Proteasomal ubiquitin receptor ADRM1

Overview
NameProteasomal ubiquitin receptor ADRM1
Smed IDSMED30006727
Length (bp)1174
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Proteasomal ubiquitin receptor ADRM1 (SMED30006727) t-SNE clustered cells

Violin plots show distribution of expression levels for Proteasomal ubiquitin receptor ADRM1 (SMED30006727) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Proteasomal ubiquitin receptor ADRM1 (SMED30006727) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Proteasomal ubiquitin receptor ADRM1 (SMED30006727) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006727

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30006727SMESG000020635.1 SmedASXL_010402SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
medial muscle cellSMED30006727SMESG000020635.1 dd_Smed_v4_10122_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30006727SMESG000020635.1 Contig3869_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30006727SMESG000020635.1 Contig3869_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30006727SMESG000020635.1 Contig3869_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Human
Match: ADRM1 (adhesion regulating molecule 1 [Source:HGNC Symbol;Acc:HGNC:15759])

HSP 1 Score: 159.844 bits (403), Expect = 2.408e-44
Identity = 80/153 (52.29%), Postives = 104/153 (67.97%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN--PKAKSSPTAGSKVVNMNDLTELLGELNEIGALNDIDLLELL 576
            K L+EFRAGKM + +   V PDKRKGLV+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+PQC +GRV++LKFK  SK++F WMQEPK D D E C KVNE LN  P   +   +GS    ++ L    G  + +G ++   L++L+
Sbjct:   21 KYLVEFRAGKMSL-KGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLI 172          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Human
Match: ADRM1 (adhesion regulating molecule 1 [Source:HGNC Symbol;Acc:HGNC:15759])

HSP 1 Score: 159.844 bits (403), Expect = 2.408e-44
Identity = 80/153 (52.29%), Postives = 104/153 (67.97%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN--PKAKSSPTAGSKVVNMNDLTELLGELNEIGALNDIDLLELL 576
            K L+EFRAGKM + +   V PDKRKGLV+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+PQC +GRV++LKFK  SK++F WMQEPK D D E C KVNE LN  P   +   +GS    ++ L    G  + +G ++   L++L+
Sbjct:   21 KYLVEFRAGKMSL-KGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLI 172          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Human
Match: ADRM1 (adhesion regulating molecule 1 [Source:HGNC Symbol;Acc:HGNC:15759])

HSP 1 Score: 82.0333 bits (201), Expect = 2.828e-18
Identity = 55/153 (35.95%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDSKKVFLWMQEPKEDNDVELCMKVNELLN--PKAKSSPTAGSKVVNMNDLTELLGELNEIGALNDIDLLELLA 579
            K L+EFRAGKM + +   V PDKRKGLV+I QT D L HFCWKDR +G VED                                      EPK D D E C KVNE LN  P   +   +GS    ++ L    G  + +G ++   L++L+ 
Sbjct:   21 KYLVEFRAGKMSL-KGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVED--------------------------------------EPKTDQDEEHCRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIG 134          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Human
Match: ADRM1 (adhesion regulating molecule 1 [Source:HGNC Symbol;Acc:HGNC:15759])

HSP 1 Score: 82.8037 bits (203), Expect = 8.365e-17
Identity = 55/152 (36.18%), Postives = 71/152 (46.71%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDSKKVFLWMQEPKEDNDVELCMKVNELLN--PKAKSSPTAGSKVVNMNDLTELLGELNEIGALNDIDLLELL 576
            K L+EFRAGKM + +   V PDKRKGLV+I QT D L HFCWKDR +G VED                                      EPK D D E C KVNE LN  P   +   +GS    ++ L    G  + +G ++   L++L+
Sbjct:   21 KYLVEFRAGKMSL-KGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVED--------------------------------------EPKTDQDEEHCRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLI 133          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Celegans
Match: rpn-13 (Proteasomal ubiquitin receptor ADRM1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q09289])

HSP 1 Score: 114.775 bits (286), Expect = 1.942e-28
Identity = 57/156 (36.54%), Postives = 88/156 (56.41%), Query Frame = 1
Query:  130 NLMEFRAGKMKMNEDNW-----VYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDSKKVFLWMQEPKEDNDVELCMKVNELLNPKAKSSP---------------TAGSKVVNMNDLTELLGELNE 537
            +++EF+AG+ ++   +      V  + +KGLVFI Q++D L HFCWKDR TG V DDL+IFPD+  FK +P C  G+V++LKFK       W+Q+   D D +L  KV + LN    S P               +AG  +++ +D+   LG +++
Sbjct:   17 HIVEFKAGRSRLEAGSGDTMRKVVAEPKKGLVFIKQSNDMLIHFCWKDRETGAVVDDLIIFPDDAEFKAVPGCPDGKVYMLKFKSGDMKLFWIQDSTPDVDKDLVKKVTDALNKPPTSRPAASRSAGSNANTDRQSAGGSLISSSDMNAPLGGIDQ 172          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Celegans
Match: rpn-13 (Proteasomal ubiquitin receptor ADRM1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q09289])

HSP 1 Score: 114.775 bits (286), Expect = 3.589e-28
Identity = 57/156 (36.54%), Postives = 88/156 (56.41%), Query Frame = 1
Query:  130 NLMEFRAGKMKMNEDNW-----VYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDSKKVFLWMQEPKEDNDVELCMKVNELLNPKAKSSP---------------TAGSKVVNMNDLTELLGELNE 537
            +++EF+AG+ ++   +      V  + +KGLVFI Q++D L HFCWKDR TG V DDL+IFPD+  FK +P C  G+V++LKFK       W+Q+   D D +L  KV + LN    S P               +AG  +++ +D+   LG +++
Sbjct:   17 HIVEFKAGRSRLEAGSGDTMRKVVAEPKKGLVFIKQSNDMLIHFCWKDRETGAVVDDLIIFPDDAEFKAVPGCPDGKVYMLKFKSGDMKLFWIQDSTPDVDKDLVKKVTDALNKPPTSRPAASRSAGSNANTDRQSAGGSLISSSDMNAPLGGIDQ 172          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Fly
Match: Rpn13 (gene:FBgn0033886 transcript:FBtr0087611)

