E3 ubiquitin-protein ligase KCMF1

Overview
NameE3 ubiquitin-protein ligase KCMF1
Smed IDSMED30006656
Length (bp)1915
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase KCMF1 (SMED30006656) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase KCMF1 (SMED30006656) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase KCMF1 (SMED30006656) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase KCMF1 (SMED30006656) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006656

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
ovarySMED30006656h1SMcG0018342 DN295646smed_ncbi_20240424PMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30006656h1SMcG0018342 DN295646smed_ncbi_20240424PMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30006656h1SMcG0018342 dd_Smed_v4_9359_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30006656h1SMcG0018342 SMED30006656smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cement glandSMED30006656h1SMcG0018342 SMED30006656smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Human
Match: KCMF1 (potassium channel modulatory factor 1 [Source:HGNC Symbol;Acc:HGNC:20589])

HSP 1 Score: 156.762 bits (395), Expect = 1.092e-41
Identity = 62/136 (45.59%), Postives = 92/136 (67.65%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C K  F  RRYKCL+C+DYDLC  C++    +  H +DHPMQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    3 RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Human
Match: KCMF1 (potassium channel modulatory factor 1 [Source:HGNC Symbol;Acc:HGNC:20589])

HSP 1 Score: 90.1225 bits (222), Expect = 1.365e-20
Identity = 36/87 (41.38%), Postives = 58/87 (66.67%), Query Frame = 2
Query:  215 MQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            MQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    1 MQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 87          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Human
Match: RNF138 (ring finger protein 138 [Source:HGNC Symbol;Acc:HGNC:17765])

HSP 1 Score: 53.1434 bits (126), Expect = 1.168e-7
Identity = 28/94 (29.79%), Postives = 46/94 (48.94%), Query Frame = 2
Query:  287 SYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNSLISGESQEYSPKVTRRFSKQTRNGTEISNSLQ 568
            ++ CP+C +   T   L DH N  H    + V CP+C SL  G+ +Q T+N + HL+ +H         +Y   V  +  ++T+  T +  S Q
Sbjct:   62 TFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQF-------DYGEFVNLQLDEETQYQTAVEESFQ 148          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Human
Match: KCMF1 (potassium channel modulatory factor 1 [Source:HGNC Symbol;Acc:HGNC:20589])

HSP 1 Score: 49.2914 bits (116), Expect = 2.289e-7
Identity = 20/46 (43.48%), Postives = 32/46 (69.57%), Query Frame = 2
Query:  215 MQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHL 349
            MQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+
Sbjct:    1 MQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHV 46          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Human
Match: RNF138 (ring finger protein 138 [Source:HGNC Symbol;Acc:HGNC:17765])

HSP 1 Score: 52.7582 bits (125), Expect = 5.988e-7
Identity = 28/94 (29.79%), Postives = 46/94 (48.94%), Query Frame = 2
Query:  287 SYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNSLISGESQEYSPKVTRRFSKQTRNGTEISNSLQ 568
            ++ CP+C +   T   L DH N  H    + V CP+C SL  G+ +Q T+N + HL+ +H         +Y   V  +  ++T+  T +  S Q
Sbjct:  156 TFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQF-------DYGEFVNLQLDEETQYQTAVEESFQ 242          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Celegans
Match: ZK652.6 (pep chromosome:WBcel235:III:7829411:7832503:1 gene:WBGene00022785.1 transcript:ZK652.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK652.6)

HSP 1 Score: 86.2705 bits (212), Expect = 1.634e-17
Identity = 50/147 (34.01%), Postives = 70/147 (47.62%), Query Frame = 2
Query:   71 HEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNN--------HHSDHPMQCLLTKYDYGTFYAGE----VQTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNS-NIEVICPVCASLSDGN--ANQQTKNLIYHLSTKH 466
            HEG+SCD C  + F+  RYKCL C DYDLC  CF  K   +         H   HPMQ +L+  D+   Y G+           S+TCP C   G T      H+  +H  +    VICP+C   ++     +++T+NL  H +  H
Sbjct:    9 HEGVSCDGCAFTAFAGNRYKCLRCSDYDLCFSCFTTKNYGDQQTIADIPIHDESHPMQLILSSVDFDLVYQGDPTRHYDERKIVSFTCPYCNITGLTERQFGTHVLSQHPEAPGYSVICPLCIGNTEMEHIQSKETENLSVHWTEIH 155          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Fly
Match: Kcmf1 (gene:FBgn0037655 transcript:FBtr0300747)

