slc46a-1

Overview
Nameslc46a-1 (AKN21693.1)
Smed IDSMED30006690
Length (bp)1565
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc46a-1 (SMED30006690) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc46a-1 (SMED30006690) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006690

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30006690SMESG000022670.1 dd_Smed_v4_10822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006690SMESG000022670.1 dd_Smed_v4_10822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30006690SMESG000022670.1 dd_Smed_v4_10822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30006690SMESG000022670.1 dd_Smed_v4_10822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006690SMESG000022670.1 dd_Smed_v4_10822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30006690SMESG000022670.1 dd_Smed_v6_10822_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc46a-1 vs. Ensembl Human
Match: SLC46A2 (solute carrier family 46 member 2 [Source:HGNC Symbol;Acc:HGNC:16055])

HSP 1 Score: 82.0333 bits (201), Expect = 5.623e-16
Identity = 105/455 (23.08%), Postives = 196/455 (43.08%), Query Frame = 1
Query:  172 KTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGW-SDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIV------AIGVIMMAVLIYGIFGK-SALLT--MSCNSYVVDCSTSEERTTLLSRLLGM-NFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVI---PETVKLQDENQLVANEETCLSKPESKNVKL----KNYLWNFFTRSRKGENRKYLIWLIL--AIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLI 1476
            + + SL+   + L +  + G    S N S  P+                +E++ QR+ +N+ I Y  ++ + + +L+ Y  GW SDR+ RK           +S CM  L    +  G ++       + V+  A  + G+FG  SA  +  M+  S          R  L+  +LG+  F G      L   ++ ++G   +L   S+SC    +L + ++   PE+V  +   +L A +    +    + +      + Y         K +  K  I L+   AI ++  A  G  DVI L+V   P+ W+    GY +A  Y     + + VL +  R F   DT +I+IG+       +++      +  +++  +   A + V   +S +SK+ +    G  F I     A + ++  T++N +Y+ TMDM++G+ F + + L F  +I
Sbjct:   30 QVAASLYDAGLLLVVKASYGTG-GSSNHSASPSPRG------------ALEDQQQRAISNFYIIYNLVVGL-SPLLSAYGLGWLSDRYHRK-----------ISICMSLLGFLLSRLGLLLKVLLDWPVEVLYGAAALNGLFGGFSAFWSGVMALGSLGSSEGRRSVRLILIDLMLGLAGFCGSMASGHLFKQMAGHSGQGLILTACSVSCASFALLYSLLVLKVPESVA-KPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHKTTIALLFVGAIIYD-LAVVGTVDVIPLFVLREPLGWNQVQVGYGMAAGYTIFITSFLGVL-VFSRCFR--DTTMIMIGMVSFGSGALLLAFVKETYMFYIARAVMLFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLALTGVVTSTLYNKIYQLTMDMFVGSCFALSSFLSFLAII 454          
BLAST of slc46a-1 vs. Ensembl Human
Match: SLC46A3 (solute carrier family 46 member 3 [Source:HGNC Symbol;Acc:HGNC:27501])

HSP 1 Score: 66.2402 bits (160), Expect = 6.022e-11
Identity = 92/395 (23.29%), Postives = 160/395 (40.51%), Query Frame = 1
Query:  322 ENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSC------CMFSLALERTVKGTIVAIGVIMMAVLIYGIF-GKSALLTMSCNSYVVD-CSTSEERTTLLSRLLGMNF-LGIFFGSFLVGLISKY----AGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPES-KNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGY--------YLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIF 1440
            + EVQ+  + + +       IP  + T      SD +GRK P+IL  +GA+ +       C F+   +  +  T +            G F G       +C +Y+VD C   +++T    R+  ++F LG+  G  L GL S Y     GF    L  ++S    +I I F + + VK        +++   +S  E  KN+  + Y+     ++  G+ R  L  L+  +        G   + +LY   SP+ W++   GY        +L ++ G    +           + + D  +  IGI      + M         +FL+ V      +  +V +S+LSK+    E G  FA  + +E    +   + FN +Y AT+  Y G  F
Sbjct:   62 QEEVQKKVSRFNLQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLCYFAFPFQLLIASTFI------------GAFCGNYTTFWGACFAYIVDQCKEHKQKTI---RIAIIDFLLGLVTG--LTGLSSGYFIRELGFEWSFLIIAVSLAVNLIYILFFLGDPVK------ECSSQNVTMSCSEGFKNLFYRTYM---LFKNASGKRRFLLCLLLFTVITYFFVVIGIAPIFILYELDSPLCWNEVFIGYGSALGSASFLTSFLGIWLFS-----------YCMEDIHMAFIGIFTTMTGMAMTAFASTTLMMFLARVPFLFTIVPFSVLRSMLSKVVRSTEQGTLFACIAFLETLGGVTAVSTFNGIYSATVAWYPGFTF 419          
BLAST of slc46a-1 vs. Ensembl Human
Match: SLC46A3 (solute carrier family 46 member 3 [Source:HGNC Symbol;Acc:HGNC:27501])

HSP 1 Score: 66.2402 bits (160), Expect = 6.670e-11
Identity = 92/395 (23.29%), Postives = 160/395 (40.51%), Query Frame = 1
Query:  322 ENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSC------CMFSLALERTVKGTIVAIGVIMMAVLIYGIF-GKSALLTMSCNSYVVD-CSTSEERTTLLSRLLGMNF-LGIFFGSFLVGLISKY----AGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPES-KNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGY--------YLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIF 1440
            + EVQ+  + + +       IP  + T      SD +GRK P+IL  +GA+ +       C F+   +  +  T +            G F G       +C +Y+VD C   +++T    R+  ++F LG+  G  L GL S Y     GF    L  ++S    +I I F + + VK        +++   +S  E  KN+  + Y+     ++  G+ R  L  L+  +        G   + +LY   SP+ W++   GY        +L ++ G    +           + + D  +  IGI      + M         +FL+ V      +  +V +S+LSK+    E G  FA  + +E    +   + FN +Y AT+  Y G  F
Sbjct:   62 QEEVQKKVSRFNLQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLCYFAFPFQLLIASTFI------------GAFCGNYTTFWGACFAYIVDQCKEHKQKTI---RIAIIDFLLGLVTG--LTGLSSGYFIRELGFEWSFLIIAVSLAVNLIYILFFLGDPVK------ECSSQNVTMSCSEGFKNLFYRTYM---LFKNASGKRRFLLCLLLFTVITYFFVVIGIAPIFILYELDSPLCWNEVFIGYGSALGSASFLTSFLGIWLFS-----------YCMEDIHMAFIGIFTTMTGMAMTAFASTTLMMFLARVPFLFTIVPFSVLRSMLSKVVRSTEQGTLFACIAFLETLGGVTAVSTFNGIYSATVAWYPGFTF 419          
BLAST of slc46a-1 vs. Ensembl Human
Match: SLC46A1 (solute carrier family 46 member 1 [Source:HGNC Symbol;Acc:HGNC:30521])

HSP 1 Score: 58.5362 bits (140), Expect = 1.882e-8
Identity = 82/352 (23.30%), Postives = 147/352 (41.76%), Query Frame = 1
Query:  412 GGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERF---FNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACL 1458
            G WSD  GR+  L+L  +G ++   +    ++  +      +G I+ A+L  G FG   LL  S  S V D S+S  RT  ++ L     +     S L G   +  G++            + +  AF   ET+K     +L                +    +   +      ++RK+L    LAIF   T   G QD++ LY   +P+ W  ++ GY      G    +L ++  L+      + L+D  +  IG++   + +++     +   +F    +   + +I  V ++ LSK+  + E G  F+  + + + + L    IFN LY AT++   G  F + A L
Sbjct:  105 GAWSDSVGRRPLLVLASLGLLLQALVSVFVVQLQLHVGYFVLGRILCALL--GDFG--GLLAASFAS-VADVSSSRSRTFRMALLEASIGVAGMLASLLGGHWLRAQGYANPFWLALALLIAMTLYAAFCFGETLKEPKSTRLF-------------TFRHHRSIVQLYVAPAPEKSRKHLALYSLAIFVVITVHFGAQDILTLYELSTPLCWDSKLIGY------GSAAQHLPYLTSLLALKLLQYCLADAWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVITPVIRAKLSKLVRETEQGALFSAVACVNSLAMLTASGIFNSLYPATLNFMKGFPFLLGAGL 432          
BLAST of slc46a-1 vs. Ensembl Celegans
Match: C46C11.2 (pep chromosome:WBcel235:X:4632348:4635780:1 gene:WBGene00016705.1 transcript:C46C11.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C46C11.2)

HSP 1 Score: 110.153 bits (274), Expect = 1.443e-25
Identity = 112/446 (25.11%), Postives = 200/446 (44.84%), Query Frame = 1
Query:  235 ILASRNESQGPTKDALDLINLQ--YVNPLEIENEVQRSAANYIIA----YRTLINIP-AAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSC-NSYVVDCSTSEERTTLLSRLLGMNF---LGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLV-ILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKL--------KNYLWNF----------------FTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQF 1464
            +LA+ N + G    AL  + ++  Y  P +I  +      N  +     Y   IN+P A +  I +GG+SD  GRK P+++  +  +VS  M  L  +   + T   +       ++ G+ G   LLTMSC N+Y+ D     ++ TL  R++ ++    LG F  S  V  + K+    TV++      G+L+  L++ +I +  K + +N L+  +E+ ++   S+N  L        +N L  F                F + R G  R +L     A F +Q     E+ ++  YV+  P  W    Y  Y +       + +   +   +R F+  DT +I + I      ++M+G     W IF S   GS  G++  ++ + ++ I E DEIG  +AI+S  +  + +    +   +Y AT+D Y G ++ + A + F
Sbjct:   24 VLAACNTAVGIVSPALKEMKMKRVYPAPPDIHGKDLEKYYNKKMVMWDNYYEYINLPIACVFGIIYGGYSDHRGRKYPMLIGILSVLVSNAMNILMWD---ENTDWPLAWTYPTAVVTGVLG-DFLLTMSCINAYIAD--EFPDKITLSYRMVVVSIIFSLGSFVASRFVKDLVKWTSKPTVMIIAE--GGYLLTFLVSLLILDQKKPKTKNCLLKEDESIVTVEGSENQSLASLPNSTQENKLSVFEIIKTSFVAIYDAAKIFLQPRAGHRRLFLYLCFAANFLDQFVWGEEKGLLGTYVRLPPFTWDTSTYADYKSWRPIVQIVGMAVGMLFFKRIFHFRDTFIICLAILSMTGCVLMIGLAQASWLIFASLAPGSLHGLLNPMSYTFIACIVEQDEIGKAYAISSVAQKLAGIAQSLVLQNIYIATVDWYQGFVWLLMAAISF 461          
BLAST of slc46a-1 vs. Ensembl Celegans
Match: C46C11.2 (pep chromosome:WBcel235:X:4633056:4635784:1 gene:WBGene00016705.1 transcript:C46C11.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C46C11.2)

HSP 1 Score: 103.605 bits (257), Expect = 1.521e-23
Identity = 99/384 (25.78%), Postives = 174/384 (45.31%), Query Frame = 1
Query:  364 YRTLINIP-AAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSC-NSYVVDCSTSEERTTLLSRLLGMNF---LGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLV-ILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKL--------KNYLWNF----------------FTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMY 1425
            Y   IN+P A +  I +GG+SD  GRK P+++  +  +VS  M  L  +   + T   +       ++ G+ G   LLTMSC N+Y+ D     ++ TL  R++ ++    LG F  S  V  + K+    TV++      G+L+  L++ +I +  K + +N L+  +E+ ++   S+N  L        +N L  F                F + R G  R +L     A F +Q     E+ ++  YV+  P  W    Y  Y +       + +   +   +R F+  DT +I + I      ++M+G     W IF S   GS  G++  ++ + ++ I E DEIG  +AI+S  +  + +    +   +Y AT+D Y
Sbjct:   30 YYEYINLPIACVFGIIYGGYSDHRGRKYPMLIGILSVLVSNAMNILMWD---ENTDWPLAWTYPTAVVTGVLG-DFLLTMSCINAYIAD--EFPDKITLSYRMVVVSIIFSLGSFVASRFVKDLVKWTSKPTVMIIAE--GGYLLTFLVSLLILDQKKPKTKNCLLKEDESIVTVEGSENQSLASLPNSTQENKLSVFEIIKTSFVAIYDAAKIFLQPRAGHRRLFLYLCFAANFLDQFVWGEEKGLLGTYVRLPPFTWDTSTYADYKSWRPIVQIVGMAVGMLFFKRIFHFRDTFIICLAILSMTGCVLMIGLAQASWLIFASLAPGSLHGLLNPMSYTFIACIVEQDEIGKAYAISSVAQKLAGIAQSLVLQNIYIATVDWY 405          
BLAST of slc46a-1 vs. Ensembl Celegans
Match: F40F9.5 (pep chromosome:WBcel235:V:9719770:9724118:-1 gene:WBGene00009582.1 transcript:F40F9.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40F9.5)

HSP 1 Score: 74.7146 bits (182), Expect = 6.398e-14
Identity = 104/435 (23.91%), Postives = 184/435 (42.30%), Query Frame = 1
Query:  319 IENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVV--DC--------STSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTS-LSCGFL--------VILIAFVIPETVKLQDE----NQLVANEETCLSKPESKNVKLK---NYLWNFF---TRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYY--GCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHFYLVKG*KISQN 1530
            ++++V++  AN  I  + +  IP  I++   G WSDR GRK PL+    G  ++   F L        T+       ++  + G+FG  A  T S +  +V  DC        ST   R  L S +     +G+  G+ +V L++  A  S      S + C F+        +I   F + ET   + E    NQL   EE    +   K + ++   +YL N F   T  R G  R  L   +  +F      + +  ++LL VK  P  W+D+++ Y+  T     C G+ L  +L     +    D++LI+  ++  A    +         IF + + G   G +    +S L ++   +E      + S + +FS ++   IFN ++  T+  + G  F++  C Q    IG + +H  +    K+ + 
Sbjct:  117 LQDDVEKDIANTKIYLQIMGTIPTLIVSPLIGNWSDRNGRKSPLLFSLFGLFIN--NFILLCATLTYETVNVYYWFFISEFMLGMFGGGAA-TFSTSLAIVTDDCRHKLKPGSSTVPFRVGLASFVQS---IGMLNGTLIVSLLAVPAIISVERHALSYVECAFIQTALSLISLIYAIFFVRETHFPKKEDFSYNQLNEAEEVEAEELPPKIIGMRRFTSYLENVFGVLTVRRPGWTRLCLCVSLAFVFIE--FLSFDPALLLLLVKRLPFAWNDKLFSYFSLTRQLVNCFGMILCPILLTFSHWLG-KDSLLIIAALACSAATSFLTAFATRTEHIFYTCIFGIVMGGMQPAYRSFLPRMVAKEETARLLTVVSIIISFSPILSSLIFNNIFNMTLTWWPGFAFFVSGCFQITVFIGQLVIHMLMRPQWKLDKQ 542          
BLAST of slc46a-1 vs. Ensembl Celegans
Match: F40F9.5 (pep chromosome:WBcel235:V:9719743:9723978:-1 gene:WBGene00009582.1 transcript:F40F9.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40F9.5)