HSP 1 Score: 155.606 bits (392), Expect = 3.183e-43
Identity = 76/153 (49.67%), Postives = 103/153 (67.32%), Query Frame = 1
Query:  136 MEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDS-KKVFLWMQEPKEDNDVELCMKVNELLN--PKAKSSPTAGSK-------VVNMN--DLTELLGELNEIGALNDI 558
            +EFRAG+M M     V+PD RKGLV++ Q+ DGL HFCWKDR +GKVEDDL++FPD+  +KR+ QC TGRV++LKFK S +++F WMQEPK D D E C ++NELLN  P A      GS        + NM+   L +L G + ++G L+ +
Sbjct:   18 VEFRAGRMNM-VGKMVHPDPRKGLVYMTQSDDGLMHFCWKDRTSGKVEDDLIVFPDDFEYKRVDQCKTGRVYVLKFKSSTRRMFFWMQEPKTDKDDEQCRRINELLNNPPSAHQRGGGGSNDGDLQYMLNNMSQQQLMQLFGGVGQMGGLSSL 169          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Fly
Match: Rpn13 (gene:FBgn0033886 transcript:FBtr0114495)

HSP 1 Score: 155.606 bits (392), Expect = 3.183e-43
Identity = 76/153 (49.67%), Postives = 103/153 (67.32%), Query Frame = 1
Query:  136 MEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDS-KKVFLWMQEPKEDNDVELCMKVNELLN--PKAKSSPTAGSK-------VVNMN--DLTELLGELNEIGALNDI 558
            +EFRAG+M M     V+PD RKGLV++ Q+ DGL HFCWKDR +GKVEDDL++FPD+  +KR+ QC TGRV++LKFK S +++F WMQEPK D D E C ++NELLN  P A      GS        + NM+   L +L G + ++G L+ +
Sbjct:   18 VEFRAGRMNM-VGKMVHPDPRKGLVYMTQSDDGLMHFCWKDRTSGKVEDDLIVFPDDFEYKRVDQCKTGRVYVLKFKSSTRRMFFWMQEPKTDKDDEQCRRINELLNNPPSAHQRGGGGSNDGDLQYMLNNMSQQQLMQLFGGVGQMGGLSSL 169          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Fly
Match: Rpn13 (gene:FBgn0033886 transcript:FBtr0087610)

HSP 1 Score: 155.606 bits (392), Expect = 3.183e-43
Identity = 76/153 (49.67%), Postives = 103/153 (67.32%), Query Frame = 1
Query:  136 MEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDS-KKVFLWMQEPKEDNDVELCMKVNELLN--PKAKSSPTAGSK-------VVNMN--DLTELLGELNEIGALNDI 558
            +EFRAG+M M     V+PD RKGLV++ Q+ DGL HFCWKDR +GKVEDDL++FPD+  +KR+ QC TGRV++LKFK S +++F WMQEPK D D E C ++NELLN  P A      GS        + NM+   L +L G + ++G L+ +
Sbjct:   18 VEFRAGRMNM-VGKMVHPDPRKGLVYMTQSDDGLMHFCWKDRTSGKVEDDLIVFPDDFEYKRVDQCKTGRVYVLKFKSSTRRMFFWMQEPKTDKDDEQCRRINELLNNPPSAHQRGGGGSNDGDLQYMLNNMSQQQLMQLFGGVGQMGGLSSL 169          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Fly
Match: Rpn13 (gene:FBgn0033886 transcript:FBtr0114494)

HSP 1 Score: 155.221 bits (391), Expect = 8.226e-43
Identity = 76/153 (49.67%), Postives = 103/153 (67.32%), Query Frame = 1
Query:  136 MEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDS-KKVFLWMQEPKEDNDVELCMKVNELLN--PKAKSSPTAGSK-------VVNMN--DLTELLGELNEIGALNDI 558
            +EFRAG+M M     V+PD RKGLV++ Q+ DGL HFCWKDR +GKVEDDL++FPD+  +KR+ QC TGRV++LKFK S +++F WMQEPK D D E C ++NELLN  P A      GS        + NM+   L +L G + ++G L+ +
Sbjct:   18 VEFRAGRMNM-VGKMVHPDPRKGLVYMTQSDDGLMHFCWKDRTSGKVEDDLIVFPDDFEYKRVDQCKTGRVYVLKFKSSTRRMFFWMQEPKTDKDDEQCRRINELLNNPPSAHQRGGGGSNDGDLQYMLNNMSQQQLMQLFGGVGQMGGLSSL 169          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Fly
Match: Rpn13 (gene:FBgn0033886 transcript:FBtr0114493)

HSP 1 Score: 155.221 bits (391), Expect = 8.226e-43
Identity = 76/153 (49.67%), Postives = 103/153 (67.32%), Query Frame = 1
Query:  136 MEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDS-KKVFLWMQEPKEDNDVELCMKVNELLN--PKAKSSPTAGSK-------VVNMN--DLTELLGELNEIGALNDI 558
            +EFRAG+M M     V+PD RKGLV++ Q+ DGL HFCWKDR +GKVEDDL++FPD+  +KR+ QC TGRV++LKFK S +++F WMQEPK D D E C ++NELLN  P A      GS        + NM+   L +L G + ++G L+ +
Sbjct:   18 VEFRAGRMNM-VGKMVHPDPRKGLVYMTQSDDGLMHFCWKDRTSGKVEDDLIVFPDDFEYKRVDQCKTGRVYVLKFKSSTRRMFFWMQEPKTDKDDEQCRRINELLNNPPSAHQRGGGGSNDGDLQYMLNNMSQQQLMQLFGGVGQMGGLSSL 169          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Zebrafish
Match: adrm1 (adhesion regulating molecule 1 [Source:NCBI gene;Acc:796450])

