BZIP domain-containing protein

Overview
NameBZIP domain-containing protein
Smed IDSMED30006731
Length (bp)1476
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BZIP domain-containing protein (SMED30006731) t-SNE clustered cells

Violin plots show distribution of expression levels for BZIP domain-containing protein (SMED30006731) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BZIP domain-containing protein (SMED30006731) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BZIP domain-containing protein (SMED30006731) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006731

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30006731SMESG000008447.1 SMESG000008431.1 dd_Smed_v4_5875_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006731SMESG000008447.1 SMESG000008431.1 SMED30006731smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30006731SMESG000008447.1 SMESG000008431.1 SMED30006731smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30006731SMESG000008447.1 SMESG000008431.1 SMED30006731smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BZIP domain-containing protein vs. Planmine SMEST
Match: SMESG000008431.1 (SMESG000008431.1)

HSP 1 Score: 416.001 bits (1068), Expect = 7.268e-145
Identity = 263/263 (100.00%), Postives = 263/263 (100.00%), Query Frame = 1
Query:  127 MRNSEDTEGKVHCMASENIENKSQLRPNSLSIAPSNNGTYPICSTSSLFKEFFSPLGNVILASPNIMDLLSPRTILNSNNLTNEQLQVDKIFTEKYKEIKAQNLKDEKIFSTSCNESTILVVSQNALDQLSGAFAVTNQSLKSMVDEXXXXXXXXXXXXXXCHDQNYIPNXXXXXXXXXXXXXXNCSGNDKLXXXXXXXXXXXXXXXXXXXERKLQLMKKLEKEVQVLTQQKGNLENKAQNQKKQIENLKAVIVQHLKSGCKM 915
            MRNSEDTEGKVHCMASENIENKSQLRPNSLSIAPSNNGTYPICSTSSLFKEFFSPLGNVILASPNIMDLLSPRTILNSNNLTNEQLQVDKIFTEKYKEIKAQNLKDEKIFSTSCNESTILVVSQNALDQLSGAFAVTNQSLKSMVDENNLVSLSTSSLSNTCHDQNYIPNAPSSASSVEVPTSSNCSGNDKLKIKIDKKRARNRDAARKCRERKLQLMKKLEKEVQVLTQQKGNLENKAQNQKKQIENLKAVIVQHLKSGCKM
Sbjct:    1 MRNSEDTEGKVHCMASENIENKSQLRPNSLSIAPSNNGTYPICSTSSLFKEFFSPLGNVILASPNIMDLLSPRTILNSNNLTNEQLQVDKIFTEKYKEIKAQNLKDEKIFSTSCNESTILVVSQNALDQLSGAFAVTNQSLKSMVDENNLVSLSTSSLSNTCHDQNYIPNAPSSASSVEVPTSSNCSGNDKLKIKIDKKRARNRDAARKCRERKLQLMKKLEKEVQVLTQQKGNLENKAQNQKKQIENLKAVIVQHLKSGCKM 263          
BLAST of BZIP domain-containing protein vs. Planmine SMEST
Match: SMESG000008447.1 (SMESG000008447.1)