HSP 1 Score: 74.7146 bits (182), Expect = 6.398e-14
Identity = 104/435 (23.91%), Postives = 184/435 (42.30%), Query Frame = 1
Query:  319 IENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVV--DC--------STSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTS-LSCGFL--------VILIAFVIPETVKLQDE----NQLVANEETCLSKPESKNVKLK---NYLWNFF---TRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYY--GCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHFYLVKG*KISQN 1530
            ++++V++  AN  I  + +  IP  I++   G WSDR GRK PL+    G  ++   F L        T+       ++  + G+FG  A  T S +  +V  DC        ST   R  L S +     +G+  G+ +V L++  A  S      S + C F+        +I   F + ET   + E    NQL   EE    +   K + ++   +YL N F   T  R G  R  L   +  +F      + +  ++LL VK  P  W+D+++ Y+  T     C G+ L  +L     +    D++LI+  ++  A    +         IF + + G   G +    +S L ++   +E      + S + +FS ++   IFN ++  T+  + G  F++  C Q    IG + +H  +    K+ + 
Sbjct:  117 LQDDVEKDIANTKIYLQIMGTIPTLIVSPLIGNWSDRNGRKSPLLFSLFGLFIN--NFILLCATLTYETVNVYYWFFISEFMLGMFGGGAA-TFSTSLAIVTDDCRHKLKPGSSTVPFRVGLASFVQS---IGMLNGTLIVSLLAVPAIISVERHALSYVECAFIQTALSLISLIYAIFFVRETHFPKKEDFSYNQLNEAEEVEAEELPPKIIGMRRFTSYLENVFGVLTVRRPGWTRLCLCVSLAFVFIE--FLSFDPALLLLLVKRLPFAWNDKLFSYFSLTRQLVNCFGMILCPILLTFSHWLG-KDSLLIIAALACSAATSFLTAFATRTEHIFYTCIFGIVMGGMQPAYRSFLPRMVAKEETARLLTVVSIIISFSPILSSLIFNNIFNMTLTWWPGFAFFVSGCFQITVFIGQLVIHMLMRPQWKLDKQ 542          
BLAST of slc46a-1 vs. Ensembl Celegans
Match: Y4C6B.5 (pep chromosome:WBcel235:IV:5319253:5325033:1 gene:WBGene00021159.1 transcript:Y4C6B.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y4C6B.5)

HSP 1 Score: 71.2478 bits (173), Expect = 5.698e-13
Identity = 91/383 (23.76%), Postives = 178/383 (46.48%), Query Frame = 1
Query:  322 ENEVQRSAAN-YIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCC--MFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKN-VKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQI--FLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDA 1452
            + ++Q +A + Y I+  TL+  P+ + T+  G  +D +  K+PLI+P IG I+     +F      T      ++  ++++  ++G+ G    +  +  +Y V  S    R+  ++ + G   LG   G  L G I +  G++   L         ++ +  +  ET K +    +  +E T L     K  V +    +   T+SR  + R  LI  +LA        +G  D+   Y+++  + W D+ YG++    YG     ++F+ PL+ R   +SD +L  +G+  K I L M    F+Q ++  +  AVI      +    ++ +S + +  E G  F++ S +E  ++L+  +I+N +Y  T+  + G ++ I A
Sbjct:   57 DKDIQAAANHFYFISSLTLL-CPSLVTTLLLGAATDYWSIKIPLIIPYIGCILGTINYVFQSYFIHT------SVYFLLISDALFGLCGGFIAIISTTLTYGVKTSMLRYRSYRIAGVEGAIGLGGTVGFALSGTIREACGYAVTFLIILGLQLLALLYLLGLAKET-KFE---PVRPDEHTSLISTTGKQLVAVIREFYRVITKSR--QFRLLLILNLLAFGLEMLVFSGLSDIQYSYLRYK-LQWGDKKYGWFSGLSYGITTAAVLFLYPLL-RMKLMSDGMLATLGLFFKMISLFMFA--FLQNEVMAYSIAVIVMFNRFVSTGFRAFISSLIDMQEQGKIFSVISLLEGITTLVATSIYNNVYPNTLTFFPGLLYLISA 422          
BLAST of slc46a-1 vs. Ensembl Fly
Match: CG15890 (gene:FBgn0030576 transcript:FBtr0073939)

HSP 1 Score: 90.5077 bits (223), Expect = 8.059e-19
Identity = 103/422 (24.41%), Postives = 184/422 (43.60%), Query Frame = 1
Query:  319 IENEVQRSAANYIIAYRTLI-NIPAAILTIYWGGWSDRFGRKLPLIL-PCIGAIVS------CCMFSLALERTVKGTIVAIGVIMMAVLIYGIF----GKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRS----------RKGEN--RKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGL-NLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHFYLVK 1509
            +E E  +     + A++T+I ++   +L ++WG WSDR  R+ P IL P +G  +       C  F  A              +  A L   IF    G    + M   SY+ D +T E+RT  +  L     +G+  G    G++ K  GF  V    S+S  F VI  AFV        +E Q         S+PE K+ + K+ L +FF +           +KGEN  RK +I L++ +        GE  V  L+ +    NWS+  + ++ +TY    GL  +IF + ++    N+ D ++ ++  + K +   +     + W ++L  ++    G      +S+ +K+   DE+G   ++    EA   ++   ++  LY AT+ +  G  F +   L    +  F+ ++ + V+
Sbjct:  123 LEEETVQQMVARMAAWKTVIQSLFPCLLILFWGSWSDRHRRRKPCILIPVVGEFLGVVGLMLCVYFEQA-------------PMEAAALTEAIFPSLSGGWFTMLMGVFSYIADITTEEDRTLRIGILNVCFSVGVPIGMAFSGVLLKQIGFYGVF---SISAAFYVI--AFVY--GFFFLEEPQ---------SRPE-KSAEQKSLLADFFDKEHVVQTFRVAFKKGENQRRKRVILLMIVVMVIIGPLHGEMAVTYLFTRFR-FNWSEVEFSFF-STYAMFTGLIGVIFCVGILSHKLNIDDALVGVLSSTSKILSSFVYAFATLPWHMYLGGLVEIFNGTAFIAMRSIATKLVSKDELGKVNSLFGVAEALMPMVFAPMYTTLYAATLRVLPGAFFLLGGGLTLFSVFIFLWMYRFQVR 512          
BLAST of slc46a-1 vs. Ensembl Fly
Match: CG15890 (gene:FBgn0030576 transcript:FBtr0339769)

HSP 1 Score: 90.5077 bits (223), Expect = 8.059e-19
Identity = 103/422 (24.41%), Postives = 184/422 (43.60%), Query Frame = 1
Query:  319 IENEVQRSAANYIIAYRTLI-NIPAAILTIYWGGWSDRFGRKLPLIL-PCIGAIVS------CCMFSLALERTVKGTIVAIGVIMMAVLIYGIF----GKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRS----------RKGEN--RKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGL-NLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHFYLVK 1509
            +E E  +     + A++T+I ++   +L ++WG WSDR  R+ P IL P +G  +       C  F  A              +  A L   IF    G    + M   SY+ D +T E+RT  +  L     +G+  G    G++ K  GF  V    S+S  F VI  AFV        +E Q         S+PE K+ + K+ L +FF +           +KGEN  RK +I L++ +        GE  V  L+ +    NWS+  + ++ +TY    GL  +IF + ++    N+ D ++ ++  + K +   +     + W ++L  ++    G      +S+ +K+   DE+G   ++    EA   ++   ++  LY AT+ +  G  F +   L    +  F+ ++ + V+
Sbjct:  123 LEEETVQQMVARMAAWKTVIQSLFPCLLILFWGSWSDRHRRRKPCILIPVVGEFLGVVGLMLCVYFEQA-------------PMEAAALTEAIFPSLSGGWFTMLMGVFSYIADITTEEDRTLRIGILNVCFSVGVPIGMAFSGVLLKQIGFYGVF---SISAAFYVI--AFVY--GFFFLEEPQ---------SRPE-KSAEQKSLLADFFDKEHVVQTFRVAFKKGENQRRKRVILLMIVVMVIIGPLHGEMAVTYLFTRFR-FNWSEVEFSFF-STYAMFTGLIGVIFCVGILSHKLNIDDALVGVLSSTSKILSSFVYAFATLPWHMYLGGLVEIFNGTAFIAMRSIATKLVSKDELGKVNSLFGVAEALMPMVFAPMYTTLYAATLRVLPGAFFLLGGGLTLFSVFIFLWMYRFQVR 512          
BLAST of slc46a-1 vs. Ensembl Fly
Match: CG30345 (gene:FBgn0050345 transcript:FBtr0305317)

HSP 1 Score: 87.8113 bits (216), Expect = 4.503e-18
Identity = 96/445 (21.57%), Postives = 196/445 (44.04%), Query Frame = 1
Query:  139 EKLIFLVFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQF-CF 1470
            E  +FLVF     +++++Q  I      TV +  A+  E    T  A D +        +IE +VQ  A+   +    L +   AI++++ G WSD+FGR+  L+    G + S  +  +  + T    I     ++ +V      G  AL+T+    YV D +T  +R   +  +     LG+  G    G I    G S + +         ++ + F + E++K +D        ET     E   + L   L     R R+  +R  + ++++++     A  GE  V  ++++    +++ + Y  + A       +     + L+ R   LS  ++ L+  +   +   +  +     +++L+ ++G   G++  + K++LS +    E+G  F++T+++++ S L    ++  +Y+AT++ Y G   +I   L F CF
Sbjct:   44 EPAVFLVFFGRFLTDAVYQNQILYQTCVTVMKYNATECEPFLGTDRASDEVK-------KIEGQVQEYASTITMISSMLESTVPAIVSLFLGPWSDKFGRRPILLSTFTGYLFSAIILVVLTQITTAVNISPWWFLLSSVPSVFSGGTCALITI-LYCYVSDVATENKRAMRMVTMEAALGLGMMAGGVASGYIYAATGASILFILVGSIISIALLYVYFFVAESLKSEDL-------ETGSRIREFFRLDLVKVLVKTCIRKRENYDRAIIWFVMMSLTLCVFAMEGESTVNYMFMRKQ-FDYTVQDYSVFNAARVVIQVVGSTIAMILLRRLLGLSTIMMTLLAFACCVLESTVRATAVYGSEMYLALMVGMMRGVMSPMCKAILSHVTPSSELGKIFSLTTSLQSISPLGAAPLYTAVYQATVNFYPGIFNFISVGLYFLCF 472          
BLAST of slc46a-1 vs. Ensembl Fly
Match: CG30344 (gene:FBgn0050344 transcript:FBtr0088583)

HSP 1 Score: 73.9442 bits (180), Expect = 1.275e-13
Identity = 102/463 (22.03%), Postives = 206/463 (44.49%), Query Frame = 1
Query:  139 EKLIFLVFLVYKTSESLFQPSIRLYIYETVGQILASRNE-----SQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFL--GIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFV---IPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLIL-----AIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQ-IFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQF-CFLI 1476
            E  +FL+F       +++Q  I      T+ +  A++ E      +G   D             E+E  VQ  +AN ++    L +I  A  +++ G WSD+FGR+ P++L      ++  +  + +    + T ++    +++ +   + G +  L      Y+ D   ++ER   L  +L    L  GI  G+   G I  YA  +  L+  S++   ++  + +V   +PE++   D +       T     E     L   L     + R   +R  +IWL +     AIF  +    GE  V  ++V+    NW+ + +  + A+      +  I  + ++ R   +S   + ++ ++   +   +  +T V WQ ++L   +G   G++  + +++LS +    E+G  FA+T++ME+ S L    ++  +Y+AT++ Y G   +I A L F C+++
Sbjct:   55 EPAVFLIFFARNLIGAVYQNQILYQTCITIEKFNATQCEPLLGIDRGSDADK------------EVEVIVQTYSANIMMTTSLLESIIPAFASLFLGPWSDKFGRR-PILLTTFTGYLTGALILIVITYITRSTNISPWWFLLSSVPSVVSGGTCALITGIYCYISD--VAKERKKALRMVLNEASLCAGIMVGNVASGYI--YAA-TNALVLFSIAGSLMMFALMYVLLFVPESLNPGDIH-------TGSRVREFFRFDLVTDLIRTCFKRRPNFDRT-IIWLTMIALTIAIFDME----GESTVNYMFVQDK-FNWTIKDFSLFNASRIVIQIVGSIVGMLVLRRVLKMSIVTMAMLSLACCVLESTVR-ATAVYWQELYLGMTLGMMRGVMGPMCRAILSHVAPATEVGKIFALTTSMESVSPLGAAPLYTTVYKATLENYPGAFNFISAALYFVCYIL 485          
BLAST of slc46a-1 vs. Ensembl Fly
Match: CG42514 (gene:FBgn0260388 transcript:FBtr0300657)

HSP 1 Score: 70.4774 bits (171), Expect = 1.540e-12
Identity = 92/395 (23.29%), Postives = 157/395 (39.75%), Query Frame = 1
Query:  394 ILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRL----LGMNFLGIFFGSFLVGLI--SKYAGFSTVLLTTSLSCGFLVILIAF---VIPETVKLQD-----------ENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAI-RLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDM-YIGTIFYIDACLQFCFLIGFIKLHFYLVKG 1512
            IL ++ G +SDR GRKLPL++  +G      M  +    T   T     +I  A L   + G    +  SC +Y+ D S+ ++RT  ++ L    L    +G+  GS L   +    YA   TV  +  L+   +  L A      P    L++           + Q V +    L KP                  RKG  R +LI L++++    T +  E   + +Y      +W    Y  +         + ++  +PL+ +     DT +I IG    +I RL    +T     ++  AV+ S   ++  + +++ SKI    E G  FA+ S  +     I    ++ LY  T +  + G +F +    Q    +  + LH  L K 
Sbjct:  131 ILALFLGSFSDRRGRKLPLLMGLVGKFFYSTMIVVNARMT---TWPVQNIIYSATLPSALTGADVAIFASCFAYISDISSLQQRTIRVTILDVIYLSAMPMGVALGSHLFYNVFNQSYADMFTVNASL-LALAIIYTLCALKWQTTPRQRSLRELGCCGFWGDFFDKQHVKDSLAVLVKP------------------RKGHRRSFLIILLVSMAL-YTFQRDEGQYLYMYTL-GKFDWDVSAYSNFKTFKSSAYVIAMLLAVPLMNKILGWRDTTIIFIGTWAHSIARLFFYFATNTD-LLYAGAVVCSLGPIVGPMIRAMTSKIVPTSERGKVFALLSVCDNAVPFISGVCYSQLYRRTQNTNHGGNVFILTIATQIAVFVMILCLHIVLGKN 500          
BLAST of slc46a-1 vs. Ensembl Zebrafish
Match: zgc:174356 (zgc:174356 [Source:ZFIN;Acc:ZDB-GENE-080215-21])

HSP 1 Score: 103.99 bits (258), Expect = 1.887e-23
Identity = 125/462 (27.06%), Postives = 206/462 (44.59%), Query Frame = 1
Query:  139 EKLIFLVFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYII----AYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCM---FSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCS--TSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLV-ANEETCLSKPESKNVKL------KNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLI 1476
            E +IFL    Y +S  +  P+I+  I   V Q             D L  +++        E E  ++ ++YI     A  +L++IP AI+    G WSD  GR+  + LP + +++S  +    SL    +V  T       +MA  + G+ G    + +S  SY+ D +  +S  RT  ++    M F+G   G  L G + +  G         + C  LV+L   +      +    +LV   EET  S  +    +L      K      F R R G+ R  L +L+L  F N     GEQ ++LLY+ + P  ++  ++G + +     +G  L+ + PL+ R   + +  L  +    +    I++  +   W +FL AV+G+ +G+  AV +SL S I   DE G  F+ ++++EA   LI  TIFN LY  T+  + G  F I A      LI
Sbjct:   15 EPVIFL----YMSSSFIVTPAIQQMIITKVCQ-------------DVLKNVSICSDPEHHKEYEHVQTTSSYIFLQFNAILSLVSIPPAIML---GSWSDSAGRRSVMALPSVLSLLSGGLLLAVSLLDNISVYWT-------LMAAALMGLTGGHVSIFLSSFSYLADLTMGSSSTRTLRMAVAESMIFVGGTIGFLLGGFLEQEFGLQAAF-GAYIGCHVLVLLYIVLWLRDPSVGKNTRLVLCKEETAESGSQEDQSRLFILKYAKMSFKAVFKR-RSGQERMKLHFLMLCTFINNLVAVGEQSILLLYLMYEPREFTTALFGVFNSVKMLLLGFGLLGLFPLLMR--CVKEMTLAKLSAVFRIASYILLALSNNTWMVFLVAVVGAPSGISQAVIRSLSSAIVGPDEQGAMFSFSASVEATCILIAATIFNGLYPLTLPTFPGMPFIIMAAFMLIVLI 445          
BLAST of slc46a-1 vs. Ensembl Zebrafish
Match: SLC46A3 (si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-361])