HSP 1 Score: 152.525 bits (384), Expect = 2.084e-43
Identity = 71/110 (64.55%), Postives = 84/110 (76.36%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM + + + V PDKRKG V+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+ QC TGRV++LKFK  SK++F WMQEPK D D E C KVNE LN
Sbjct:   20 KYLVEFRAGKMTL-KGSTVTPDKRKGTVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVNQCTTGRVYVLKFKAGSKRLFFWMQEPKTDKDDEYCRKVNEYLN 128          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Zebrafish
Match: adrm1 (adhesion regulating molecule 1 [Source:NCBI gene;Acc:796450])

HSP 1 Score: 156.377 bits (394), Expect = 2.151e-43
Identity = 71/110 (64.55%), Postives = 84/110 (76.36%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM + + + V PDKRKG V+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+ QC TGRV++LKFK  SK++F WMQEPK D D E C KVNE LN
Sbjct:   20 KYLVEFRAGKMTL-KGSTVTPDKRKGTVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVNQCTTGRVYVLKFKAGSKRLFFWMQEPKTDKDDEYCRKVNEYLN 128          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Zebrafish
Match: adrm1 (adhesion regulating molecule 1 [Source:NCBI gene;Acc:796450])

HSP 1 Score: 156.377 bits (394), Expect = 3.078e-43
Identity = 71/110 (64.55%), Postives = 84/110 (76.36%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM + + + V PDKRKG V+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+ QC TGRV++LKFK  SK++F WMQEPK D D E C KVNE LN
Sbjct:   20 KYLVEFRAGKMTL-KGSTVTPDKRKGTVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVNQCTTGRVYVLKFKAGSKRLFFWMQEPKTDKDDEYCRKVNEYLN 128          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Zebrafish
Match: adrm1 (adhesion regulating molecule 1 [Source:NCBI gene;Acc:796450])

HSP 1 Score: 156.377 bits (394), Expect = 3.668e-43
Identity = 71/110 (64.55%), Postives = 84/110 (76.36%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM + + + V PDKRKG V+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+ QC TGRV++LKFK  SK++F WMQEPK D D E C KVNE LN
Sbjct:   20 KYLVEFRAGKMTL-KGSTVTPDKRKGTVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVNQCTTGRVYVLKFKAGSKRLFFWMQEPKTDKDDEYCRKVNEYLN 128          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Zebrafish
Match: adrm1 (adhesion regulating molecule 1 [Source:NCBI gene;Acc:796450])

HSP 1 Score: 156.377 bits (394), Expect = 3.703e-43
Identity = 71/110 (64.55%), Postives = 84/110 (76.36%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM + + + V PDKRKG V+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+ QC TGRV++LKFK  SK++F WMQEPK D D E C KVNE LN
Sbjct:   20 KYLVEFRAGKMTL-KGSTVTPDKRKGTVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVNQCTTGRVYVLKFKAGSKRLFFWMQEPKTDKDDEYCRKVNEYLN 128          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Xenopus
Match: adrm1 (adhesion regulating molecule 1 [Source:NCBI gene;Acc:394646])

HSP 1 Score: 159.458 bits (402), Expect = 2.923e-44
Identity = 72/110 (65.45%), Postives = 85/110 (77.27%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM + + + V PDKRKGLV+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+ QC TGRV++LKFK  SK++F WMQEPK D D E C KVNE LN
Sbjct:   20 KYLVEFRAGKMSL-KGSTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGSVEDDLIIFPDDCEFKRVSQCTTGRVYVLKFKAGSKRLFFWMQEPKTDKDEEYCRKVNEYLN 128          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Xenopus
Match: adrm1 (adhesion regulating molecule 1 [Source:NCBI gene;Acc:394646])

HSP 1 Score: 158.688 bits (400), Expect = 8.039e-44
Identity = 72/110 (65.45%), Postives = 85/110 (77.27%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM + + + V PDKRKGLV+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+ QC TGRV++LKFK  SK++F WMQEPK D D E C KVNE LN
Sbjct:   33 KYLVEFRAGKMSL-KGSTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGSVEDDLIIFPDDCEFKRVSQCTTGRVYVLKFKAGSKRLFFWMQEPKTDKDEEYCRKVNEYLN 141          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Xenopus
Match: adrm1 (adhesion regulating molecule 1 [Source:NCBI gene;Acc:394646])

HSP 1 Score: 83.9593 bits (206), Expect = 2.560e-17
Identity = 47/109 (43.12%), Postives = 53/109 (48.62%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM + + + V PDKRKGLV+I QT D L HFCWKDR +G VED                                      EPK D D E C KVNE LN
Sbjct:   21 KYLVEFRAGKMSL-KGSTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGSVED--------------------------------------EPKTDKDEEYCRKVNEYLN 90          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Mouse
Match: Adrm1 (adhesion regulating molecule 1 [Source:MGI Symbol;Acc:MGI:1929289])

HSP 1 Score: 158.303 bits (399), Expect = 6.725e-44
Identity = 72/110 (65.45%), Postives = 85/110 (77.27%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM + +   V PDKRKGLV+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+PQC +GRV++LKFK  SK++F WMQEPK D D E C KVNE LN
Sbjct:   21 KYLVEFRAGKMSL-KGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLN 129          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Mouse
Match: Gm9774 (predicted pseudogene 9774 [Source:MGI Symbol;Acc:MGI:3642386])

HSP 1 Score: 157.532 bits (397), Expect = 1.008e-43
Identity = 72/110 (65.45%), Postives = 85/110 (77.27%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM + +   V PDKRKGLV+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+PQC +GRV++LKFK  SK++F WMQEPK D D E C KVNE LN
Sbjct:   21 KYLVEFRAGKMSL-KGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLN 129          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Mouse
Match: Gm9774 (predicted pseudogene 9774 [Source:MGI Symbol;Acc:MGI:3642386])