HSP 1 Score: 414.461 bits (1064), Expect = 3.310e-144
Identity = 262/263 (99.62%), Postives = 263/263 (100.00%), Query Frame = 1
Query:  127 MRNSEDTEGKVHCMASENIENKSQLRPNSLSIAPSNNGTYPICSTSSLFKEFFSPLGNVILASPNIMDLLSPRTILNSNNLTNEQLQVDKIFTEKYKEIKAQNLKDEKIFSTSCNESTILVVSQNALDQLSGAFAVTNQSLKSMVDEXXXXXXXXXXXXXXCHDQNYIPNXXXXXXXXXXXXXXNCSGNDKLXXXXXXXXXXXXXXXXXXXERKLQLMKKLEKEVQVLTQQKGNLENKAQNQKKQIENLKAVIVQHLKSGCKM 915
            MRNSEDTEGKVHCMASENIENKSQLRPNSLSIAPSNNGTYPICSTSSLFKEFFSPLGNVILASPNIMDLLSPRTILNSNNLTNEQLQVDKIFTEKYKEIKAQNLKDEKIFSTSCNESTILVVSQNALDQLSGAFAVTNQSLKSMVDENNLVSLSTSSLSNTCHDQNYIPNAPSSASSVEVPTSSNCSGNDKLKIKIDKKRARNRDAARKCRERKLQLMKKLEKEVQVLTQQKGNLENKAQ+QKKQIENLKAVIVQHLKSGCKM
Sbjct:    1 MRNSEDTEGKVHCMASENIENKSQLRPNSLSIAPSNNGTYPICSTSSLFKEFFSPLGNVILASPNIMDLLSPRTILNSNNLTNEQLQVDKIFTEKYKEIKAQNLKDEKIFSTSCNESTILVVSQNALDQLSGAFAVTNQSLKSMVDENNLVSLSTSSLSNTCHDQNYIPNAPSSASSVEVPTSSNCSGNDKLKIKIDKKRARNRDAARKCRERKLQLMKKLEKEVQVLTQQKGNLENKAQHQKKQIENLKAVIVQHLKSGCKM 263          
The following BLAST results are available for this feature:
BLAST of BZIP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BZIP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BZIP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BZIP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BZIP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BZIP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BZIP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BZIP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BZIP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BZIP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BZIP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BZIP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BZIP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BZIP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000008431.17.268e-145100.00SMESG000008431.1[more]
SMESG000008447.13.310e-14499.62SMESG000008447.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006731 ID=SMED30006731|Name=BZIP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1476bp
AAATTATTTCAAGGTCGATTTGACAGTTAGTATGTCCAATCAAAACTTAA
CGATGACTAATTAGTTTCGCTTTTAGTAAACAACGTACCTGATCAAATAT
TTATATAAACTAAAACATTTTAATAAATGAGAAATTCAGAAGATACAGAA
GGAAAAGTTCACTGTATGGCATCTGAAAATATTGAAAATAAATCTCAACT
GAGGCCTAATTCATTGAGTATTGCTCCTTCTAATAATGGAACATATCCAA
TTTGTAGCACTTCGTCGTTATTCAAAGAATTTTTTTCTCCTTTGGGAAAT
GTTATTTTGGCTTCACCAAATATAATGGATTTATTGTCACCTCGTACAAT
TTTAAATTCAAATAATTTAACAAATGAACAACTGCAAGTTGACAAAATAT
TTACAGAAAAATATAAAGAAATCAAAGCTCAGAATTTAAAAGACGAAAAG
ATTTTTTCTACCTCTTGTAATGAATCAACAATTTTAGTTGTATCTCAAAA
TGCTTTAGACCAATTAAGTGGAGCATTTGCAGTAACAAATCAAAGTTTAA
AATCTATGGTTGATGAAAACAATCTCGTGTCATTGTCAACTTCGAGTTTA
TCAAATACTTGCCATGATCAAAATTACATCCCGAACGCACCTTCATCAGC
AAGTAGTGTTGAAGTACCGACTTCTTCTAATTGTTCGGGAAACGATAAAT
TAAAAATCAAAATCGATAAGAAACGAGCAAGAAATCGTGATGCTGCCAGA
AAGTGCCGCGAACGCAAATTGCAATTAATGAAAAAACTCGAGAAAGAAGT
TCAGGTGTTAACACAACAAAAGGGTAATCTAGAAAATAAAGCTCAAAATC
AAAAGAAACAAATTGAAAATTTAAAAGCAGTTATCGTTCAACATCTGAAA
AGTGGGTGCAAAATGTGAATTATTATTCCAGATTTAAATGCCAATTTTAT
TGTAAGTTGTTAGAAATAATTGCAAATTGTGCAATTGTAAATTTCAACTT
AGGTTTTATGAAGATTGCTGAGTTTTTTGATATTTTATGTACTTCATTTG
TGATATAATTAATTTGTAAAGAATGATAAAGCTATTTTTAAACAATATTA
ATTACATTTCAAGAATTTTTAAACTAATTATTTTTAATCAGATTATTGTA
TCTTTATTGTCTTCTATTTTGAAAGCAATATATGAAAATTTAAGCAAACT
GTAATTCGAGTTTTTGTATGTTTATCTTGTAATTGGTTTTGATTTATAGT
TCTATATAAAAATAGTAATGTTTGGTTGGATTTGATAAGTACAACACAAA
TGTGATATATGTGAATAGAAATGGCAATCAGAGATCATTGTATTCTTTCT
TTCAAAGCTCTTAAGATAATTATTGGTGTGATTTTCGTATTACCGGGATG
TCTGTCGATATTGTAGGAGAAAGCACAGAATTTATGGATTTAAAAAAATA
TTTAATCAAATGGATAAAAGCATCGG
back to top

protein sequence of SMED30006731-orf-1

>SMED30006731-orf-1 ID=SMED30006731-orf-1|Name=SMED30006731-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=264bp
MRNSEDTEGKVHCMASENIENKSQLRPNSLSIAPSNNGTYPICSTSSLFK
EFFSPLGNVILASPNIMDLLSPRTILNSNNLTNEQLQVDKIFTEKYKEIK
AQNLKDEKIFSTSCNESTILVVSQNALDQLSGAFAVTNQSLKSMVDENNL
VSLSTSSLSNTCHDQNYIPNAPSSASSVEVPTSSNCSGNDKLKIKIDKKR
ARNRDAARKCRERKLQLMKKLEKEVQVLTQQKGNLENKAQNQKKQIENLK
AVIVQHLKSGCKM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000140anterior region of the whole animal
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR002112Leuzip_Jun
IPR004827bZIP
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 189..209
NoneNo IPR availableCOILSCoilCoilcoord: 211..252
NoneNo IPR availableGENE3DG3DSA:1.20.5.170coord: 195..256
e-value: 8.2E-13
score: 50.4
NoneNo IPR availablePANTHERPTHR11462JUN TRANSCRIPTION FACTOR-RELATEDcoord: 16..262
NoneNo IPR availablePANTHERPTHR11462:SF35TRANSCRIPTION FACTOR AP-1coord: 16..262
NoneNo IPR availableSUPERFAMILYSSF57959Leucine zipper domaincoord: 196..251
IPR002112Transcription factor JunPRINTSPR00043LEUZIPPRJUNcoord: 180..200
score: 29.41
coord: 220..232
score: 37.56
coord: 235..249
score: 26.27
coord: 202..218
score: 64.36
coord: 249..263
score: 35.66
IPR004827Basic-leucine zipper domainSMARTSM00338brlzneucoord: 191..255
e-value: 2.5E-9
score: 47.0
IPR004827Basic-leucine zipper domainPFAMPF00170bZIP_1coord: 193..251
e-value: 2.6E-10
score: 40.2
IPR004827Basic-leucine zipper domainPROSITEPS00036BZIP_BASICcoord: 198..213
IPR004827Basic-leucine zipper domainPROSITEPS50217BZIPcoord: 193..256
score: 11.346