HSP 1 Score: 85.8853 bits (211), Expect = 1.816e-17
Identity = 107/463 (23.11%), Postives = 200/463 (43.20%), Query Frame = 1
Query:  139 EKLIFL--VFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFG--SFLVGLISKYAGFSTVLLTTSLSCGFLVI--LIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTA--KAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERF---FNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDA--CLQFCFLIGFIK 1488
            ++L F+  V  +Y  +  +  P I+ Y+Y    ++      S  P  +          N    + EVQ++A+ + +       IP+ I+T+    +SD+ GRK+ +I+P IG ++    F      TV    + + ++++A  +  +FG    +   C SYV D     ++ TL   ++ M  +G+  G  S   G     AGF+    T+++   F V+  L A  I E  ++ D ++ +A  +            L+N   + ++    G  R+  + ++L I ++  +    G   +  LY  + P+ W++ + G      YG      IF+   +  F     L +  +  IG+   A+ ++M G       +FL  +    A M   V +S++SK+    E G  FA  +  E  S+      F+ +Y AT+    G +F + A  CL    L+G +K
Sbjct:    2 KRLYFIEPVVAIYAFASFMLYPLIQQYVYR---RLWLEITNSTYPVSENTSQCAANSSNHTSRQEEVQKAASLFSMYTDLSSMIPSLIVTLLLVSYSDQRGRKITIIMPLIGTLIYTLSF-----LTVSFFQLNLYLLIVASFVSALFGGIGTMLGGCFSYVADLCEDGKQKTLRMAVVDM-MIGMLAGVASISTGYFLHAAGFNWPFFTSAI---FQVVNLLYAIFILEETRVIDRSETLACCQ-----------ALRNLACSIYSLFAGGSRRRTWVLVLLIITFSSLSFVNTGGLSIFTLYELNEPLCWTEILVG------YGSAASTSIFITSFVGVFLFSLCLPNIAIAFIGMLSVAVSMLMTGFAKTTLTMFLVRIPAMFAIMPFPVLRSMMSKVVSKSEQGALFACVAFTETLSTNGSAASFSRIYAATVAWCPGFVFLLGAGLCLIPMSLLGILK 435          
BLAST of slc46a-1 vs. Ensembl Zebrafish
Match: SLC46A3 (si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-361])

HSP 1 Score: 84.3445 bits (207), Expect = 5.102e-17
Identity = 103/451 (22.84%), Postives = 194/451 (43.02%), Query Frame = 1
Query:  139 EKLIFL--VFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFG--SFLVGLISKYAGFSTVLLTTSLSCGFLVI--LIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTA--KAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERF---FNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACL 1458
            ++L F+  V  +Y  +  +  P I+ Y+Y    ++      S  P  +          N    + EVQ++A+ + +       IP+ I+T+    +SD+ GRK+ +I+P IG ++    F      TV    + + ++++A  +  +FG    +   C SYV D     ++ TL   ++ M  +G+  G  S   G     AGF+    T+++   F V+  L A  I E  ++ D ++ +A  +            L+N   + ++    G  R+  + ++L I ++  +    G   +  LY  + P+ W++ + G      YG      IF+   +  F     L +  +  IG+   A+ ++M G       +FL  +    A M   V +S++SK+    E G  FA  +  E  S+      F+ +Y AT+    G +F + A L
Sbjct:    2 KRLYFIEPVVAIYAFASFMLYPLIQQYVYR---RLWLEITNSTYPVSENTSQCAANSSNHTSRQEEVQKAASLFSMYTDLSSMIPSLIVTLLLVSYSDQRGRKITIIMPLIGTLIYTLSF-----LTVSFFQLNLYLLIVASFVSALFGGIGTMLGGCFSYVADLCEDGKQKTLRMAVVDM-MIGMLAGVASISTGYFLHAAGFNWPFFTSAI---FQVVNLLYAIFILEETRVIDRSETLACCQ-----------ALRNLACSIYSLFAGGSRRRTWVLVLLIITFSSLSFVNTGGLSIFTLYELNEPLCWTEILVG------YGSAASTSIFITSFVGVFLFSLCLPNIAIAFIGMLSVAVSMLMTGFAKTTLTMFLVRIPAMFAIMPFPVLRSMMSKVVSKSEQGALFACVAFTETLSTNGSAASFSRIYAATVAWCPGFVFLLGAGL 423          
BLAST of slc46a-1 vs. Ensembl Zebrafish
Match: SLC46A3 (si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-361])

HSP 1 Score: 84.3445 bits (207), Expect = 5.102e-17
Identity = 103/451 (22.84%), Postives = 194/451 (43.02%), Query Frame = 1
Query:  139 EKLIFL--VFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFG--SFLVGLISKYAGFSTVLLTTSLSCGFLVI--LIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTA--KAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERF---FNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACL 1458
            ++L F+  V  +Y  +  +  P I+ Y+Y    ++      S  P  +          N    + EVQ++A+ + +       IP+ I+T+    +SD+ GRK+ +I+P IG ++    F      TV    + + ++++A  +  +FG    +   C SYV D     ++ TL   ++ M  +G+  G  S   G     AGF+    T+++   F V+  L A  I E  ++ D ++ +A  +            L+N   + ++    G  R+  + ++L I ++  +    G   +  LY  + P+ W++ + G      YG      IF+   +  F     L +  +  IG+   A+ ++M G       +FL  +    A M   V +S++SK+    E G  FA  +  E  S+      F+ +Y AT+    G +F + A L
Sbjct:    2 KRLYFIEPVVAIYAFASFMLYPLIQQYVYR---RLWLEITNSTYPVSENTSQCAANSSNHTSRQEEVQKAASLFSMYTDLSSMIPSLIVTLLLVSYSDQRGRKITIIMPLIGTLIYTLSF-----LTVSFFQLNLYLLIVASFVSALFGGIGTMLGGCFSYVADLCEDGKQKTLRMAVVDM-MIGMLAGVASISTGYFLHAAGFNWPFFTSAI---FQVVNLLYAIFILEETRVIDRSETLACCQ-----------ALRNLACSIYSLFAGGSRRRTWVLVLLIITFSSLSFVNTGGLSIFTLYELNEPLCWTEILVG------YGSAASTSIFITSFVGVFLFSLCLPNIAIAFIGMLSVAVSMLMTGFAKTTLTMFLVRIPAMFAIMPFPVLRSMMSKVVSKSEQGALFACVAFTETLSTNGSAASFSRIYAATVAWCPGFVFLLGAGL 423          
BLAST of slc46a-1 vs. Ensembl Zebrafish
Match: slc46a3 (solute carrier family 46 member 3 [Source:ZFIN;Acc:ZDB-GENE-100105-2])

HSP 1 Score: 83.9593 bits (206), Expect = 7.761e-17
Identity = 108/454 (23.79%), Postives = 195/454 (42.95%), Query Frame = 1
Query:  166 VYKTSESLFQPSIRLYIY-----ETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSE---ERTTLLSRLLGMNFLGIFFG--SFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDE----NQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIF-WNQTAKAGEQDVILLYVKHSPMNWSDEMYGY--------YLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACL 1458
            +Y  +  +F P ++ Y+Y     E  G I  S + S   +       N  Y+    +   VQ+  + +++       IP+ I  +    +SD  GRK+ ++ P +G  +    + L     V     ++  ++ +  + G+ G    L   C +YV D    +   ++T  ++RL     LG+  G  S   G   K AGF+   LT        ++ +  V+ E++ L +     +   A+E   L + ++   +L+     F   +R+   R  ++ L+LA F + + A  G   + +LY  ++P+ WS+   GY        YL ++ G         + L+ R   L D  +IL+G+   A  LIM         +FL  +    + M   V +S++SKI    E G  FA  + +E  S  +  T+FN +Y AT+  + G  F + A L
Sbjct:   13 LYAFAMFMFYPLLQQYVYRRLWFELSGFIYTSESLSHCSS-------NHSYIT---LHQAVQKETSLFLLHSELCFLIPSLISALLLVSYSDYCGRKVAIVPPLVGEALHALSYVL-----VSRFSFSLNYLLASSFMSGLMGGPPTLIGGCFAYVADLCGEDLEGQKTVRMARL--DMILGVLTGLASLCTGFFIKAAGFTWPFLTAVFLHLINLLYVLVVLKESLVLPNSAVSTSSPSASEAPRLRQTQALTTRLQGVYLLFAASNRR---RNVVLLLMLAAFAFFKLALQGGWSIFILYELNTPLCWSEVFVGYGSALSTAIYLVSFAG---------VALLSR--CLPDAYIILLGLMSVAAGLIMAAFAKTTLLMFLVRLPLLLSIMPTPVLRSMMSKIVSGSEQGAMFACVAFVEMLSVGVSFTVFNSIYAATLSWFSGFSFLLAAGL 435          
BLAST of slc46a-1 vs. Ensembl Xenopus
Match: SLC46A3 (solute carrier family 46 member 3 [Source:NCBI gene;Acc:100492828])

HSP 1 Score: 82.0333 bits (201), Expect = 5.480e-16
Identity = 104/438 (23.74%), Postives = 195/438 (44.52%), Query Frame = 1
Query:  187 LFQPSIRLYIYET------VGQILASRNESQGPTKDALDLINLQYV-----NPLEI-ENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKY----AGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDA 1452
            L +P + +Y + +      + Q + SR   +G +   ++  N+ +      +P  I + EVQ+ A+ +         IP+ ++ +    + DR GRK  ++LPC+GA++S  ++       +    + + V+ ++ +I G  G  A     C SYV D S   ++  +    + M  LG+   S L G+ S Y     GF+   L   L     +  I F + ETV+  +  Q V ++E           +L   ++  F R+   + R  L  L+LA      A  G   +  LY   +P+ W   + G+  A    C  +   F + L  R   L D  ++ IG++     +I++  +     + L  +    A M + V +S++SK+  ++E G  FA  + +E+ + ++  TIF+ +Y AT+  + G  F + A
Sbjct:   19 LVEPVVAIYCFASFFTFPLIQQYVYSRMLIEGSSDGFINGNNISHCETNQSDPAYIHQKEVQKRASLFSSTLDLSALIPSLVMALILVSYGDRHGRKASILLPCLGALLSVLIYC-----AIAFFTLPLAVLYLSYVISGFMGGFATFIGGCFSYVADLSKDAQKKNIRIAFVDM-VLGV--SSGLAGIASGYFIRELGFNWSFLIPGLLHIINICYICFFLEETVQRSEFQQPVLSKE--------GFTELFTGVFLLF-RNASCKKRVVLTLLLLAFMLYLLANFGAVSLFTLYELDAPLCWDSVLVGWGSAFSTFCF-VGSFFGVYLFSR--CLKDAYIVFIGMTSWIGGIILVAFSTTTIAMMLVRIPLLFAAMPLPVLRSIMSKVVLENEQGALFACIACLESITGVLTITIFSAVYAATVMWFPGFSFLLSA 436          
BLAST of slc46a-1 vs. Ensembl Xenopus
Match: slc46a1 (solute carrier family 46 (folate transporter), member 1 [Source:NCBI gene;Acc:100145771])

HSP 1 Score: 80.1073 bits (196), Expect = 1.823e-15
Identity = 80/352 (22.73%), Postives = 141/352 (40.06%), Query Frame = 1
Query:  412 GGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIE-RFFNL--SDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACL 1458
            G WSD+ GR+  L  PCIG  +   ++ + + + +      +   ++   I GI G   ++   C +Y+ D S  + RT  ++ L     +     S + G   K  G+            F  + + F + E+VK +   +L  +                   +  FT S +   R+ L    LA+    T   G +++ +LY    P+ W  ++ GY      G    +L ++  L   R F L  +D+ +  +G       L+++        +F    +   A     V +S LSK+ E+ E G  F+  + +E  S L+   +FN LY AT+    G  F   A L
Sbjct:  116 GPWSDKVGRRPVLFFPCIGLALQAALYLVVMYQELH-----VAYFLIGRFISGISGDFNMILAGCFAYIADVSDRQSRTFRVAILEACLGIAGMVASIIGGHWRKAQGYINPFWLVFAVNLFTAVYVYFCVEESVKDKKPARLFTHRH-------------YQTFFRLFTVSGENNRRRKLCLYSLALLVVVTVHMGAKNLFVLYELSYPLCWDSDLIGY------GSAAEHLTYLSSLAGLRLFQLCLADSWVAEMGFISNISGLVVISLASTTPVMFTGYGLRFFAMATTPVIRSKLSKMVEEGEQGALFSSVACVEGLSYLLATAVFNSLYPATLHFMQGFPFLFGALL 443          
BLAST of slc46a-1 vs. Ensembl Xenopus
Match: ENSXETT00000010934.1 (thymic stromal cotransporter homolog [Source:NCBI gene;Acc:100487203])

HSP 1 Score: 60.4622 bits (145), Expect = 4.101e-9
Identity = 105/428 (24.53%), Postives = 183/428 (42.76%), Query Frame = 1
Query:  298 QYVNPLEIENE--VQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSAL--LTMSCNSYVVD-------CSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFS----TVLLTTSLSCG-FLVILIAFVI----PETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWN----QTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERF-FNLSDTVLILIG-ISMKAIRLIMMGSTFVQWQ--IFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHF 1497
            Q +N   I ++  +Q++ +N+ I Y +++ +   +   +    SD+  RK+ + +P  G ++S  MF L              VI+    I  +FG +AL  LT    +Y           ST  +R+  L  +  +  L  F GS   G I  +   +     +L + SL C  F V+   FV+    PET  ++       NE     K +S+  +    L +   ++    +++   +++++IF +      A  G +DVI ++V   P++W     GY  A  Y    +N I     +  F   + D  LI+IG IS     LIM    FVQW    +++  +   + +   + +SL+SK  ++   G  FA+         +      N LY+AT+D Y G  F + + L F   I  +  HF
Sbjct:   36 QTINSSNISSDEALQKAISNFYIVYNSIMGLGPLLSAYFLAKISDKINRKITICVPLTGYLIS-RMFLLF-------------VILWDWPIEVMFGSAALNGLTGWFTAYWAGVMAWASLASTESKRSIKLIIIELVYGLAGFAGSLASGHIFVHININHHQGAILASCSLGCYVFCVLYSTFVLKIPSPETGCIETNEGTTINET---QKEDSEYTERSRLLGDKSLQTLNQPHQRTTKFILISIFISVILYNIAAGGAEDVINVFVLKKPLSWGPVDVGYGNAATY----INYITSFLGVYVFSMCVGDLGLIIIGMISFSCGILIM---AFVQWTYLYYVARAVMMFSLIPTPIIRSLISKHVQESLYGKVFAVLQLAIGVVYVSSSAGLNKLYQATLDWYSGFCFLLFSTLGFLSAIPVMNKHF 439          
BLAST of slc46a-1 vs. Ensembl Xenopus
Match: ENSXETT00000010952.1 (thymic stromal cotransporter homolog [Source:NCBI gene;Acc:100487203])

HSP 1 Score: 57.3806 bits (137), Expect = 3.578e-8
Identity = 102/417 (24.46%), Postives = 179/417 (42.93%), Query Frame = 1
Query:  298 QYVNPLEIENE--VQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSAL--LTMSCNSYVVD-------CSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFS----TVLLTTSLSCG-FLVILIAFVI----PETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWN----QTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERF-FNLSDTVLILIG-ISMKAIRLIMMGSTFVQWQ--IFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQF 1464
            Q +N   I ++  +Q++ +N+ I Y +++ +   +   +    SD+  RK+ + +P  G ++S  MF L              VI+    I  +FG +AL  LT    +Y           ST  +R+  L  +  +  L  F GS   G I  +   +     +L + SL C  F V+   FV+    PET  ++       NE     K +S+  +    L +   ++    +++   +++++IF +      A  G +DVI ++V   P++W     GY  A  Y    +N I     +  F   + D  LI+IG IS     LIM    FVQW    +++  +   + +   + +SL+SK  ++   G  FA+         +      N LY+AT+D Y G  F + + L F
Sbjct:   36 QTINSSNISSDEALQKAISNFYIVYNSIMGLGPLLSAYFLAKISDKINRKITICVPLTGYLIS-RMFLLF-------------VILWDWPIEVMFGSAALNGLTGWFTAYWAGVMAWASLASTESKRSIKLIIIELVYGLAGFAGSLASGHIFVHININHHQGAILASCSLGCYVFCVLYSTFVLKIPSPETGCIETNEGTTINET---QKEDSEYTERSRLLGDKSLQTLNQPHQRTTKFILISIFISVILYNIAAGGAEDVINVFVLKKPLSWGPVDVGYGNAATY----INYITSFLGVYVFSMCVGDLGLIIIGMISFSCGILIM---AFVQWTYLYYVARAVMMFSLIPTPIIRSLISKHVQESLYGKVFAVLQLAIGVVYVSSSAGLNKLYQATLDWYSGFCFLLFSTLGF 428          
BLAST of slc46a-1 vs. Ensembl Xenopus
Match: ENSXETT00000010845.1 (solute carrier family 46 member 2 [Source:NCBI gene;Acc:100487507])