HSP 1 Score: 137.117 bits (344), Expect = 5.679e-37
Identity = 75/175 (42.86%), Postives = 102/175 (58.29%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQ---EPKEDNDVELCMKVNEL----LNPKAKS-----SPTAG---------SKVVNMNDLTELLGELN---EIGALNDIDLLELL 576
            K L+EFRAGKM +     V PDKRKGLV+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+PQC +GRV++LKFK  SK++F WMQ    P        C    +L    L+P A +     +P++G         ++ + ++DL  +L  +N     G    +DL  +L
Sbjct:   21 KYLVEFRAGKMSLKGTT-VTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQVDLGPSLGQAWPACWGAVDLQPAALHPAASATSPSPAPSSGNGTSTAASPTQPIQLSDLQSILATMNVPAWPGGSQQVDLASVL 194          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. UniProt/SwissProt
Match: sp|Q98SH3|ADRM1_CHICK (Proteasomal ubiquitin receptor ADRM1 OS=Gallus gallus OX=9031 GN=ADRM1 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 3.800e-44
Identity = 80/136 (58.82%), Postives = 96/136 (70.59%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLNPKAKSSPTA-GSKVVNMNDLTELLGE 528
            K L+EFRAGKM + + + V PDKRKGLV+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+PQC TGRV++LKFK  SK++F WMQEPK D D E C KVNE LN      P A G      ++L+ L GE
Sbjct:   21 KYLVEFRAGKMSL-KGSTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCTTGRVYVLKFKAGSKRLFFWMQEPKTDKDEEHCRKVNEYLN--NPPMPGALGGNASGGHELSALGGE 153          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. UniProt/SwissProt
Match: sp|Q9JMB5|ADRM1_RAT (Proteasomal ubiquitin receptor ADRM1 OS=Rattus norvegicus OX=10116 GN=Adrm1 PE=1 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 6.069e-44
Identity = 78/135 (57.78%), Postives = 96/135 (71.11%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLNPKAKSSPTAGSKVVNMNDLTELLGE 528
            K L+EFRAGKM + +   V PDKRKGLV+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+PQC +GRV++LKFK  SK++F WMQEPK D D E C KVNE LN       T G+   + ++L+ L GE
Sbjct:   21 KYLVEFRAGKMSL-KGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLNNPPMPG-TLGASGSSGHELSALGGE 153          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. UniProt/SwissProt
Match: sp|Q16186|ADRM1_HUMAN (Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 1.157e-43
Identity = 80/153 (52.29%), Postives = 104/153 (67.97%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN--PKAKSSPTAGSKVVNMNDLTELLGELNEIGALNDIDLLELL 576
            K L+EFRAGKM + +   V PDKRKGLV+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+PQC +GRV++LKFK  SK++F WMQEPK D D E C KVNE LN  P   +   +GS    ++ L    G  + +G ++   L++L+
Sbjct:   21 KYLVEFRAGKMSL-KGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLI 172          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. UniProt/SwissProt
Match: sp|Q6P877|ADRM1_XENTR (Proteasomal ubiquitin receptor ADRM1 OS=Xenopus tropicalis OX=8364 GN=adrm1 PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.548e-43
Identity = 72/110 (65.45%), Postives = 85/110 (77.27%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM + + + V PDKRKGLV+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+ QC TGRV++LKFK  SK++F WMQEPK D D E C KVNE LN
Sbjct:   20 KYLVEFRAGKMSL-KGSTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGSVEDDLIIFPDDCEFKRVSQCTTGRVYVLKFKAGSKRLFFWMQEPKTDKDEEYCRKVNEYLN 128          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. UniProt/SwissProt
Match: sp|A1L5A6|ADRM1_BOVIN (Proteasomal ubiquitin receptor ADRM1 OS=Bos taurus OX=9913 GN=ADRM1 PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.284e-43
Identity = 72/110 (65.45%), Postives = 85/110 (77.27%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM + +   V PDKRKGLV+I QT D L HFCWKDR +G VEDDL+IFPD+  FKR+PQC +GRV++LKFK  SK++F WMQEPK D D E C KVNE LN
Sbjct:   21 KYLVEFRAGKMSL-KGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLN 129          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. TrEMBL
Match: T1IBL1 (RPN13_C domain-containing protein OS=Rhodnius prolixus OX=13249 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.780e-45
Identity = 83/167 (49.70%), Postives = 109/167 (65.27%), Query Frame = 1
Query:   94 IFDLHKKPKRKKNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDSKKVFLWMQEPKEDNDVELCMKVNELLN--PKAKSSPTAGSK--------VVNMN--DLTELLGELNEIGALNDI 558
            +F         KNL+EF+AGKM M +   V+PDKRKGLV+I+Q+ D L HFCWKDR TG VEDDL+IFPD+  FKR+PQC TGRV++LKFK S + F W+QEPK D D + C KVNE+LN  P   S  + G+         + NM+   L +L G + +IG L+ +
Sbjct:    7 LFGCSASRSSSKNLVEFKAGKMTM-KGKMVHPDKRKGLVYIYQSEDSLMHFCWKDRNTGSVEDDLIIFPDDVEFKRVPQCTTGRVYILKFKSSSRKFFWIQEPKTDKDEDNCRKVNEVLNNPPSLGSQRSGGATPDGDLQNLLSNMSQQQLMQLFGGVGQIGGLSSL 172          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. TrEMBL
Match: A0A069DYZ0 (Putative proteasomal ubiquitin receptor adrm1 OS=Panstrongylus megistus OX=65343 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 3.916e-45
Identity = 84/168 (50.00%), Postives = 110/168 (65.48%), Query Frame = 1
Query:   94 IFDLHKKPKRKKNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN--PKAKSSPTAGSK--------VVNMN--DLTELLGELNEIGALNDI 558
            +F         KNL+EF+AGKM M +   V+PDKRKGLV+I+Q+ D L HFCWKDR TG VEDDL+IFPD+  FKR+PQC TGRV++LKFK  S+K F W+QEPK D D + C KVNE+LN  P   S  + G+         + NM+   L +L G + +IG L+ +
Sbjct:    7 LFGCSASRSGSKNLVEFKAGKMSM-KGKMVHPDKRKGLVYIYQSEDSLMHFCWKDRSTGSVEDDLIIFPDDVEFKRVPQCTTGRVYILKFKSSSRKFFFWIQEPKTDKDEDNCRKVNEVLNNPPSLGSQRSGGATPDGDLQNLLSNMSQQQLMQLFGGVGQIGGLSSL 173          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. TrEMBL
Match: A0A3S3RW95 (Proteasomal ubiquitin receptor ADRM1-like isoform X1 OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_06382 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 4.467e-45
Identity = 115/282 (40.78%), Postives = 155/282 (54.96%), Query Frame = 1
Query:  121 RKKNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELL-NPKAKSSPTAGSKVVNMNDLTELL----GEL-NEIGALNDIDLLELLAQ-GFGSQ-------------ISNESEFPSHNQTTPFPIGATVSNPTY--------AERQSTILQGPLN-SSTKMGISSLDTHNTKNSISS----FDASDILSDNTIKKLLDNKAF--RVKVL 858
            + K L+EF+AGKM+M + N V P KRKGLVF++Q+ D L HFCWKDR TGKVEDDL+IFP++  FKR+PQC TGRV++LKFK  S++ F W+QEPKED D E C KVNE L NP A  S    S +  ++ L  L      EL N +  +N   L+++L   G GSQ              SN+S   S  +TTP    A  + P            + S+  Q P+  S  +  ISSL    ++ +  +     D S  ++   ++ LL NK F  RVK  
Sbjct:   16 QSKYLVEFKAGKMEM-KGNLVTPLKRKGLVFVNQSDDNLIHFCWKDRQTGKVEDDLIIFPEDAEFKRVPQCTTGRVYVLKFKSSSRRCFYWLQEPKEDKDEEYCKKVNEYLNNPPAPGSRNNNSGLAALSGLGGLPDLQDSELHNLLNNMNPQHLMQMLGGVGLGSQSNANSLAGILGNSSSNKSRGNSSTRTTPASSSAPSTAPASNVSTDANNRSKSSSTPQVPIQLSDLQSIISSLTGTQSQQAQGAAKEDIDLSSAITSEAMQSLLSNKDFMDRVKTF 296          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. TrEMBL
Match: E9G779 (RPN13_C domain-containing protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_194394 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 5.430e-45
Identity = 84/142 (59.15%), Postives = 100/142 (70.42%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDS-KKVFLWMQEPKEDNDVELCMKVNELLN----PKAKSSPTAGSKVVNMNDLTELLGELNE 537
            KNL+EFRAGKM M   N V+PDKRKGLV+IHQ+SD L HFCWKDR +G VEDD +IFPD+  + R+PQC TGRVFLLKFK S KK F WMQEPK D D   C KVNE LN    P ++S    GS + +  DL  LL  +++
Sbjct:   14 KNLVEFRAGKMTM-RGNMVHPDKRKGLVYIHQSSDSLIHFCWKDRQSGSVEDDWIIFPDDCEYVRVPQCTTGRVFLLKFKSSNKKTFFWMQEPKTDKDETYCRKVNEYLNNPPTPGSQSG-RGGSNLGSERDLQSLLSSMSQ 153          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. TrEMBL
Match: A0A224XCQ7 (Putative proteasomal ubiquitin receptor adrm1 OS=Panstrongylus lignarius OX=156445 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 6.003e-45
Identity = 84/168 (50.00%), Postives = 110/168 (65.48%), Query Frame = 1
Query:   94 IFDLHKKPKRKKNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN--PKAKSSPTAGSK--------VVNMN--DLTELLGELNEIGALNDI 558
            +F         KNL+EF+AGKM M +   V+PDKRKGLV+I+Q+ D L HFCWKDR TG VEDDL+IFPD+  FKR+PQC TGRV++LKFK  S+K F W+QEPK D D + C KVNE+LN  P   S  + G+         + NM+   L +L G + +IG L+ +
Sbjct:    7 LFGCGASRSGSKNLVEFKAGKMSM-KGKMVHPDKRKGLVYIYQSEDSLMHFCWKDRSTGSVEDDLIIFPDDVEFKRVPQCTTGRVYILKFKSSSRKFFFWIQEPKTDKDEDNCRKVNEVLNNPPSLGSQRSGGATPDGDLQNLLSNMSQQQLMQLFGGVGQIGGLSSL 173          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Cavefish
Match: adrm1 (adhesion regulating molecule 1 [Source:NCBI gene;Acc:103040590])

