGAACCAATTCGGTGTTGTCCAGAAATATCTA
TGTACATATATATATCTATAAAACTGATTTGACTGAATTTATCTCTAGAT
TATTAATATTACTGCAACTGACTCCTCATTTCTTGTATAAATTGTCTCAT
TTTTATCATATTTTTCAAAGAAAATTTCCCCTAAATCCCAAAATTGATAT
CGAATAAACATTTACCGAAACAACGCCGGCAACTCAGCTGATTTCATTAA
TTTTTTTGTCAATGGCAAACAAGCTGAGAGATGATGGGAAAGATACAATG
GAATAGGATTGCAGAAATATGGACGACTTCCCCATTGGTAACGTCGGTCC
GTTGGGAATTCCGGT
back to top

protein sequence of SMED30006736-orf-1

>SMED30006736-orf-1 ID=SMED30006736-orf-1|Name=SMED30006736-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=955bp
MADLKFRKKSLTETFSSSTDSSHEEEERLKMLFMSCDSNNDGRLDKKDLI
MMCRKMNMLDLAEEIISVLGANSNGSSISFQEFLKCRAKVLALNEGECSR
KKSAEYLVHSNFYNQNYNQYDQLAGSCSDVSQIYSSVDYDSGTQEIQEEP
LNLFAMLQQFYGDLYCQWTASERDNASPSLSQQLLQCANQIHLSRINRLY
SELKFAIKRFNNCHASQDNYQKEITRHQKDRERLKQELQNQTSRYEDRLT
ELHSVIAELQKKIERKDRNTIMEEDEDILNDENEVVDNADYEKLNLRNQS
ELVKESTPGNTFHQLSCSTSFVESSIFGADKSTAPSEKPMSNVNFVEVQT
DIACAMDSRTFNIQKNDRSNEKLQEATEKQLKAFHHNHIFLQEKLSNYEN
VVCSLRTQLGSVLEERESLRKQLKDLQDCVELNSVPLYSQQSSCSMSKIS
LDSKSTSSSSSSPARPIMGVRQQQSKQNQIKPQNPETDWVMKVVTKYQKS
LSNPTQSIFINHIIDDSHSILTSGLVFLQELSENIPYPALVEPCKRISLE
WQRLVANSDRESADKLLLQTTLAESKSIADQLQCSIVQSQSDCAALARSN
FLADQIIELADILIQLQETDPLGSGLDITHQSLCHEATYENNSLIMSNEK
PRSTSSCGDFRQLRHGFREQIESAAKLLIYRFECYSSMGRQTPDSGAGVS
STLSSGGGSVDVESVMRQASSTGDWTKADELKLRQLFDQLRLERHRARLS
IVGFHLNQSYYGQCLSSSNQSSLHRNDIGKLPSNDFENQISISNQNLIES
AILLQELCSLKEERANLKTRIYLLEKEAKSIQLALDSKSACEKSLKVQLN
QMMQHRTDFISGTDESRRLKAQIEDLLQALEELRERCQVQQRQNEEFVND
LKKANAALILAFDKAKKKYQNKISRLEGQLSANNPGYHQQSLLTNNSTSD
ETAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR040171USBP1-like
IPR002048EF_hand_dom
IPR019536USH1C-bd_PDZ_domain
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 217..276
NoneNo IPR availableCOILSCoilCoilcoord: 409..429
NoneNo IPR availableCOILSCoilCoilcoord: 863..907
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 3..149
e-value: 7.7E-10
score: 40.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 449..484
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 934..954
NoneNo IPR availablePANTHERPTHR23347:SF6FI17904P1coord: 9..932
IPR002048EF-hand domainSMARTSM00054efh_1coord: 28..56
e-value: 0.01
score: 25.0
coord: 61..90
e-value: 44.0
score: 4.5
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 24..59
score: 11.919
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 62..93
score: 5.587
IPR002048EF-hand domainCDDcd00051EFhcoord: 28..85
e-value: 4.65025E-6
score: 42.9201
IPR019536Usher syndrome type-1C protein-binding protein 1, PDZ domainPFAMPF10506MCC-bdg_PDZcoord: 868..932
e-value: 1.1E-9
score: 38.2
IPR040171Usher syndrome type-1C protein-binding protein 1-likePANTHERPTHR23347COLORECTAL MUTANT CANCER PROTEIN MCC PROTEIN -RELATEDcoord: 9..932
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 37..49
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 22..93