HSP 1 Score: 54.6842 bits (130), Expect = 2.139e-7
Identity = 90/406 (22.17%), Postives = 170/406 (41.87%), Query Frame = 1
Query:  322 ENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSAL--LTMSCNSY------VVDCSTSEERTTLLSRLLGMNF-LGIFFGSFLVGLISKYAGFS----TVLLTTSL---SCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFF---NLSDTVLILIGISMKAIRLIMMGSTFVQWQ--IFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLI 1476
            ++E Q + +N+ + +  ++ +   +         D+  RK+P+ +P +G  VS  MF L              VI+    I  +FG +AL  LT    +Y      V    +SE + ++   ++ + + +  F GS + G I K    +    +VL+  SL   +   +  L  F IP   +    N       T L K  ++              +    ++ +L+ L L+      A  G  DV+  ++   P++W     GY  A  Y      LIFV   +  +F    L+D V+I IGI   +  + +MG  FVQW    +++ V+   + + +   +S++SK  +    G  F +   + + + ++    F  LY+A++  + G  F + + +    LI
Sbjct:   58 DDEEQNAISNFYLIHNLILALTPILSAYILANIGDKKSRKVPICVPLLGYFVSR-MFLLF-------------VILFNWPIEVMFGSAALNGLTGFFTTYWAGVLAVASLGSSESKRSVRIIIIELVYGVAGFVGSLVSGHIFKNFDIANQKGSVLVILSLCFYAFSLIYSLFIFKIPRIEETGPGNTESTETSTLLMKNPTETSTANGV-------TMTSSSKVFLVLLFLSAILYNAAVGGAVDVLPFFIIKEPLSWGAVEVGYANAAGY------LIFVTSFLGVYFFSKRLTDFVMIGIGILSFSAGIFIMG--FVQWTFLFYVARVVMMFSLIPLPTIRSVISKHVQGSSYGKVFVVLQLLLSITHVVTLISFTKLYQASLKWFHGLCFILASIIALLSLI 434          
BLAST of slc46a-1 vs. Ensembl Mouse
Match: Slc46a2 (solute carrier family 46, member 2 [Source:MGI Symbol;Acc:MGI:1353616])

HSP 1 Score: 72.4034 bits (176), Expect = 4.523e-13
Identity = 90/405 (22.22%), Postives = 172/405 (42.47%), Query Frame = 1
Query:  322 ENEVQRSAANYIIAYRTLINIPAAILTIYWGGW-SDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGI---FGKSALLTMSCNSYV-----------VDCSTSEE--RTTLLSRLLGM-NFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVI---LIAFVIPETV--KLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSR-KGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQF 1464
            E++ Q++ +N+ I Y  ++ +   +L+ Y  GW SDR+ RK+ +    +G ++S                  IG+++  +L + +   +G +AL  + C S+            + CS      R  L+  +LG+  F G      L   I  ++    +L   S+ C    +   L    +PE+   K+      V+         +      +N   N  T  + K   R+ +  L +       A  G  DV+ L+V   P++W+    GY +A+ Y     + + VL +  R F   DT +I+IG+       +++      +  +++  I   A + +   +S +SK+ +D   G  F I       + ++  TI+N +Y+ T+D +IGT F + + L F
Sbjct:   69 EDQQQKAISNFNIIYNLVLGL-TPLLSAYGLGWLSDRYHRKISICTAMLGFLLS-----------------RIGLLLKVMLDWPVEVMYGAAALNGL-CGSFSAYWSGVMALGSLGCSEGRRSVRLILIDLVLGLAGFSGSMASGHLFKQIVGHSAQGLLLTACSVGCAAFALFYSLFVLKVPESKPNKVHPTVDTVSGMMGTYRTLDPDQQDKQNVPRNPRTPGKGKSSQREVVALLFVGAIIYDLAAVGTVDVMALFVLKEPLHWNQVQLGYGMASGYIIFITSFLGVL-VFSRCFR--DTTMIIIGMLSFGSGALLLAFVKETYMFYIARAIMLFALIPITTIRSAMSKLIKDSSYGKIFVILQLCLTLTGVVTSTIYNKIYQLTLDKFIGTCFVLSSFLSF 451          
BLAST of slc46a-1 vs. Ensembl Mouse
Match: Slc46a1 (solute carrier family 46, member 1 [Source:MGI Symbol;Acc:MGI:1098733])

HSP 1 Score: 63.5438 bits (153), Expect = 2.733e-10
Identity = 92/414 (22.22%), Postives = 173/414 (41.79%), Query Frame = 1
Query:  298 QYVNPLEIENEVQRSAANYIIAYRTL-INIPAAILTIYW----GGWSDRFGRK----LPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILI---AFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERF---FNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQF--CFLIGFIK 1488
            Q  +PL  E E        + ++ TL +N+   ++ ++W    G WSDR GR+    L  +   + A+VS  +  L L          +G  ++   +  + G    L  +  + V D S++  RT  ++ L     +     S L G   +  G++       L+   L+++    AF   ETVK     +L               ++    +   +      ++R +L    LAIF   T   G QD++ LY   +P+ W  ++ GY      G    +L ++  L+      F L+DT +  IG++   + +++     +   +F    +   + +   V ++ LSK+  + E G  F+  + + + + L+   IFN +Y AT++   G  F + A L F    LIG ++
Sbjct:   69 QSADPLMKEVET-------LTSHWTLYMNVGGFLVGLFWSTLLGAWSDRVGRRPLLVLASLGLLLQAVVSIFVVQLELH---------VGFFVLGRALCALLGDFNGLLAASFASVADVSSNHSRTFRMALLEACIGVAGTLASLLGGHWLRAQGYANPFW---LALALLIVMALYAAFCFGETVKEPKSTRLF-------------TLRHHRSIARLYVVPAPEKSRMHLALYSLAIFVVVTVHFGAQDILTLYELSAPLCWDSKLIGY------GSAAQHLPYLTSLLGLRLLQFCLADTWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVTTPVIRAKLSKLVSESEQGALFSAVACVNSLAMLMASGIFNSIYPATLNFMKGFPFLLGAGLLFIPAILIGVLE 444          
BLAST of slc46a-1 vs. Ensembl Mouse
Match: Slc46a3 (solute carrier family 46, member 3 [Source:MGI Symbol;Acc:MGI:1918956])

HSP 1 Score: 63.1586 bits (152), Expect = 3.965e-10
Identity = 92/400 (23.00%), Postives = 168/400 (42.00%), Query Frame = 1
Query:  322 ENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVS---CCM---FSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNF-LGIFFGSFLVGLISKY----AGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKY--LIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGY--------YLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACL 1458
              EVQ+ A+ + +       IP  + T      SD  GRKLP++L  +G++ +    CM   F L L+  +  T +             +FG       +C +Y+VD    +E    + R+  ++F LG+  G  L GL S Y     GF      T++    L++ +A+++     L D  +  +++   +S  ES    LK+  +  +   + G +++   L  LI  +        G   +  LY    P+ W++   GY        +L+++ G    +           + L D  +  IGI    + + +   T     +FL  +      M ++V +S+LSK+    E G  FA  + +E  + +   + ++ +Y AT+  Y G IF + A L
Sbjct:   62 REEVQKKASLFNLQVEMSALIPGLVSTFMLLASSDNHGRKLPMVLSSLGSLGTNTWLCMMSYFDLPLQLLIASTFIG-----------ALFGNYTTFWGACFAYIVD--QQKEYKHRIIRIAILDFMLGVVTG--LTGLSSGYFIRELGFVWSYFITAM---VLIVNLAYIL---FFLNDPIKESSSQIVTMSCIES----LKDLFYRTYMLFKNGSSKRQALLCLLIFTLVIYFFVIIGISPIFTLYELGPPLCWNEVYIGYGSALGSVSFLSSFLGIWLFS-----------YCLKDIHIAYIGIFTTMVGMTLAAFTRTTLMMFLVRIPFIFTIMPLSVLRSMLSKVVHSTEQGALFACIAFLETLAGVTSTSAYSGIYSATVAWYPGFIFLLSAGL 425          
BLAST of slc46a-1 vs. Ensembl Mouse
Match: Slc46a3 (solute carrier family 46, member 3 [Source:MGI Symbol;Acc:MGI:1918956])

HSP 1 Score: 63.1586 bits (152), Expect = 3.965e-10
Identity = 92/400 (23.00%), Postives = 168/400 (42.00%), Query Frame = 1
Query:  322 ENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVS---CCM---FSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNF-LGIFFGSFLVGLISKY----AGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKY--LIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGY--------YLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACL 1458
              EVQ+ A+ + +       IP  + T      SD  GRKLP++L  +G++ +    CM   F L L+  +  T +             +FG       +C +Y+VD    +E    + R+  ++F LG+  G  L GL S Y     GF      T++    L++ +A+++     L D  +  +++   +S  ES    LK+  +  +   + G +++   L  LI  +        G   +  LY    P+ W++   GY        +L+++ G    +           + L D  +  IGI    + + +   T     +FL  +      M ++V +S+LSK+    E G  FA  + +E  + +   + ++ +Y AT+  Y G IF + A L
Sbjct:   62 REEVQKKASLFNLQVEMSALIPGLVSTFMLLASSDNHGRKLPMVLSSLGSLGTNTWLCMMSYFDLPLQLLIASTFIG-----------ALFGNYTTFWGACFAYIVD--QQKEYKHRIIRIAILDFMLGVVTG--LTGLSSGYFIRELGFVWSYFITAM---VLIVNLAYIL---FFLNDPIKESSSQIVTMSCIES----LKDLFYRTYMLFKNGSSKRQALLCLLIFTLVIYFFVIIGISPIFTLYELGPPLCWNEVYIGYGSALGSVSFLSSFLGIWLFS-----------YCLKDIHIAYIGIFTTMVGMTLAAFTRTTLMMFLVRIPFIFTIMPLSVLRSMLSKVVHSTEQGALFACIAFLETLAGVTSTSAYSGIYSATVAWYPGFIFLLSAGL 425          
BLAST of slc46a-1 vs. UniProt/SwissProt
Match: sp|Q6DCX5|PCFT_XENLA (Proton-coupled folate transporter OS=Xenopus laevis OX=8355 GN=slc46a1 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.117e-15
Identity = 80/346 (23.12%), Postives = 141/346 (40.75%), Query Frame = 1
Query:  412 GGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIE-RFFNL--SDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIF 1440
            G WSD+ GR+  L+LPCIG  +   ++ L + + +      +G  ++   I GI G   ++   C +Y+ D S  + RT  ++ L     +     S + G   K  G+            F  + + F + E+VK +   +L  +                   +  FT   +   R+ L    LA+    T   G +++ +LY    P+ W  ++ GY      G    +L ++  L   R F L  +D+ +  +G       L+++        +F    +   A     V +S LSK+ E+ E G  F+  + +E  S L+   +FN LY AT+    G  F
Sbjct:  109 GPWSDKVGRRPVLMLPCIGLALQAAVYLLVMYQELH-----VGYFLIGRFISGISGDFNMILAGCFAYIADVSDRQSRTFRVAVLEACLGIAGMVASIIGGHWRKAQGYINPFWLVFAVNLFTALYVYFCVEESVKDKKPARLFTHRH-------------YQSFFRLFTVQGENNRRRKLFLYSLALLVVVTVHMGAKNLFVLYELSYPLCWDSDLIGY------GSAAEHLTYLSSLAGLRLFQLCLADSWVAEMGFISNISGLVVISLASTTPIMFTGYGLRFFAMATTPVIRSKLSKMVEEGEQGALFSSVACVEGLSFLLATGLFNSLYPATLHFMKGFPF 430          
BLAST of slc46a-1 vs. UniProt/SwissProt
Match: sp|Q5F4B8|S46A3_CHICK (Solute carrier family 46 member 3 OS=Gallus gallus OX=9031 GN=SLC46A3 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 6.598e-15
Identity = 107/444 (24.10%), Postives = 182/444 (40.99%), Query Frame = 1
Query:  157 VFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEI-ENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVD-CSTSEERTTLLSRLLGMNFLGIFFG--SFLVGLISKY----AGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKY-LIWLILAIFWNQT-AKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACL 1458
            V  +Y  + SL  P ++ +IY    ++      S   + D          +P  + E  +Q   + + +       +P+ I+        D  GRK  L+LP IGA+++    ++     V        V+ +A  I G+FG  A       +Y+ D C   +++TT ++       + + FG  S L GL S Y     GF+    T SL     +I I F + +TV + +  Q           P S    LK      +   +   ++K  LI ++L IF        G   +  LY    P+ W+ E+Y  Y A  +  + L     + L  +   L D  ++ IGI      ++M         +FL  V    + M + V +S+LSK+    E G  FA  + +E  +  I  ++FN++Y AT+  + G  F + A L
Sbjct:   10 VIFIYIFASSLTSPVVQQFIYR---KLWEEEYNSTAISSDNSSHCERNKSSPTYVMEKAIQEKTSFFNMQLDLTGAVPSLIVAFIIVANGDHQGRKKSLVLPSIGALIADIFLTI-----VSYFSWPTSVLFLATFISGLFGSMATFLGGGFAYIADQCHDEKQKTTRIA------VIDLIFGVVSGLAGLSSGYFLREMGFTWTFATASLLHVVNIIYITFFLQDTVHISEFQQ---------QAPLSYKEHLKETFSGVYMLFKTAPSKKRILIIVLLFIFMTYLFTMFGGSSLFTLYELDEPLCWT-EVYIGYGAAAFTSISLTSFLGVYLFSK--CLKDIYIVFIGIFSYIGGIVMAAFAKTTLLMFLVRVPSLFSIMPIPVLRSMLSKVVLPSEQGAVFACIACLEVLTGTISLSVFNVIYAATVAWFSGFSFLLSASL 427          
BLAST of slc46a-1 vs. UniProt/SwissProt
Match: sp|Q7ZWG6|PCFT_DANRE (Proton-coupled folate transporter OS=Danio rerio OX=7955 GN=slc46a1 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.384e-14
Identity = 92/365 (25.21%), Postives = 148/365 (40.55%), Query Frame = 1
Query:  397 LTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLI----YGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFST---VLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWL-ILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGY-----YLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDA 1452
            + I  G WSDR GR+L LI+P +G         LA++  V  T++ + + +   LI     G+ G    +   C +YV D S    RT  ++ L     L   F S + G   +  G+     ++L T+L+      L    +PETV    + +L +                + Y       S     R+  +WL IL  F   T   G  D+ +LY   +P+ W  E+ GY     +LA      GL  +           L D+ + L+G++   + L+++        +F    +         V +S LSK+ +  E G  FA  + +E   SL+   +FN LY AT+    G  F   A
Sbjct:  120 MVILLGSWSDRAGRRLVLIIPSLG---------LAVQAAVYLTVMYLKLPVFWFLIGRICSGLSGDFNAILAGCFAYVADTSERGSRTFRVAILEACLGLAGMFASIIGGQWRRAQGYINPFWLVLATNLTAALYAYLF---VPETVTPDPQARLFSTRH--------HQAVCRLY------SSDAPPGRRSKLWLYILCFFLVVTVHLGCSDLYVLYELSAPLCWGPELIGYGSAAKHLAYLTSLTGLRAMQCC--------LEDSWVALVGLTSNMVGLVVISVADTTALMFTGYGLCFLFMASTPVLRSKLSKLVDPAEQGALFASVACVEGLCSLVSSGVFNALYPATLHFMKGFPFVFGA 450          
BLAST of slc46a-1 vs. UniProt/SwissProt
Match: sp|Q8CA03|TSCOT_MOUSE (Thymic stromal cotransporter protein OS=Mus musculus OX=10090 GN=Slc46a2 PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 3.164e-12
Identity = 90/405 (22.22%), Postives = 172/405 (42.47%), Query Frame = 1
Query:  322 ENEVQRSAANYIIAYRTLINIPAAILTIYWGGW-SDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGI---FGKSALLTMSCNSYV-----------VDCSTSEE--RTTLLSRLLGM-NFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVI---LIAFVIPETV--KLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSR-KGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQF 1464
            E++ Q++ +N+ I Y  ++ +   +L+ Y  GW SDR+ RK+ +    +G ++S                  IG+++  +L + +   +G +AL  + C S+            + CS      R  L+  +LG+  F G      L   I  ++    +L   S+ C    +   L    +PE+   K+      V+         +      +N   N  T  + K   R+ +  L +       A  G  DV+ L+V   P++W+    GY +A+ Y     + + VL +  R F   DT +I+IG+       +++      +  +++  I   A + +   +S +SK+ +D   G  F I       + ++  TI+N +Y+ T+D +IGT F + + L F
Sbjct:   69 EDQQQKAISNFNIIYNLVLGL-TPLLSAYGLGWLSDRYHRKISICTAMLGFLLS-----------------RIGLLLKVMLDWPVEVMYGAAALNGL-CGSFSAYWSGVMALGSLGCSEGRRSVRLILIDLVLGLAGFSGSMASGHLFKQIVGHSAQGLLLTACSVGCAAFALFYSLFVLKVPESKPNKVHPTVDTVSGMMGTYRTLDPDQQDKQNVPRNPRTPGKGKSSQREVVALLFVGAIIYDLAAVGTVDVMALFVLKEPLHWNQVQLGYGMASGYIIFITSFLGVL-VFSRCFR--DTTMIIIGMLSFGSGALLLAFVKETYMFYIARAIMLFALIPITTIRSAMSKLIKDSSYGKIFVILQLCLTLTGVVTSTIYNKIYQLTLDKFIGTCFVLSSFLSF 451          
BLAST of slc46a-1 vs. UniProt/SwissProt
Match: sp|A5D7V7|S46A3_BOVIN (Solute carrier family 46 member 3 OS=Bos taurus OX=9913 GN=SLC46A3 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.514e-11
Identity = 91/395 (23.04%), Postives = 168/395 (42.53%), Query Frame = 1
Query:  322 ENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVS----CCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVD-CSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSC--GFLVILIAF---VIPETVKLQDENQLVANEETCLSKPES-KNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLA----TYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAI-RLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACL 1458
            + EVQ+  + + +       IP  + T  +   SD  GRK PLIL  +GA+ +    C +   AL          I +++ +  I  +FG       +  +Y+VD C   ++RT  ++ +            FL G++S   G S+      L     FL++ +A    +I   + L+D  +  +++   +S  E+ KN+  + Y+     ++  GE +     L+  +        G   + +LY   SP+ W + + GY  A    T++       +F   + +       T   ++G++M A  R  +M   F+    FL  V      M ++V +S++SK+    E G  FA  + +E    +   + FN +Y AT+    G +F + A L
Sbjct:   62 QEEVQKKVSLFNLEMDISGLIPGLVSTFVFLSHSDHGGRKFPLILSSVGALANSAWLCLLSYFAL---------PIQLLIASTFIGALFGNYTTFLGASFAYIVDQCKEKKQRTIRIAII-----------DFLFGVVSGLTGLSSGYFIRGLGFVWSFLIVTVALFVNLIYILLFLEDSMKESSSQNISVSWTETFKNLFHRTYM---LFKNASGEQQSLCCLLLFTMITYFFVTIGVSPIFVLYELDSPLCWDEVLIGYGSALGSVTFFSSFLGIWLFSYCMEDIHMAFIGTFTTMVGMAMTAFARTTLM--MFLVRLPFLFTV------MPLSVLRSMISKVVHSTEQGTMFACLAFLETLGGITAVSTFNGIYSATVAWCKGFVFLLSAVL 425          
BLAST of slc46a-1 vs. TrEMBL
Match: A0A0H3YKJ6 (Slc46a-1 OS=Schmidtea mediterranea OX=79327 GN=slc46a-1 PE=2 SV=1)