HSP 1 Score: 154.836 bits (390), Expect = 1.228e-42
Identity = 82/156 (52.56%), Postives = 103/156 (66.03%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLNPKAKSSPTAGSKVVNMNDLTEL--LGE---LNEIGALNDIDLLELL 576
            K L+EFRAGKM + + + V PDKRKG V+I QT D L HFCWKDR T  V+DDL+IFPD+  FKR+ QC TGRV++LKFK  SK++F WMQEPK D D E C KVNE LN    + P  G+     +   EL  LGE    N +G ++   LL+L+
Sbjct:   20 KYLVEFRAGKMTL-KGSTVTPDKRKGTVYIQQTDDSLIHFCWKDRTTANVDDDLIIFPDDCEFKRVNQCTTGRVYVLKFKAGSKRLFFWMQEPKTDKDEEYCRKVNEYLN----NPPMPGALGSGGSGGHELSALGEGGLQNLLGNISHNQLLQLI 170          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Yeast
Match: RPN13 (Subunit of the 19S regulatory particle of the 26S proteasome lid; acts as a ubiquitin receptor for the proteasome; null mutants accumulate ubiquitinated Gcn4p and display decreased 26S proteasome stability; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004413])

HSP 1 Score: 44.669 bits (104), Expect = 3.875e-6
Identity = 29/102 (28.43%), Postives = 53/102 (51.96%), Query Frame = 1
Query:  133 LMEFRAGKMKMNEDNWVY-PDKRKGLVFIHQTSD---GLNHFCWK--DRLTGKVED--DLVIFPDETVFKRLPQCNTGRVFLLKFKDSKKVFLWMQEPKEDN 414
            +++FRAG  + NED+ +  P   +G + I    +   G   F W+  ++  G+  D   L++ P ET++  +    +GR+F L F  +++ F W+QE    N
Sbjct:    7 VIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGN 108          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Nematostella
Match: EDO40101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S841])

HSP 1 Score: 152.91 bits (385), Expect = 3.378e-45
Identity = 71/110 (64.55%), Postives = 83/110 (75.45%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            KNL+EFRAGKM +     V  DKRKG V+IHQ+ D L HFCWKDR +GKVEDDL+IFPD+  +KR+ QC TGRV++LKFK  S+K F WMQEPK D D E C KVN LLN
Sbjct:   15 KNLLEFRAGKMNLKGTT-VTADKRKGQVYIHQSEDSLMHFCWKDRTSGKVEDDLIIFPDDIEYKRVKQCTTGRVYILKFKSSSRKFFFWMQEPKTDKDEEYCTKVNSLLN 123          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Medaka
Match: ENSORLT00000018643.2 (proteasomal ubiquitin receptor ADRM1 [Source:NCBI gene;Acc:101171004])

HSP 1 Score: 155.992 bits (393), Expect = 3.532e-43
Identity = 71/110 (64.55%), Postives = 84/110 (76.36%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM M + + V PDKRKG V+I QT D L HFCWKDR TG V+DDL+IFPD+  FKR+ QC TGRV++LKFK  SK++F WMQEP+ D D E C KVNE LN
Sbjct:   20 KYLVEFRAGKMTM-KGSTVTPDKRKGQVYIQQTDDSLIHFCWKDRTTGNVDDDLIIFPDDCEFKRVNQCTTGRVYVLKFKAGSKRLFFWMQEPRSDKDDEFCRKVNEYLN 128          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Medaka
Match: adrm1 (proteasomal ubiquitin receptor ADRM1-like [Source:NCBI gene;Acc:101175629])

HSP 1 Score: 155.606 bits (392), Expect = 5.071e-43
Identity = 81/155 (52.26%), Postives = 106/155 (68.39%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELL-NPKAKSSPTAGSKVVNMNDLTELLGE---LNEIGALNDIDLLELL 576
            K L+EFRAGKM + + N V PDKRKG V+I Q+ D L HFCWKDR TG V+DDL+IFPD+  FK++ QC TGRV++LKFK  SK++F WMQEPK D D E C KVNE L NP    +P   S   + ++L+ L GE    N +G ++   L++L+
Sbjct:   20 KYLVEFRAGKMTL-KGNTVTPDKRKGSVYIQQSDDSLIHFCWKDRTTGNVDDDLIIFPDDCEFKKVNQCTTGRVYVLKFKAGSKRLFFWMQEPKSDKDDEYCRKVNEYLNNPPIPGAPG--SGSGSGHELSALGGEGGLQNLLGNMSHNQLMQLI 171          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Medaka
Match: adrm1 (proteasomal ubiquitin receptor ADRM1-like [Source:NCBI gene;Acc:101175629])

HSP 1 Score: 154.836 bits (390), Expect = 5.777e-43
Identity = 81/155 (52.26%), Postives = 106/155 (68.39%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELL-NPKAKSSPTAGSKVVNMNDLTELLGE---LNEIGALNDIDLLELL 576
            K L+EFRAGKM + + N V PDKRKG V+I Q+ D L HFCWKDR TG V+DDL+IFPD+  FK++ QC TGRV++LKFK  SK++F WMQEPK D D E C KVNE L NP    +P   S   + ++L+ L GE    N +G ++   L++L+
Sbjct:   20 KYLVEFRAGKMTL-KGNTVTPDKRKGSVYIQQSDDSLIHFCWKDRTTGNVDDDLIIFPDDCEFKKVNQCTTGRVYVLKFKAGSKRLFFWMQEPKSDKDDEYCRKVNEYLNNPPIPGAPG--SGSGSGHELSALGGEGGLQNLLGNMSHNQLMQLI 171          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Medaka
Match: ENSORLT00000018639.2 (proteasomal ubiquitin receptor ADRM1 [Source:NCBI gene;Acc:101171004])

HSP 1 Score: 154.066 bits (388), Expect = 2.507e-42
Identity = 71/110 (64.55%), Postives = 82/110 (74.55%), Query Frame = 1
Query:  127 KNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFK-DSKKVFLWMQEPKEDNDVELCMKVNELLN 453
            K L+EFRAGKM M     V PDKRKG V+I QT D L HFCWKDR TG V+DDL+IFPD+  FKR+ QC TGRV++LKFK  SK++F WMQEP+ D D E C KVNE LN
Sbjct:   20 KYLVEFRAGKMTMKGST-VTPDKRKGQVYIQQTDDSLIHFCWKDRTTGNVDDDLIIFPDDCEFKRVNQCTTGRVYVLKFKAGSKRLFFWMQEPRSDKDDEFCRKVNEYLN 128          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Planmine SMEST
Match: SMESG000020635.1 (SMESG000020635.1)