HSP 1 Score: 938.332 bits (2424), Expect = 0.000e+0
Identity = 462/462 (100.00%), Postives = 462/462 (100.00%), Query Frame = 1
Query:  127 MNNREKLIFLVFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHFYLVKG 1512
            MNNREKLIFLVFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHFYLVKG
Sbjct:    1 MNNREKLIFLVFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHFYLVKG 462          
BLAST of slc46a-1 vs. TrEMBL
Match: A0A267H2I0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013497g2 PE=4 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 8.933e-97
Identity = 171/468 (36.54%), Postives = 283/468 (60.47%), Query Frame = 1
Query:  145 LIFLVFLVYKTSESLFQPSIRLYIYETVG-------QILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVS--CCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTT---SLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHFYLVKG 1512
            L+ +V    KTSESL QPS+R+Y+Y+ V         +  S ++    +K+ L + + Q       ++ VQR+A+ Y++AYR L+N+PA   +++ G WSDR GRK P++LP +GAI++  C   S A++ +       +G +M    +YG FGKS ++T++C+SYV D S +E+RT LL RLL MNF G+F GS L  +   +   +++LL     +L+    ++L      E+ +     QLV     C++  ++K+  +++ +  F  R R  +     +++ L +  NQ  K GE DV+LL  KH P NW    YGYYL+ YY  MGLNL+ +LP++ R+ +L D+VL+++G+ MK IR++++G+      ++ SAV+G  AG IV+  KS+ SK+ E+ EIG TF++ S  E+ +SL+GP++F+ +Y +T+D++ G++F +DA +Q   L  F ++  YL KG
Sbjct:   14 LVMMVLFFCKTSESLLQPSVRIYVYQQVCMSKGISLAVCESHSQGDSQSKNRLHMTDEQ-------QSIVQRTASKYLLAYRMLVNLPAVFFSVFAGSWSDRVGRKYPMMLPPLGAILATVCYGASSAIDDSTN-----LGWVMAGAAVYGFFGKSTVMTIACSSYVADISNAEDRTKLLGRLLAMNFFGVFVGSLLTSIFQCFNSVNSMLLVVLVINLAIELTIVLFVHESVESAESASCYQLVC---PCMNT-DTKSWAIRDSI-GFLLRRRPQQLLLLFLFVSLCV--NQICKQGEHDVLLLLSKHEPFNWPGHFYGYYLSVYYASMGLNLVVILPIMMRWMDLRDSVLVMVGLFMKIIRMVIIGTATSTLMLYSSAVLGCFAGFIVSAIKSMTSKLVEESEIGQTFSLLSCAESVASLVGPSLFSPIYASTVDIFPGSVFCLDAGVQILLLCCFFRI--YLTKG 460          
BLAST of slc46a-1 vs. TrEMBL
Match: A0A0R3TX44 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS12417 PE=4 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 1.557e-96
Identity = 178/473 (37.63%), Postives = 265/473 (56.03%), Query Frame = 1
Query:  130 NNREKLIFLVFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDL--INLQYVN----PLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLL-TTSLSCGFLVILIAFVIPETVKLQDE-------------NQLVANEETCLSKPESKN------VKLKNYL---WNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQ 1461
            N    L+  +FL+YKT+E+L Q S RL +Y  V   +           D++DL  + L+Y        +++N +Q++AA +II YR L+N+PA  + +  G WSD  GRK P+++P IGA ++CC+F + L          +  ++   L+YG+ GKS+ L M  +SY+ DCST  ERTT + RL+G NF+G+  GS LV L    + +  VLL   + + G L+IL+  V  E+V +                NQ   +E    S+  S        V + N L   WN+ +R R      Y+  L+ A+ +NQ  KAGEQD ILLYV    + W+D +YG YL  YY  M +NLI + PL++  F+ SD  LILIG+ MK+IRLI    T     IF  AVIG+SAG I++  +SL++K+ +  E+G +FA+ S +E F++L G  +F  +Y AT+ ++ G IF IDACL 
Sbjct:    4 NQLPNLVIFIFLIYKTTETLLQTSTRLQVYRLVCNYITG--------TDSMDLNSVCLRYAEVDKIDSDLDNPIQKNAAPFIIGYRVLLNLPAMFICLILGTWSDSNGRKTPMVIPMIGACLACCLFGVTLIPGYSSIPFQMAWLLTGALLYGLCGKSSALGMGAHSYITDCSTENERTTRIGRLMGSNFIGLCLGSLLVTLFYYLSSYGWVLLFVVAFNIGTLIILVVLV-KESVSINSHDDIGCEYGSLYVMNQPTEDETASGSRETSHKSGRRCCVTMMNSLAESWNYLSRQRPNGRHIYIRILLGAVLFNQVTKAGEQDSILLYVVRRDIGWTDGIYGAYLGVYYASMAINLILIFPLVDYLFHPSDVTLILIGLVMKSIRLIGTALTTDTMLIFSFAVIGASAGFIISSLRSLITKLADSGEVGTSFALMSVLETFANLFGSILFTSVYAATVSVFPGCIFIIDACLH 467          
BLAST of slc46a-1 vs. TrEMBL
Match: A0A2H1CVA1 (Proton-coupled folate transporter OS=Fasciola hepatica OX=6192 GN=D915_000668 PE=4 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 3.353e-93
Identity = 178/497 (35.81%), Postives = 277/497 (55.73%), Query Frame = 1
Query:  130 NNREKLIFLVFLVYKTSESLFQPSIRLYIYETVGQI---------LASRNESQGPTKD------------ALDLINLQ-YVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDE----------NQLVANEETCLSKPESKNVKLKNYLWNF------FTRSRKGEN-RKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHFYL 1503
             +   L+ L F VYKT ESL Q + RL++Y T+            L +R E   P                LD  N++ +   ++ E EVQR + NY+IAYR L N+PA +  + +G  S+R GRK  +++PC G++++C  F+ +L   ++    AI +I+M  L YGI GKS+ ++M  NSY+ D S++EERT LL RL+G+NF G+  G+ L+ + S++ G + +L+  +   G L+I++ F + E++K   E            L  ++    +  +S N  +K   W+       F  S+K  N R  L +L  ++ +NQ  K+GEQD ILL+V + P  W+ E YGYYL  YYGCM + L  +LPLIE      D+ LI+IG+  K  RL+ M  T     +F+SAV GS AG I + T+SL+SK+ +  ++G +FA+ S ME  ++L G T+F  +Y  T+ ++ GT+F ID  L    L GF+ L  ++
Sbjct:   13 KDSPSLVILCFFVYKTVESLLQSANRLHVYSTICSAIVNETTYGNLCNRKEQFRPVLTDNTSRSLWSNVMGLDADNVEIFSRAVDKETEVQRLSGNYLIAYRILFNLPAMVTCLLYGSVSNRIGRKWAMVIPCCGSVMACSWFAASLHPRLRPIPEAITLILMGALSYGICGKSSAMSMGANSYITDVSSTEERTKLLGRLMGVNFFGLCIGAGLLAVFSRFHGIAAILIFVTTCDGLLIIIVIFFVRESLKQPAELSILNTKPIGPGLTVDDSEQRNGTDSHNCFIK--FWSSIRESYRFLFSQKVNNLRAVLPFLFGSVLFNQLTKSGEQDAILLFVTNRPFRWTAEWYGYYLTVYYGCMAILLTVILPLIESKLAPRDSTLIVIGLCFKIARLLCMSFTSSTVLMFISAVGGSVAGFISSGTRSLISKLVQGKDVGASFALVSCMETVANLGGGTLFTSVYNLTLTVFPGTVFLIDTILHVGVLCGFLWLRHHV 507          
BLAST of slc46a-1 vs. TrEMBL
Match: A0A504YXT2 (Proton-coupled folate transporter OS=Fasciola gigantica OX=46835 GN=FGIG_02323 PE=4 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 6.441e-93
Identity = 176/493 (35.70%), Postives = 278/493 (56.39%), Query Frame = 1
Query:  142 KLIFLVFLVYKTSESLFQPSIRLYIYETV----------GQILASRNESQGPTKD-----------ALDLINLQ-YVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDE----------NQLVANEETCLSKPESKNVKLKNYLWNF------FTRSRKGEN-RKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHFYL 1503
             L+ L F VYKT ESL Q + RL++Y T+          G +   + + Q    D            LD  N++ +   ++ E EVQR + NY+IAYR L N+PA +  + +G  S+R GRK  +++PC G++++C  F+ +L   ++    AI +I+M  L YGI GKS+ ++M  NSY+ D S++EERT LL RL+G+NF G+  G+ L+ + S++ G + +L+  +   G ++I++ F++ E++K   E            L  ++    +  +S N  +K   W+       F  S+K  N R  L +L  ++ +NQ  K+GEQD ILL+V + P  W+ E YGYYL  YYGCM + L  +LPLIE      D+ LI+IG+  K  RL+ M  T     +F+SAV GS AG I + T+SL+SK+ +  ++G +FA+ S ME  ++L G T+F  +Y  T+ ++ GT+F ID  L    L GF+ L  ++
Sbjct:   17 SLVILCFFVYKTVESLLQSANRLHVYSTICSAIVNETTYGNLCNRKEQFQPVLTDNTSRSLWSNLMGLDADNVEMFSRAVDKETEVQRLSGNYLIAYRILFNLPAMVTCLLYGSVSNRIGRKWAMVIPCCGSVMACSWFAASLHPRLRPIPEAITLILMGALSYGICGKSSAMSMGANSYITDVSSTEERTKLLGRLMGVNFFGLCIGAGLLAVFSRFHGIAAILIFVATCDGLMIIILIFLVRESLKQPAELSILNTKPIGPGLTVDDSEQRNGTDSHNCFIK--FWSSIRESYRFLFSQKVNNLRAVLPFLFGSVLFNQLTKSGEQDAILLFVTNRPFRWTAEWYGYYLTVYYGCMAILLTVILPLIESKLAPRDSTLIVIGLCFKIARLLCMSFTSSTVLMFISAVGGSVAGFISSGTRSLISKLVQGKDVGASFALVSCMETVANLGGGTLFTSVYNLTLTVFPGTVFLIDTILHVGVLCGFLWLRHHV 507          
BLAST of slc46a-1 vs. Ensembl Cavefish
Match: zgc:174356 (proton-coupled folate transporter-like [Source:NCBI gene;Acc:103039826])

HSP 1 Score: 105.145 bits (261), Expect = 3.688e-24
Identity = 115/404 (28.47%), Postives = 189/404 (46.78%), Query Frame = 1
Query:  322 ENEVQRSAANYIIAYRTLI----NIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVI--------MMAVLIYGIFGKSALLTMSCNSYVVDCS--TSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEE---TCLSKPESKNVKLKNYLWNFFT--RSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLI 1476
            E+E   S A+YI+ + TLI    +IP A+L    G WSDR GR+  L+LP I +++S             G +VA+ ++        ++A  I G+ G    + +   SY+ D +  +S  RT  ++    M F+G   G  L G + ++ G     +       F ++ I   + +           + EE   T   K +S    LK    +F    R R G++R  L  LIL  F N      E  ++LLY+K+ P  ++ EM+G Y +     +G  L+ + PL+ R F   +  L  +    +A   +++  +   W +FL AV+ + AG+  AV +SL S I   DE  + F+ ++++EA   L+G  IFN LY  T+  + G  F I A   FC ++
Sbjct:    8 EDEQVESQASYILLFYTLILSLVSIPPAMLL---GSWSDRVGRRHVLVLPFILSLLS------------GGVLVAMVLVETMSVYWCLLAAGIIGLTGGHVSIFLISFSYLADITIDSSSSRTLRMAVAEAMVFVGGMVGFLLGGFLEQWFGLLEAFIAYICCHVFAILYIVLWLRDPRPFGSALSFPSKEEEEQTSSEKSQSGLFILKYAKLSFQAVFRRRSGQDRLKLQLLILCTFINNLVSI-ETAILLLYLKYKPREFTTEMFGAYNSARMFLLGFGLLGLFPLLMRCFR--EMTLAKLSAVFRAASYVLLAFSTNTWMVFL-AVVATPAGITQAVIRSLSSAIVGPDEQAM-FSFSASVEATCILLGAVIFNGLYPQTLPTFPGFPFIIMA--GFCIIV 389          
BLAST of slc46a-1 vs. Ensembl Cavefish
Match: si:dkey-5g14.1 (solute carrier family 46 member 3-like [Source:NCBI gene;Acc:103033173])

HSP 1 Score: 97.0561 bits (240), Expect = 4.122e-21
Identity = 111/452 (24.56%), Postives = 201/452 (44.47%), Query Frame = 1
Query:  157 VFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNF-LGIFFGSFLV--GLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFF---NLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDA--CLQFCFLIGFIK 1488
            V  VY  +  L  P ++ Y+Y  + Q +     +  P  D     +    N      EVQ++A+ + +       IP+ I T+    +SD+ GRK+ +ILP +G++V C  F       V    + + ++++A  +  +FG    +   C SYV D     ++ TL  R+ G++  +G+F G  L+  G   +  GF+  L+T        ++   F + E+  +  E+ +  +  TC         +L   ++N F    +  N   L++LI  I     A  G   V+ LYV + P+ WS+ + GY  A          +FV   +  +F    L + V++ IG+      ++MM        +FL  +    A M   V +S++SK+    E G  FA  + +++ S+ +    FN +Y +T+  + G  F + A  CL    L+G ++
Sbjct:   10 VVAVYSFACFLLYPLVQQYVYRRLWQEI---TNTSYPALDTSSRCDTNSSNHTSHHYEVQQAASLFSMYSELFSLIPSLIATLVLVAYSDQRGRKITIILPLVGSLVYCLAF-----LAVSFFELNLYLLIIASFVSSLFGGIGTMLGGCFSYVADLCEDGKQKTL--RMAGVDMVIGLFSGVALISSGYFLRETGFNWPLVTAGTVHLVNLLYSVFFLEESRVI--ESSVAEDNRTCGEAIR----RLTFGIYNLFALGSRRRN-VLLVFLITIISTFSFANFGGLTVVTLYVLNEPLCWSEILIGYASALS------TTVFVTSFVGVYFLSRCLPELVIVFIGMLSVFTGMVMMAFAKTTLMMFLVRIPMVLAIMPFPVLRSMMSKVVSKSEQGALFAWVAFVDSLSTNLASAAFNSVYSSTVAWFPGFAFLLAAGICLIPMALLGILR 438          
BLAST of slc46a-1 vs. Ensembl Cavefish
Match: slc46a3 (solute carrier family 46 member 3 [Source:ZFIN;Acc:ZDB-GENE-100105-2])

HSP 1 Score: 66.2402 bits (160), Expect = 3.761e-11
Identity = 94/436 (21.56%), Postives = 186/436 (42.66%), Query Frame = 1
Query:  196 PSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSE---ERTTLLSRLLGMNFLGIF--FGSFLVGLISKYAGFSTVLLTTS----LSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGY--------YLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDA 1452
            P ++ YIY  + Q L+       P+       +  Y N L ++  VQ   +++++       +P+   +     +SD  GRK  ++ P +G +     + +    ++      +  ++ A  + G+ G    LT  C SYV D    E   ++T  ++RL     LG+    GS   G   + AGFS   L  S    L+  +++I++     + +     +     E   LS+ ++   +L+  ++  F  S +      L+ L   IF+ + +  G   + +LY  ++P+ W++ +  Y        YL+++ G         + L+ R+  L D  + L+G+   A+ L M         +FL  +    + M   V ++++SK+    E G  FA  + +E  S  +   +F+ +Y AT+  + G  F + A
Sbjct:   23 PLLQQYIYRRLWQQLSGHPY---PSNQNQSHCSSNYTN-LSLQQAVQTETSHFLLQSELCFILPSLFTSPLLVSYSDYGGRKSAMVPPLLGDLFFTFHYFIVSRFSLN-----LSYVLAAAFLTGLLGGPTTLTGGCFSYVADYCREELAGQKTVRMARL--DMVLGVLSGLGSLCTGFFIRAAGFSWPFLCASILHLLNLIYVLIILKEPPGQNLPPSPSSPGSVIEPPRLSQAQAMTGRLQG-VYLLFAASTRRRRTVLLLLLTAYIFY-KVSNMGGMSIFILYELNAPLCWNEVLVSYGSALSTLIYLSSFTG---------VALLSRW--LPDAPIALLGLLSIAVGLSMAAFAKTTLLMFLVRLPLLLSMMPAPVMRAMMSKLVLSSEQGALFACVAFVEMLSMGLAFPVFSSVYAATISWFSGFSFLLAA 434          
BLAST of slc46a-1 vs. Ensembl Cavefish
Match: slc46a3 (solute carrier family 46 member 3 [Source:ZFIN;Acc:ZDB-GENE-100105-2])

HSP 1 Score: 66.2402 bits (160), Expect = 3.761e-11
Identity = 94/436 (21.56%), Postives = 186/436 (42.66%), Query Frame = 1
Query:  196 PSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSE---ERTTLLSRLLGMNFLGIF--FGSFLVGLISKYAGFSTVLLTTS----LSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGY--------YLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDA 1452
            P ++ YIY  + Q L+       P+       +  Y N L ++  VQ   +++++       +P+   +     +SD  GRK  ++ P +G +     + +    ++      +  ++ A  + G+ G    LT  C SYV D    E   ++T  ++RL     LG+    GS   G   + AGFS   L  S    L+  +++I++     + +     +     E   LS+ ++   +L+  ++  F  S +      L+ L   IF+ + +  G   + +LY  ++P+ W++ +  Y        YL+++ G         + L+ R+  L D  + L+G+   A+ L M         +FL  +    + M   V ++++SK+    E G  FA  + +E  S  +   +F+ +Y AT+  + G  F + A
Sbjct:   23 PLLQQYIYRRLWQQLSGHPY---PSNQNQSHCSSNYTN-LSLQQAVQTETSHFLLQSELCFILPSLFTSPLLVSYSDYGGRKSAMVPPLLGDLFFTFHYFIVSRFSLN-----LSYVLAAAFLTGLLGGPTTLTGGCFSYVADYCREELAGQKTVRMARL--DMVLGVLSGLGSLCTGFFIRAAGFSWPFLCASILHLLNLIYVLIILKEPPGQNLPPSPSSPGSVIEPPRLSQAQAMTGRLQG-VYLLFAASTRRRRTVLLLLLTAYIFY-KVSNMGGMSIFILYELNAPLCWNEVLVSYGSALSTLIYLSSFTG---------VALLSRW--LPDAPIALLGLLSIAVGLSMAAFAKTTLLMFLVRLPLLLSMMPAPVMRAMMSKLVLSSEQGALFACVAFVEMLSMGLAFPVFSSVYAATISWFSGFSFLLAA 434          
BLAST of slc46a-1 vs. Ensembl Cavefish
Match: slc46a1 (solute carrier family 46 member 1 [Source:NCBI gene;Acc:393255])

HSP 1 Score: 62.003 bits (149), Expect = 2.117e-10
Identity = 56/208 (26.92%), Postives = 97/208 (46.63%), Query Frame = 1
Query:  853 ETCLSKPESKNVKLKNY--LWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIF----LSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACL 1458
            E+    PE+K V  ++Y  +++ +T   K  +R +L    L  F   T   G +++ +LY   +P+ W  E+ GY  A  +     +L+ +  L +    L D+ + +IG++     L++         +F    LS +I +S      V +S LSK+ +  E G  FA  + +E   SL+   +FN LY AT+ +  G  F   A L
Sbjct:    8 ESVTPDPETKLVSTRHYRAVYDLYTSGGKKGHRAWLWLYTLCFFLVVTVHFGSRELYVLYELSTPLCWDSELIGYGSAAQHLSYISSLLGLKALQQ---CLEDSWVAIIGLASNVAGLVVFSVADTTALMFTGYGLSFLIMAS----TPVLRSKLSKLVDPSEQGALFASVACVEGLCSLVASGLFNSLYPATLHVMKGFPFLFGAIL 208          
BLAST of slc46a-1 vs. Ensembl Sea Lamprey
Match: zgc:174356 (zgc:174356 [Source:ZFIN;Acc:ZDB-GENE-080215-21])

HSP 1 Score: 91.6633 bits (226), Expect = 3.370e-20
Identity = 98/418 (23.44%), Postives = 184/418 (44.02%), Query Frame = 1
Query:  268 TKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFG--RKLPLILPCIGAIVSCCMF---SLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVI----PETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTA---KAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGL---NLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLI 1476
            TK   DL++  Y      +  VQ  A+   +      NIPA I     G WSDR    R+L + LPC GA ++  +    S + E +V  T+ A         I    G    + +S  SY+   ++ +ER   +  L  M F+G   G  + G    + GF  V  +  L+C  L  L A +      E    +DE Q + +EE            L+ ++       ++GE  + ++ L+LA+     A     G+  ++++++++ P+++++E YGY+       +G+    L  +L  + R F L+   +++     + I   +M      W +FL+  + S +G+  A+ ++  S++    E G  F+  +++E    L+  ++ + LY AT+  + G          FCF++
Sbjct:   45 TKLIADLVSAGYDGG---QMVVQTGASTLFLLQSLATNIPAMITASLLGTWSDRSACMRRLAMTLPCFGAAMASALLMVVSSSPELSVYWTLAA-------SCIASALGGYVTILLSVMSYLATVTSPDERPCRMGVLEAMIFMGGTVGGLVEGAAVAHMGFLGVF-SIQLACNLLATLYALLCIASPAEQRSNEDERQPICSEE-----------GLQLFMSVKVVFRKRGERGRLVMLLLLAVSLLNMACIVVTGDSQILVMFLQYPPLHFTNEQYGYFSGGRTFLVGMCLLVLFPLLLKLARGFTLAKGAMLI-----RVISFGLMACASAPWMVFLAGGLASVSGIPGAMIRAQTSRLATRSEQGAVFSAFASLETAFMLVTSSVLSALYPATLPHFPG----------FCFIL 425          
BLAST of slc46a-1 vs. Ensembl Sea Lamprey
Match: slc46a3 (solute carrier family 46 member 3 [Source:ZFIN;Acc:ZDB-GENE-100105-2])

HSP 1 Score: 83.9593 bits (206), Expect = 1.127e-17
Identity = 106/431 (24.59%), Postives = 188/431 (43.62%), Query Frame = 1
Query:  187 LFQPSIRLYIYETVGQILASRNESQGPT--KDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGV----IMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEE---RTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDA 1452
            L  P  + YIY   G    S N+S G T   +  D+ +       E+E E Q +A+ + +    +  +PA + ++  G +SD  GR+L +ILPCIG          +LE  V   IV++ +    + +  L+ G  G  A +     +Y+ D +       R   L  L+G++  GI  G+ + G + +  G++ V L   L     +I +A V+ ET+  +D      +  +C + P      +      F      G  R  L  L++A  +   A+ G    + L+   +P+ W   + GY  A  +     + + V  L      LSD  + LIGIS   + + M+        +FL  +      M VAV +S++SK     E G  F++  ++E  + ++G  +FN +Y  T+  +   +F + +
Sbjct:   20 LSSPLNQQYIYRRFGNF--STNDSTGSTCSPNGSDVED-------ELEKEAQAAASLFQVRLDLVGFLPAVLASLVLGVYSDTSGRRLMMILPCIG---------YSLESIVYILIVSLELPLPWLYLGCLLRGATGGYASILAGSFAYLTDVANPANLNMRVACLDMLIGISG-GI--GAVISGHMLQAMGYAFVYLCVCLILVLCIIYVACVLEETIT-KD-----IHVRSC-TTPLRATTTVP-----FVQPGGPGSKRWRLALLLVAFTFYLLAEIGGSLPVSLFEMKAPLCWDALLLGYGSAVGFAIFITSFVGVTVLSR---CLSDPPIALIGISTFTVGMAMICGVQTTLMMFLVRLPLMFTIMPVAVMRSMMSKTVLPSEQGTLFSLVGSLELLAGIVGSVVFNNVYAVTVGWFACLVFLLSS 414          
BLAST of slc46a-1 vs. Ensembl Nematostella
Match: EDO36768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHN9])

HSP 1 Score: 130.954 bits (328), Expect = 1.378e-33
Identity = 97/347 (27.95%), Postives = 169/347 (48.70%), Query Frame = 1
Query:  322 ENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGF-STVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAK-AGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAM 1356
            +N VQ S +N++      + +P+   ++  G WSDR GRK  +ILP +G I    + ++     V    + +  +++ ++I G FG  A   +S  SY+ D +    RT  +S L  M FLG   G  + G++  ++GF +T  L   L+C  +   + F++PE+      N  V+N+   L +  S   K+       F R R+G +R YL+ ++            G  DVI+LY    P++ S  + GY+LA  +   GL ++  +PL+ +   LSD ++ L+GI+      I  G    +W +F  AV+    G+ +   +S++SK  +  E G  FA  + +
Sbjct:   52 QNYVQTSTSNWMRYQALALALPSIASSLVLGAWSDRVGRKAIMILPPVGNI----LMNINYMLNVHFFSLNVNYLIIGIVIAGTFGGFATTLLSVFSYMADITDKSHRTLRISILESMVFLGGSVGELVAGVMLDHSGFMATFGLALGLNCC-IAAYVTFILPES---YFPNGQVSNQRCFLLEHLSTAAKV------LFKR-REGNSRLYLLVVLFGAMSVLLLNFGGFNDVIILYCLKEPLHLSSSILGYFLAEVFLIRGLGVVLGMPLMTKLLKLSDYIIALLGITFSCGMFIFFGLAKHKWMMFAGAVLALGDGLPIPCMRSIMSKCVQPSEQGSMFAAVACL 383          
BLAST of slc46a-1 vs. Ensembl Nematostella
Match: EDO38916 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBG4])

HSP 1 Score: 112.079 bits (279), Expect = 7.730e-27
Identity = 96/384 (25.00%), Postives = 172/384 (44.79%), Query Frame = 1
Query:  316 EIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVS--CCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTV--LLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYI-GTIFYIDA 1452
             +E EVQ +AA   I      ++P+ +L++  G WSD  GRK  ++LP IG+++   C +  +  +  V        V+ +  L+ G  G    L M   +Y+ D +   +R   L+ +  + F G        GL     GF+     +   L   F   +  F++PET +  DEN   +   +C         K    +W  ++  R G  RK ++ L L     Q A  G   V+ LY+ HSP+ +S +  GY+ A  +  MG   +F L  + ++ +  +  +  +G+       ++ G +  +  +F+   +G   G +  V K +LS+I   DE G  F+  +++E   S IG    + +Y A +   + G +F++ A
Sbjct:   55 NLEQEVQATAAYVQIGITMFESLPSIVLSLMVGSWSDCHGRKPAILLPVIGSMLEAVCVLIVMYCDLDVY-------VLFIGALLNGCSGYLPTLLMGIMAYIADSTDESQRALRLAIMEALVFTGGMVSQLTSGLWIDKLGFTGPYWFIFGCLVIAFFYTI--FLVPET-RFPDENTEKSRFFSC---------KTLKRIWKVYSTPRDG-GRKNMLLLTLNDALTQVAIQGVGPVMTLYILHSPLCFSADDLGYFSAVRFLVMGFGAVFGLKFLVKWID--ELSISRLGLLTTIGTYVLFGFSTTRAMVFIVGAVGLLNGAVAPVFKGMLSRIVSRDEQGALFSFVASLETLCSFIGALTLSSMYPAFLKHDLPGMVFFLVA 416          
BLAST of slc46a-1 vs. Ensembl Nematostella
Match: EDO42708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0P7])