HSP 1 Score: 699.123 bits (1803), Expect = 0.000e+0
Identity = 341/341 (100.00%), Postives = 341/341 (100.00%), Query Frame = 1
Query:   76 MTTPFNIFDLHKKPKRKKNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDSKKVFLWMQEPKEDNDVELCMKVNELLNPKAKSSPTAGSKVVNMNDLTELLGELNEIGALNDIDLLELLAQGFGSQISNESEFPSHNQTTPFPIGATVSNPTYAERQSTILQGPLNSSTKMGISSLDTHNTKNSISSFDASDILSDNTIKKLLDNKAFRVKVLQSEEISTDNIEKILLRKSDENNNLMKTLLDILSNNETGGQLIRAMGLPDTIISQLTEYDLVSVLQALEKYYGTRNGTPQD 1098
            MTTPFNIFDLHKKPKRKKNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDSKKVFLWMQEPKEDNDVELCMKVNELLNPKAKSSPTAGSKVVNMNDLTELLGELNEIGALNDIDLLELLAQGFGSQISNESEFPSHNQTTPFPIGATVSNPTYAERQSTILQGPLNSSTKMGISSLDTHNTKNSISSFDASDILSDNTIKKLLDNKAFRVKVLQSEEISTDNIEKILLRKSDENNNLMKTLLDILSNNETGGQLIRAMGLPDTIISQLTEYDLVSVLQALEKYYGTRNGTPQD
Sbjct:    1 MTTPFNIFDLHKKPKRKKNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDSKKVFLWMQEPKEDNDVELCMKVNELLNPKAKSSPTAGSKVVNMNDLTELLGELNEIGALNDIDLLELLAQGFGSQISNESEFPSHNQTTPFPIGATVSNPTYAERQSTILQGPLNSSTKMGISSLDTHNTKNSISSFDASDILSDNTIKKLLDNKAFRVKVLQSEEISTDNIEKILLRKSDENNNLMKTLLDILSNNETGGQLIRAMGLPDTIISQLTEYDLVSVLQALEKYYGTRNGTPQD 341          
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Planmine SMEST
Match: SMESG000019035.1 (SMESG000019035.1)

HSP 1 Score: 189.504 bits (480), Expect = 2.186e-56
Identity = 87/159 (54.72%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  115 PKRKKNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQTSDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDSKKVFLWMQEPKEDNDVELCMKVNELLNPKAKSSPTAGSKVVNMN---DLTELLGELNEIG-ALNDIDLLELLA 579
            P + KNL+EF+AGKM +++ NWV+ DKRKGLV+IH+ SDGL HFCWKDR +G+VEDDL++FP++T FK++PQC TGRV++LKFKDSKK+FLW+QEPK D D E+C  VN+ LN    S PT G+  +  +   D+ ELL  L   G +++  D++ LL 
Sbjct:   11 PAKSKNLVEFKAGKMNIDDKNWVHADKRKGLVYIHRGSDGLIHFCWKDRTSGEVEDDLIVFPEDTEFKKIPQCTTGRVYVLKFKDSKKLFLWLQEPKVDKDEEICKNVNDSLN----SPPTQGTASMRSHIDSDMQELLTGLGGAGYSISQNDIMSLLG 165          
The following BLAST results are available for this feature:
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ADRM12.408e-4452.29adhesion regulating molecule 1 [Source:HGNC Symbol... [more]
ADRM12.408e-4452.29adhesion regulating molecule 1 [Source:HGNC Symbol... [more]
ADRM12.828e-1835.95adhesion regulating molecule 1 [Source:HGNC Symbol... [more]
ADRM18.365e-1736.18adhesion regulating molecule 1 [Source:HGNC Symbol... [more]
back to top
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpn-131.942e-2836.54Proteasomal ubiquitin receptor ADRM1 homolog [Sou... [more]
rpn-133.589e-2836.54Proteasomal ubiquitin receptor ADRM1 homolog [Sou... [more]
back to top
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rpn133.183e-4349.67gene:FBgn0033886 transcript:FBtr0087611[more]
Rpn133.183e-4349.67gene:FBgn0033886 transcript:FBtr0114495[more]
Rpn133.183e-4349.67gene:FBgn0033886 transcript:FBtr0087610[more]
Rpn138.226e-4349.67gene:FBgn0033886 transcript:FBtr0114494[more]
Rpn138.226e-4349.67gene:FBgn0033886 transcript:FBtr0114493[more]
back to top
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adrm12.084e-4364.55adhesion regulating molecule 1 [Source:NCBI gene;A... [more]
adrm12.151e-4364.55adhesion regulating molecule 1 [Source:NCBI gene;A... [more]
adrm13.078e-4364.55adhesion regulating molecule 1 [Source:NCBI gene;A... [more]
adrm13.668e-4364.55adhesion regulating molecule 1 [Source:NCBI gene;A... [more]
adrm13.703e-4364.55adhesion regulating molecule 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
adrm12.923e-4465.45adhesion regulating molecule 1 [Source:NCBI gene;A... [more]
adrm18.039e-4465.45adhesion regulating molecule 1 [Source:NCBI gene;A... [more]
adrm12.560e-1743.12adhesion regulating molecule 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Adrm16.725e-4465.45adhesion regulating molecule 1 [Source:MGI Symbol;... [more]
Gm97741.008e-4365.45predicted pseudogene 9774 [Source:MGI Symbol;Acc:M... [more]
Gm97745.679e-3742.86predicted pseudogene 9774 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q98SH3|ADRM1_CHICK3.800e-4458.82Proteasomal ubiquitin receptor ADRM1 OS=Gallus gal... [more]
sp|Q9JMB5|ADRM1_RAT6.069e-4457.78Proteasomal ubiquitin receptor ADRM1 OS=Rattus nor... [more]
sp|Q16186|ADRM1_HUMAN1.157e-4352.29Proteasomal ubiquitin receptor ADRM1 OS=Homo sapie... [more]
sp|Q6P877|ADRM1_XENTR1.548e-4365.45Proteasomal ubiquitin receptor ADRM1 OS=Xenopus tr... [more]
sp|A1L5A6|ADRM1_BOVIN4.284e-4365.45Proteasomal ubiquitin receptor ADRM1 OS=Bos taurus... [more]
back to top
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1IBL13.780e-4549.70RPN13_C domain-containing protein OS=Rhodnius prol... [more]
A0A069DYZ03.916e-4550.00Putative proteasomal ubiquitin receptor adrm1 OS=P... [more]
A0A3S3RW954.467e-4540.78Proteasomal ubiquitin receptor ADRM1-like isoform ... [more]
E9G7795.430e-4559.15RPN13_C domain-containing protein OS=Daphnia pulex... [more]
A0A224XCQ76.003e-4550.00Putative proteasomal ubiquitin receptor adrm1 OS=P... [more]
back to top
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
adrm11.228e-4252.56adhesion regulating molecule 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RPN133.875e-628.43Subunit of the 19S regulatory particle of the 26S ... [more]
back to top
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO401013.378e-4564.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000018643.23.532e-4364.55proteasomal ubiquitin receptor ADRM1 [Source:NCBI ... [more]
adrm15.071e-4352.26proteasomal ubiquitin receptor ADRM1-like [Source:... [more]
adrm15.777e-4352.26proteasomal ubiquitin receptor ADRM1-like [Source:... [more]
ENSORLT00000018639.22.507e-4264.55proteasomal ubiquitin receptor ADRM1 [Source:NCBI ... [more]
back to top
BLAST of Proteasomal ubiquitin receptor ADRM1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000020635.10.000e+0100.00SMESG000020635.1[more]
SMESG000019035.12.186e-5654.72SMESG000019035.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006727 ID=SMED30006727|Name=Proteasomal ubiquitin receptor ADRM1|organism=Schmidtea mediterranea sexual|type=transcript|length=1174bp
AAATAATTCAAATATTTAAATGGCGAAATAATTGAATAAAGCGTTTAACT
GAAAAAAGTCCAAGAGCTTGAAAACATGACGACTCCTTTCAACATTTTCG
ATCTTCATAAAAAACCAAAACGCAAGAAAAATCTAATGGAGTTTCGAGCA
GGAAAAATGAAAATGAACGAGGATAATTGGGTCTATCCCGATAAGCGAAA
AGGCTTAGTTTTTATTCATCAAACGTCGGACGGTCTGAATCACTTTTGTT
GGAAAGATAGATTGACAGGAAAGGTCGAAGATGATTTGGTTATATTTCCC
GATGAAACAGTTTTTAAGCGCTTGCCCCAATGCAACACCGGAAGAGTCTT
TTTATTGAAATTCAAGGATTCTAAGAAAGTATTTTTATGGATGCAGGAAC
CTAAAGAGGACAACGATGTTGAGCTATGCATGAAAGTCAACGAACTCCTC
AATCCAAAAGCCAAATCCTCTCCAACTGCTGGCTCGAAAGTCGTAAATAT
GAATGATTTAACTGAATTACTTGGAGAACTTAATGAGATTGGAGCTTTGA
ACGACATTGACCTATTAGAACTATTAGCTCAAGGATTTGGAAGTCAAATT
TCTAATGAAAGTGAATTCCCAAGTCATAACCAAACAACTCCGTTTCCCAT
AGGTGCGACTGTATCAAATCCAACATATGCAGAAAGGCAATCCACTATTC
TCCAAGGCCCCTTGAATTCATCAACTAAAATGGGGATCAGTTCTCTCGAC
ACTCACAATACTAAAAATAGTATTTCTTCATTCGACGCTAGTGACATTCT
AAGTGATAATACAATCAAAAAATTACTGGACAATAAAGCATTTCGAGTTA
AAGTTTTGCAAAGCGAAGAAATCTCTACTGATAACATTGAAAAAATTCTT
TTAAGAAAGTCAGATGAAAATAATAATCTAATGAAGACATTATTAGATAT
TCTGTCAAACAATGAAACTGGCGGACAGTTGATAAGGGCGATGGGTCTAC
CGGACACTATTATTTCACAATTAACAGAATACGATCTTGTTAGTGTTTTG
CAGGCATTGGAGAAGTATTATGGCACAAGAAATGGCACTCCACAAGACTG
ATGGTAACAGCTTTGTGAGGATTTTTATTTGCACAATTTTCAAACTAATA
AAAACATTGTCCAATAAAAAAAAA
back to top