HSP 1 Score: 105.916 bits (263), Expect = 1.044e-24
Identity = 110/456 (24.12%), Postives = 205/456 (44.96%), Query Frame = 1
Query:  127 MNNREKLIF----LVFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDLI---NLQYVNPL--EIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGL-ISKYA---GFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYI-GTIFYIDA 1452
            M N +KL +    +V  +Y     +  P I+ Y+Y  + +       S+G   DA       N+  +N     IE EVQ  A+   +       +P+ ++++  G W+D  GR+  L LP +G+ +   +  L +          I V+ +   I G+ G    + M   +Y+ D +  ++R+  L+ L  M F G        GL I KY+    +  +L   SLSC    IL+  ++PE+        ++ N+    S    +NV      +  +   R+G  R+ L  L L+         G   VI+L+V H+P+ +S ++ GY  A  Y  +G+  +  + ++ R+ ++ +  +  +G+       I+ G +   + +FL    G   G +V + + ++S+I   DE G  F+  +++E    L G  +FN LY A++  +  G +F++ A
Sbjct:    1 MVNFQKLKWRTPEIVVFLYAYGLFMHVPVIQQYVYSRIAK-------SKGFPYDAHKKTGCGNITILNATMQHIEQEVQSLASYVHLGIVMFAALPSVVMSLLIGSWTDSRGRRPALFLPALGSTLESIVVILVMYFEWP-----IYVLFVGASINGLCGSFTTIIMGTMAYIADTTHEDQRSLRLAILEFMVFFGAMVSQLTSGLWIEKYSFIIPYWFILSCLSLSC----ILVIAIVPES----RPPDVIQNKTAFCSCRSLQNV------YKVYMTPREG-GRRNLFLLTLSSGVTNLILQGVAGVIVLFVLHTPLCFSPKLVGYLSALRYLSIGVGAVLGIKVLGRWLSVIN--ISRVGMLSTMASYILFGFSTKIFIVFLVPFAGLFMGCVVPILRGIMSRIVSQDEQGALFSAVASLEMLCHLCGTFLFNSLYPASLKFHFPGFVFFLGA 427          
BLAST of slc46a-1 vs. Ensembl Nematostella
Match: EDO48562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIS8])

HSP 1 Score: 98.5969 bits (244), Expect = 6.141e-22
Identity = 101/409 (24.69%), Postives = 180/409 (44.01%), Query Frame = 1
Query:  196 PSIRLYIYETVGQILASRNESQGPTKDALDLINL-QYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIV--SCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTV---LLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLY 1404
            P ++ Y+YE   + L   N S        DL +  Q  N     + VQ  A+ YI+AY   + +PA +     G WSD+ GRK  +++   GAIV  S  +F++  +  +   I+  G       I G+ G    + ++  +Y+ D + S+ R   L+ L  + FL    G F  G+   + G+      +L+  L   F+ +L  F +PE++      Q +     CL+  + K+V        +    +K + R  L  L L   +   A+     + +LY K  P+ WS E+ GY+L T         +  +  +     L++     IG       L M+G +   + +F+S V    +G+     ++ +S++   +E G  FAI +++E+ ++     IFN LY
Sbjct:   36 PVLQQYLYERAAKELKINNTSNTTICSPNDLNSTGQSAN-----DAVQEKASQYILAYNLALQLPAVLTACLLGTWSDKNGRKPLMLIVAFGAIVDASVALFTVYTDGPLYPLIIGGG-------INGVMGFYPTMVLALLAYIADTTPSKRRAIKLAVLEALAFLSGTLGHFSSGIYIHHLGYKATFWGILSLHL-INFIYLL--FFLPESM----PKQRIEQSGKCLTLEQVKSV--------YMVYLKKRDGRWILCVLSLLSVFFLFAQYIVTTLGVLYGKRYPLCWSAELVGYFLGTLLCVKAFGAVLGI-WLGSLMKLTNYTAAQIGTLFLIAGLTMIGFSQTTFLMFMSCVANLFSGVPQPCIRAQMSQMVGKEEQGALFAILASLESLTNFTSQLIFNPLY 416          
BLAST of slc46a-1 vs. Ensembl Nematostella
Match: EDO28612 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5Z8])

HSP 1 Score: 96.2857 bits (238), Expect = 2.002e-21
Identity = 99/409 (24.21%), Postives = 176/409 (43.03%), Query Frame = 1
Query:  196 PSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQR---SAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIV--SCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFL-VILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLY 1404
            P ++ Y+YE   + L   N S           N    +P ++ +  QR    A+ YI+AY   + +PA +     G WSD+ GRK  +++   GAIV  S  +F++  +  +   I+  G       I G+ G    + ++  +Y+ D +  E R   L+ L  + FL    G F  G+   + G+        LS   +  I + F +PE++      Q +     CL+  + K+V        +    +K + R  L  L L   +   A+     + +LY K  P+ WS E+ GY+L T         +  + L      L++     IG       L M+G +   + +F+S V    +G+     ++ +S++   +E G  FAI +++E+ ++     IFN LY
Sbjct:   17 PVLQQYLYERAAKELKINNTS-----------NTTICSPNDLNSTGQRYREKASQYILAYNLALQLPAVLTACLLGTWSDKNGRKPLMLIVAFGAIVDASVALFTVYTDGPLYPLIIGGG-------INGVMGFYPTMVLALLAYIADTTPPERRAIKLAVLEALAFLSGTLGHFSSGIYIHHLGYKATFWGI-LSLHLINFIYLLFFLPESM----PKQRIEQSGKCLTLEQVKSV--------YMVYLKKRDGRWILCVLSLLSVFFLFAQYIVTTLGVLYGKRYPLCWSAELVGYFLGTLLCVKAFGAVLGIWL-GSLMKLTNYTAAQIGTLFLIAGLTMIGFSQTTFLMFMSCVANLFSGVPQPCIRAQMSQMVGKEEQGALFAILASLESLTNFTSQLIFNPLY 393          
BLAST of slc46a-1 vs. Ensembl Medaka
Match: si:dkey-5g14.1 (solute carrier family 46 member 3 [Source:HGNC Symbol;Acc:HGNC:27501])

HSP 1 Score: 89.3521 bits (220), Expect = 1.284e-18
Identity = 117/444 (26.35%), Postives = 204/444 (45.95%), Query Frame = 1
Query:  178 SESLFQPSIRLYIYETVGQILA------SRNESQ-GPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFL-GIFFG--SFLVGLISKYAGFSTVLLTTSLSCGFLVILIA-FVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFF-TRSRKGENRKYLIWLILAIFWNQT-AKAGEQDVILLYVKHSPMNWSDEMYGY--YLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQF 1464
            S SL  P ++ YIY  +   L       S N S+  P+  +         N  +   EVQ+ A+ + +    L  IP+ I+T+    +SDR GRK+ +I+P IG+++    F      TV    + I +++ +  +  +FG        C +Y+ D   +E + TL  R+ G++ + G+  G  +   G   + AGF+   L TSL C  L +L A F++ ETVK  +E   + +E T       +   LK  +   + T S      K L+ L++ IF + + A  G   ++ LY  + P+ W++ + GY   L+T    +    +  L     +  +   +++L+GI   A  +I+M        +F+  +    + M   V +S++SK     E G  FA  S +E  +  +   +FN +Y AT+  Y G +F + A L F
Sbjct:   17 SSSLIYPLVQQYIYRRLWLQLTNTTYPISSNSSRCAPSNSS--------SNQTDFHKEVQKQASLFSMYSELLSTIPSLIVTLLLVAYSDRGGRKITIIMPLIGSLIYASSF-----LTVSFFELNIYLLIGSSFLSSLFGGLGTFLGGCYAYIADLCKNERQRTL--RMAGVDMMSGLLSGVAAISTGYFLRAAGFNWPFL-TSLLCQCLTLLYAIFILEETVKAPNEGD-IFDEST-------RRHALKFLVCGVYQTFSGLSSKCKILLALMMFIFTSFSFAFIGGISLVTLYELNKPLCWNEVLIGYGSALSTTVSLISFAGVAAL----TYCRVPQLLIVLLGILSVASGMILMSFAKTTVLMFIVNIPMLLSNMPFPVLRSMMSKNISKSEHGALFACFSFLEILTINVSFGVFNSIYAATVAWYPGFVFSLSAGLCF 432          
BLAST of slc46a-1 vs. Ensembl Medaka
Match: si:dkey-5g14.1 (solute carrier family 46 member 3 [Source:NCBI gene;Acc:101171853])

HSP 1 Score: 87.4261 bits (215), Expect = 5.709e-18
Identity = 119/468 (25.43%), Postives = 208/468 (44.44%), Query Frame = 1
Query:  133 NREKLIFLVFLVYKTSESLFQPSIRLYIYE-------TVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFL-GIFFG--SFLVGLISKYAGFSTVLLTTSLSCGFLVILIA-FVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFF-TRSRKGENRKYLIWLILAIFWNQT-AKAGEQDVILLYVKHSPMNWSDEMYGY--------YLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFL 1473
             R  L+  V  +Y  S  L  P ++ YIY             ++S +    P+  +         N  +   EVQ+ A+ + +    L  IP+ I+T+    +SDR GRK+ +I+P IG+++    F      TV    + I +++ +  +  +FG        C +Y+ D   +E + TL  R+ G++ + G+  G  +   G   + AGF+   L TSL C  L +L A F++ ETVK  +E  +  +E T       +   LK  +   + T S      K L+ L++ IF + + A  G   ++ LY  + P+ W++ + GY        +L ++ G   L    V  L+     +      +I +S     ++M     V+  + LS        M   V +S++SK     E G  FA  S +E+ ++ +   +FN +Y AT+  Y G +F + A L  CF+
Sbjct:    2 KRLYLVEPVVALYAFSSFLIYPLVQQYIYRRLWLQLTNTAYPISSNSSRCAPSNSS--------SNQTDFHKEVQKQASLFSMYSELLSTIPSLIVTLLLVAYSDRGGRKITIIMPLIGSLIYASSF-----LTVSFFELNIYLLIGSSFLSSLFGGLGTFLGGCFAYIADLCKNERQRTL--RMAGVDMMIGLLSGVAAISTGYFLRAAGFNWPFL-TSLLCQCLTLLYAIFILEETVKAPNEGDIF-DEST-------RRHALKYMVCGVYQTFSGLTSKCKILLALMMFIFTSFSFAYVGGISLVTLYELNEPLCWNEVLIGYGSALSTTVFLTSFAGVAALTYCRVPQLLIILLGILSVASGMILMSFAKTTVLMF---IVRIPMLLSI-------MPFPVLRSMMSKNISKSEQGALFACLSFLESLTNNVSSGVFNSIYAATVAWYPGFVFILSAGL--CFI 433          
BLAST of slc46a-1 vs. Ensembl Medaka
Match: si:dkey-5g14.1 (solute carrier family 46 member 3 [Source:NCBI gene;Acc:101171853])

HSP 1 Score: 87.4261 bits (215), Expect = 5.709e-18
Identity = 119/468 (25.43%), Postives = 208/468 (44.44%), Query Frame = 1
Query:  133 NREKLIFLVFLVYKTSESLFQPSIRLYIYE-------TVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFL-GIFFG--SFLVGLISKYAGFSTVLLTTSLSCGFLVILIA-FVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFF-TRSRKGENRKYLIWLILAIFWNQT-AKAGEQDVILLYVKHSPMNWSDEMYGY--------YLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFL 1473
             R  L+  V  +Y  S  L  P ++ YIY             ++S +    P+  +         N  +   EVQ+ A+ + +    L  IP+ I+T+    +SDR GRK+ +I+P IG+++    F      TV    + I +++ +  +  +FG        C +Y+ D   +E + TL  R+ G++ + G+  G  +   G   + AGF+   L TSL C  L +L A F++ ETVK  +E  +  +E T       +   LK  +   + T S      K L+ L++ IF + + A  G   ++ LY  + P+ W++ + GY        +L ++ G   L    V  L+     +      +I +S     ++M     V+  + LS        M   V +S++SK     E G  FA  S +E+ ++ +   +FN +Y AT+  Y G +F + A L  CF+
Sbjct:    2 KRLYLVEPVVALYAFSSFLIYPLVQQYIYRRLWLQLTNTAYPISSNSSRCAPSNSS--------SNQTDFHKEVQKQASLFSMYSELLSTIPSLIVTLLLVAYSDRGGRKITIIMPLIGSLIYASSF-----LTVSFFELNIYLLIGSSFLSSLFGGLGTFLGGCFAYIADLCKNERQRTL--RMAGVDMMIGLLSGVAAISTGYFLRAAGFNWPFL-TSLLCQCLTLLYAIFILEETVKAPNEGDIF-DEST-------RRHALKYMVCGVYQTFSGLTSKCKILLALMMFIFTSFSFAYVGGISLVTLYELNEPLCWNEVLIGYGSALSTTVFLTSFAGVAALTYCRVPQLLIILLGILSVASGMILMSFAKTTVLMF---IVRIPMLLSI-------MPFPVLRSMMSKNISKSEQGALFACLSFLESLTNNVSSGVFNSIYAATVAWYPGFVFILSAGL--CFI 433          
BLAST of slc46a-1 vs. Ensembl Medaka
Match: slc46a1 (solute carrier family 46 member 1 [Source:NCBI gene;Acc:101170694])

HSP 1 Score: 69.3218 bits (168), Expect = 2.940e-12
Identity = 87/367 (23.71%), Postives = 149/367 (40.60%), Query Frame = 1
Query:  412 GGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTI----VAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFST---VLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNY--LWNFFTRSRKG--ENRKYL---IWLI-LAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIE-RFFNL--SDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACL 1458
            G WSD  GR+  LILP +G         LAL+  V   +    + +   ++  L+ G+ G    +   C +YV D S  + RT  ++ L     L     S + G   +  G+     ++L T+L+      L+                    E+ L  P +K +  +++  +W  ++    G   +R +    +WL  L  F   T  +G +++ +LY    P+ W   + GY      G    NL ++  L+  R   L   D+ + L+ ++   I L++         +F    +      +  V +S LSK+ +  E G  FA  + +E    L+G  IFN LY AT+    G  F   A L
Sbjct:  106 GSWSDLAGRRTVLILPNLG---------LALQAAVYLVVMYLKLPVAYFLVGRLLSGLSGDFNAILAGCFAYVADISDRKSRTFRVAVLEACLGLAGILASIIGGQWRRAQGYINPFWLVLATNLASALYASLVV------------------RESVLPDPSAKLLTTRHHKAVWRLYSTGGSGIDGDRSFCRCKLWLYSLCFFVVVTVHSGSRELYVLYELSPPLCWGSALIGY------GSAAQNLAYLTSLLGLRIMQLCLEDSWVALVSLASNIIGLLVFSVADSTQLMFTGYGLCFLFMAVTPVLRSKLSKLVDPSEQGSLFASVACVETLCYLVGSGIFNSLYPATLYFMRGFTFLFAAIL 439          
BLAST of slc46a-1 vs. Ensembl Medaka
Match: slc46a1 (solute carrier family 46 member 1 [Source:NCBI gene;Acc:101170694])

HSP 1 Score: 69.3218 bits (168), Expect = 3.266e-12
Identity = 87/367 (23.71%), Postives = 149/367 (40.60%), Query Frame = 1
Query:  412 GGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTI----VAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFST---VLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNY--LWNFFTRSRKG--ENRKYL---IWLI-LAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIE-RFFNL--SDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACL 1458
            G WSD  GR+  LILP +G         LAL+  V   +    + +   ++  L+ G+ G    +   C +YV D S  + RT  ++ L     L     S + G   +  G+     ++L T+L+      L+                    E+ L  P +K +  +++  +W  ++    G   +R +    +WL  L  F   T  +G +++ +LY    P+ W   + GY      G    NL ++  L+  R   L   D+ + L+ ++   I L++         +F    +      +  V +S LSK+ +  E G  FA  + +E    L+G  IFN LY AT+    G  F   A L
Sbjct:  135 GSWSDLAGRRTVLILPNLG---------LALQAAVYLVVMYLKLPVAYFLVGRLLSGLSGDFNAILAGCFAYVADISDRKSRTFRVAVLEACLGLAGILASIIGGQWRRAQGYINPFWLVLATNLASALYASLVV------------------RESVLPDPSAKLLTTRHHKAVWRLYSTGGSGIDGDRSFCRCKLWLYSLCFFVVVTVHSGSRELYVLYELSPPLCWGSALIGY------GSAAQNLAYLTSLLGLRIMQLCLEDSWVALVSLASNIIGLLVFSVADSTQLMFTGYGLCFLFMAVTPVLRSKLSKLVDPSEQGSLFASVACVETLCYLVGSGIFNSLYPATLYFMRGFTFLFAAIL 468          
BLAST of slc46a-1 vs. Planmine SMEST
Match: SMESG000022670.1 (SMESG000022670.1)