protein sequence of SMED30006727-orf-1

>SMED30006727-orf-1 ID=SMED30006727-orf-1|Name=SMED30006727-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=342bp
MTTPFNIFDLHKKPKRKKNLMEFRAGKMKMNEDNWVYPDKRKGLVFIHQT
SDGLNHFCWKDRLTGKVEDDLVIFPDETVFKRLPQCNTGRVFLLKFKDSK
KVFLWMQEPKEDNDVELCMKVNELLNPKAKSSPTAGSKVVNMNDLTELLG
ELNEIGALNDIDLLELLAQGFGSQISNESEFPSHNQTTPFPIGATVSNPT
YAERQSTILQGPLNSSTKMGISSLDTHNTKNSISSFDASDILSDNTIKKL
LDNKAFRVKVLQSEEISTDNIEKILLRKSDENNNLMKTLLDILSNNETGG
QLIRAMGLPDTIISQLTEYDLVSVLQALEKYYGTRNGTPQD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000419prepharyngeal region
PLANA:0002030early male germ cell
PLANA:0002056medial muscle cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR038633Rpn13/ADRM1_sf
IPR006773Rpn13/ADRM1
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006773Proteasomal ubiquitin receptor Rpn13/ADRM1PFAMPF04683Proteasom_Rpn13coord: 26..108
e-value: 6.7E-26
score: 90.7
IPR006773Proteasomal ubiquitin receptor Rpn13/ADRM1PANTHERPTHR12225ADHESION REGULATING MOLECULE 1 110 KDA CELL MEMBRANE GLYCOPROTEINcoord: 15..259
IPR038633Proteasomal ubiquitin receptor Rpn13/ADRM1 superfamilyGENE3DG3DSA:2.30.29.70coord: 19..127
e-value: 3.3E-38
score: 132.0
NoneNo IPR availableCDDcd13314PH_Rpn13coord: 22..125
e-value: 4.05441E-56
score: 176.306