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 460/462 (99.57%), Postives = 460/462 (99.57%), Query Frame = 1
Query:  127 MNNREKLIFLVFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHFYLVKG 1512
            MNNREKLIFLVFLVYKTSESLFQPSIRLYIYETVGQILASRNESQG TKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLT SLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHFYLVKG
Sbjct:    1 MNNREKLIFLVFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGSTKDALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTISLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLIGFIKLHFYLVKG 462          
BLAST of slc46a-1 vs. Planmine SMEST
Match: SMESG000080390.1 (SMESG000080390.1)

HSP 1 Score: 56.6102 bits (135), Expect = 2.573e-8
Identity = 89/406 (21.92%), Postives = 181/406 (44.58%), Query Frame = 1
Query:  322 ENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERT---TLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKL--KNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIR--LIMMGSTFVQW---QIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFL-IGFIKLHFYLV 1506
            +N VQ SAA Y I  +    IP+ I+ I+ G  SD +GRKL +++  IG+ +   +F++ L  ++ G    + V ++   + G+ G    + +   S V D +    R     ++   LG++ +       L+G   +   F   ++T  +      ++  F+     K    N+   N +  +    SK ++L   N  +NF            LI+  ++ F +     G   +I +Y+   P  W+ E+ GYY +     +   +I    L+ ++  +++ ++I +G     +   L  +  ++ +     + + A     +G  V++ +S+ SK    ++ G  F + S+ E  SSL+G  ++N +Y+AT+  Y G ++    C     L I F+ + F+ +
Sbjct:   75 QNRVQSSAAQYNIYAQLSSGIPSMIVVIFSGVLSDFYGRKLVILISWIGSFIGT-IFNILL-ISLNG---PLWVYIVGQFLSGLGGNYGAMLVGVFSLVSDSTGHRNRNFGIIIIEIALGLSMIT---SQALLGKWLRLNNFLWPIVTFGIIFSLSGVMYLFLKETRNKRMTGNR---NIQFHMKMTISKMIELFYNNKKFNFL-----------LIFSTISFFIHTFNFFGNMTLITVYLFGRPFCWNSEILGYYRSISSAIVQFGIILSF-LMLKYMRMNEILIIEVGFLTNILSKLLFAIAPSYAKSICDYLIIIAGFDLFSGASVSLLRSVSSKHVSPEDYGTLFGMMSSFETLSSLLGGVVYNGIYDATLSFYYGFVY----CFAVVLLSIAFVLMIFFFI 453          
BLAST of slc46a-1 vs. Planmine SMEST
Match: SMESG000065078.1 (SMESG000065078.1)

HSP 1 Score: 54.299 bits (129), Expect = 1.339e-7
Identity = 89/391 (22.76%), Postives = 154/391 (39.39%), Query Frame = 1
Query:  292 NLQYVNPLEIENEVQRSAANY---IIAYRTL-INIPAAILTI----YWGGWSDRFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIFGKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISKYAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPESKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLYVKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIGISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEIGVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIF 1440
            NL YV    +    ++   +    I  Y T+ I + ++I TI    ++  +SDRFGRKL  ILP  GA V   +  L +   V    + I VI      YG+FG     T    SY+ D ST +ERT  +  +  +  LG    S + G+  KY  +    + T +      +   F++ E  K+ D       ++T +S  E     +K Y W+     +  E R  LI + +   +   ++     +   Y+   P+         + A+    + L +   +  + +FF  SD  L+   +      L+ M       Q++L+A     +       +  +SK    +E G  F   +  E     I   I    Y  T  ++ G ++
Sbjct:   18 NLAYVCNRNVTGGSEKEKTDKLQEIYTYNTMFIQLSSSIFTILTAPFYSVFSDRFGRKLMFILPGGGAFVKSVIEILII---VYEWPLYIFVITEG--FYGLFGGFNFATSLSYSYIADISTQKERTKRMGIMGVLMGLGALLVSLVSGIWIKYRNYKEPYIFTGVVALLCFLYPIFLLKEPPKINDP------KKTIISPIEQMKSIVKVY-WD-----KPKEYRALLILVFVLFNFYYVSEMSGLSLSGTYLMSYPICMDTIQLSIFGASNMLALNLGIGITIIFLSKFF--SDLFLVFFCLLSGIAYLLQMAFAVSVTQVYLAAASNLFSFSAFPFIRGFMSKRMGPNEQGALFGGLALSETVCGAITKVITIYFYRETFRIFHGMVY 389          
The following BLAST results are available for this feature:
BLAST of slc46a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SLC46A25.623e-1623.08solute carrier family 46 member 2 [Source:HGNC Sym... [more]
SLC46A36.022e-1123.29solute carrier family 46 member 3 [Source:HGNC Sym... [more]
SLC46A36.670e-1123.29solute carrier family 46 member 3 [Source:HGNC Sym... [more]
SLC46A11.882e-823.30solute carrier family 46 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of slc46a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C46C11.21.443e-2525.11pep chromosome:WBcel235:X:4632348:4635780:1 gene:W... [more]
C46C11.21.521e-2325.78pep chromosome:WBcel235:X:4633056:4635784:1 gene:W... [more]
F40F9.56.398e-1423.91pep chromosome:WBcel235:V:9719770:9724118:-1 gene:... [more]
F40F9.56.398e-1423.91pep chromosome:WBcel235:V:9719743:9723978:-1 gene:... [more]
Y4C6B.55.698e-1323.76pep chromosome:WBcel235:IV:5319253:5325033:1 gene:... [more]
back to top
BLAST of slc46a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG158908.059e-1924.41gene:FBgn0030576 transcript:FBtr0073939[more]
CG158908.059e-1924.41gene:FBgn0030576 transcript:FBtr0339769[more]
CG303454.503e-1821.57gene:FBgn0050345 transcript:FBtr0305317[more]
CG303441.275e-1322.03gene:FBgn0050344 transcript:FBtr0088583[more]
CG425141.540e-1223.29gene:FBgn0260388 transcript:FBtr0300657[more]
back to top
BLAST of slc46a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1743561.887e-2327.06zgc:174356 [Source:ZFIN;Acc:ZDB-GENE-080215-21][more]
SLC46A31.816e-1723.11si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-36... [more]
SLC46A35.102e-1722.84si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-36... [more]
SLC46A35.102e-1722.84si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-36... [more]
slc46a37.761e-1723.79solute carrier family 46 member 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc46a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC46A35.480e-1623.74solute carrier family 46 member 3 [Source:NCBI gen... [more]
slc46a11.823e-1522.73solute carrier family 46 (folate transporter), mem... [more]
ENSXETT00000010934.14.101e-924.53thymic stromal cotransporter homolog [Source:NCBI ... [more]
ENSXETT00000010952.13.578e-824.46thymic stromal cotransporter homolog [Source:NCBI ... [more]
ENSXETT00000010845.12.139e-722.17solute carrier family 46 member 2 [Source:NCBI gen... [more]
back to top
BLAST of slc46a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Slc46a24.523e-1322.22solute carrier family 46, member 2 [Source:MGI Sym... [more]
Slc46a12.733e-1022.22solute carrier family 46, member 1 [Source:MGI Sym... [more]
Slc46a33.965e-1023.00solute carrier family 46, member 3 [Source:MGI Sym... [more]
Slc46a33.965e-1023.00solute carrier family 46, member 3 [Source:MGI Sym... [more]
back to top
BLAST of slc46a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DCX5|PCFT_XENLA5.117e-1523.12Proton-coupled folate transporter OS=Xenopus laevi... [more]
sp|Q5F4B8|S46A3_CHICK6.598e-1524.10Solute carrier family 46 member 3 OS=Gallus gallus... [more]
sp|Q7ZWG6|PCFT_DANRE2.384e-1425.21Proton-coupled folate transporter OS=Danio rerio O... [more]
sp|Q8CA03|TSCOT_MOUSE3.164e-1222.22Thymic stromal cotransporter protein OS=Mus muscul... [more]
sp|A5D7V7|S46A3_BOVIN1.514e-1123.04Solute carrier family 46 member 3 OS=Bos taurus OX... [more]
back to top
BLAST of slc46a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKJ60.000e+0100.00Slc46a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A267H2I08.933e-9736.54Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0R3TX441.557e-9637.63Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A2H1CVA13.353e-9335.81Proton-coupled folate transporter OS=Fasciola hepa... [more]
A0A504YXT26.441e-9335.70Proton-coupled folate transporter OS=Fasciola giga... [more]
back to top
BLAST of slc46a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1743563.688e-2428.47proton-coupled folate transporter-like [Source:NCB... [more]
si:dkey-5g14.14.122e-2124.56solute carrier family 46 member 3-like [Source:NCB... [more]
slc46a33.761e-1121.56solute carrier family 46 member 3 [Source:ZFIN;Acc... [more]
slc46a33.761e-1121.56solute carrier family 46 member 3 [Source:ZFIN;Acc... [more]
slc46a12.117e-1026.92solute carrier family 46 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc46a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zgc:1743563.370e-2023.44zgc:174356 [Source:ZFIN;Acc:ZDB-GENE-080215-21][more]
slc46a31.127e-1724.59solute carrier family 46 member 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc46a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc46a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367681.378e-3327.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389167.730e-2725.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427081.044e-2424.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485626.141e-2224.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286122.002e-2124.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc46a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-5g14.11.284e-1826.35solute carrier family 46 member 3 [Source:HGNC Sym... [more]
si:dkey-5g14.15.709e-1825.43solute carrier family 46 member 3 [Source:NCBI gen... [more]
si:dkey-5g14.15.709e-1825.43solute carrier family 46 member 3 [Source:NCBI gen... [more]
slc46a12.940e-1223.71solute carrier family 46 member 1 [Source:NCBI gen... [more]
slc46a13.266e-1223.71solute carrier family 46 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc46a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000022670.10.000e+099.57SMESG000022670.1[more]
SMESG000080390.12.573e-821.92SMESG000080390.1[more]
SMESG000065078.11.339e-722.76SMESG000065078.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006690
GenBankAKN21693.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006690 ID=SMED30006690|Name=slc46a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1565bp
GAAAAATCTGTCATTCGCTGTGAAAATTTGCTGATTTTGCCCTCCTCCAA
TAAAATCTAGCGAGATTTCCTCATTATTTCCCGCCAGTTGGTGAAATTCG
CCTCACTTAATTCCACCCAAAAAAATATGAACAATAGAGAAAAATTAATT
TTCCTCGTATTTCTCGTGTACAAAACATCTGAATCTCTGTTTCAACCGTC
AATAAGATTATACATCTATGAGACTGTGGGACAGATCTTGGCCAGTAGGA
ATGAATCGCAGGGCCCCACCAAGGATGCTTTGGATTTGATCAATTTACAA
TATGTCAACCCGTTGGAGATTGAAAATGAGGTACAGAGATCGGCGGCGAA
TTACATCATTGCTTACAGAACTTTGATTAATATTCCGGCGGCGATTTTGA
CAATTTATTGGGGAGGTTGGAGCGATAGGTTCGGCAGGAAGTTGCCGTTA
ATTTTACCTTGCATTGGAGCAATAGTAAGTTGCTGTATGTTTAGCCTGGC
CTTAGAGAGGACAGTCAAAGGTACGATAGTCGCCATTGGGGTGATAATGA
TGGCAGTACTGATATACGGAATATTCGGCAAGAGTGCGCTATTAACCATG
AGTTGCAACAGCTATGTCGTGGACTGCTCAACCTCTGAGGAAAGGACAAC
TCTATTAAGCAGGCTATTGGGAATGAACTTTCTCGGAATATTCTTCGGTT
CCTTTCTTGTTGGATTAATATCAAAATACGCGGGTTTCTCCACAGTTCTT
TTAACAACTAGTCTGAGTTGTGGATTTCTTGTTATTTTGATAGCGTTTGT
CATTCCGGAAACCGTCAAGTTGCAGGACGAGAACCAACTGGTAGCGAATG
AAGAAACATGTCTGTCGAAGCCGGAATCCAAAAATGTTAAATTAAAGAAT
TATTTGTGGAATTTCTTCACTAGAAGCCGAAAAGGCGAAAATAGGAAATA
TTTGATTTGGTTAATTTTAGCGATATTTTGGAATCAGACCGCAAAGGCGG
GAGAACAGGACGTGATCCTATTGTATGTGAAACATTCTCCGATGAATTGG
TCTGATGAAATGTATGGGTATTACTTGGCGACCTATTACGGTTGCATGGG
CTTGAATTTGATATTCGTTTTGCCATTGATAGAGAGATTTTTTAATCTTT
CTGACACGGTTTTGATTCTCATTGGCATATCCATGAAAGCTATCCGGTTG
ATCATGATGGGGTCGACATTTGTCCAATGGCAGATATTTCTATCTGCCGT
AATCGGAAGCTCGGCCGGCATGATTGTTGCAGTTACCAAATCGCTACTCA
GCAAAATTTGTGAGGATGACGAGATCGGAGTGACGTTCGCCATTACGTCA
GCAATGGAAGCGTTTTCAAGCTTGATCGGCCCGACAATTTTTAATTTATT
ATATGAAGCCACCATGGACATGTACATTGGAACGATATTCTACATTGACG
CCTGTTTGCAGTTCTGTTTCTTGATCGGTTTCATTAAATTGCATTTTTAC
TTGGTGAAAGGTTGAAAGATCTCTCAAAATTGTATGGACATGTTTAAAAC
AATAATATAAAGTCA
back to top

protein sequence of SMED30006690-orf-1

>SMED30006690-orf-1 ID=SMED30006690-orf-1|Name=SMED30006690-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=463bp
MNNREKLIFLVFLVYKTSESLFQPSIRLYIYETVGQILASRNESQGPTKD
ALDLINLQYVNPLEIENEVQRSAANYIIAYRTLINIPAAILTIYWGGWSD
RFGRKLPLILPCIGAIVSCCMFSLALERTVKGTIVAIGVIMMAVLIYGIF
GKSALLTMSCNSYVVDCSTSEERTTLLSRLLGMNFLGIFFGSFLVGLISK
YAGFSTVLLTTSLSCGFLVILIAFVIPETVKLQDENQLVANEETCLSKPE
SKNVKLKNYLWNFFTRSRKGENRKYLIWLILAIFWNQTAKAGEQDVILLY
VKHSPMNWSDEMYGYYLATYYGCMGLNLIFVLPLIERFFNLSDTVLILIG
ISMKAIRLIMMGSTFVQWQIFLSAVIGSSAGMIVAVTKSLLSKICEDDEI
GVTFAITSAMEAFSSLIGPTIFNLLYEATMDMYIGTIFYIDACLQFCFLI
GFIKLHFYLVKG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 69..419
e-value: 6.5E-22
score: 77.9
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 67..453
e-value: 6.2E-37
score: 129.2
NoneNo IPR availablePANTHERPTHR23507FAMILY NOT NAMEDcoord: 6..458
NoneNo IPR availablePANTHERPTHR23507:SF1ZGC:174356coord: 6..458
NoneNo IPR availableCDDcd17386MFS_SLC46coord: 73..456
e-value: 5.54719E-36
score: 134.327
NoneNo IPR availableTMHMMTMhelixcoord: 106..126
NoneNo IPR availableTMHMMTMhelixcoord: 175..197
NoneNo IPR availableTMHMMTMhelixcoord: 338..360
NoneNo IPR availableTMHMMTMhelixcoord: 437..459
NoneNo IPR availableTMHMMTMhelixcoord: 204..226
NoneNo IPR availableTMHMMTMhelixcoord: 365..387
NoneNo IPR availableTMHMMTMhelixcoord: 312..331
NoneNo IPR availableTMHMMTMhelixcoord: 77..96
NoneNo IPR availableTMHMMTMhelixcoord: 400..422
NoneNo IPR availableTMHMMTMhelixcoord: 133..155
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 82..455