HSP 1 Score: 147.517 bits (371), Expect = 2.636e-37
Identity = 62/134 (46.27%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKH 466
            +HEG+SCD C KS F+ RRYKCL+C+DYDLC  C++    S  H  +HPMQC+LT+ D   ++ GE+  +D   S+TCP C K+G +  TL +H++ EH+ +++EV+CPVCA L  G  N  T +   HL+ +H
Sbjct:    3 RHEGVSCDSCLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHPMQCILTRSDIELYFGGEMLASDQPQSFTCPYCKKMGFSDATLLEHVSAEHTETSLEVVCPVCAGLPGGEPNLVTDDFAGHLTLEH 136          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Fly
Match: Kcmf1 (gene:FBgn0037655 transcript:FBtr0300743)

HSP 1 Score: 147.517 bits (371), Expect = 2.636e-37
Identity = 62/134 (46.27%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKH 466
            +HEG+SCD C KS F+ RRYKCL+C+DYDLC  C++    S  H  +HPMQC+LT+ D   ++ GE+  +D   S+TCP C K+G +  TL +H++ EH+ +++EV+CPVCA L  G  N  T +   HL+ +H
Sbjct:    3 RHEGVSCDSCLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHPMQCILTRSDIELYFGGEMLASDQPQSFTCPYCKKMGFSDATLLEHVSAEHTETSLEVVCPVCAGLPGGEPNLVTDDFAGHLTLEH 136          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Fly
Match: Kcmf1 (gene:FBgn0037655 transcript:FBtr0300748)

HSP 1 Score: 147.517 bits (371), Expect = 2.636e-37
Identity = 62/134 (46.27%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKH 466
            +HEG+SCD C KS F+ RRYKCL+C+DYDLC  C++    S  H  +HPMQC+LT+ D   ++ GE+  +D   S+TCP C K+G +  TL +H++ EH+ +++EV+CPVCA L  G  N  T +   HL+ +H
Sbjct:    3 RHEGVSCDSCLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHPMQCILTRSDIELYFGGEMLASDQPQSFTCPYCKKMGFSDATLLEHVSAEHTETSLEVVCPVCAGLPGGEPNLVTDDFAGHLTLEH 136          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Fly
Match: Kcmf1 (gene:FBgn0037655 transcript:FBtr0300744)

HSP 1 Score: 147.517 bits (371), Expect = 2.636e-37
Identity = 62/134 (46.27%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKH 466
            +HEG+SCD C KS F+ RRYKCL+C+DYDLC  C++    S  H  +HPMQC+LT+ D   ++ GE+  +D   S+TCP C K+G +  TL +H++ EH+ +++EV+CPVCA L  G  N  T +   HL+ +H
Sbjct:    3 RHEGVSCDSCLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHPMQCILTRSDIELYFGGEMLASDQPQSFTCPYCKKMGFSDATLLEHVSAEHTETSLEVVCPVCAGLPGGEPNLVTDDFAGHLTLEH 136          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Fly
Match: Kcmf1 (gene:FBgn0037655 transcript:FBtr0300745)

HSP 1 Score: 147.517 bits (371), Expect = 2.636e-37
Identity = 62/134 (46.27%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKH 466
            +HEG+SCD C KS F+ RRYKCL+C+DYDLC  C++    S  H  +HPMQC+LT+ D   ++ GE+  +D   S+TCP C K+G +  TL +H++ EH+ +++EV+CPVCA L  G  N  T +   HL+ +H
Sbjct:    3 RHEGVSCDSCLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHPMQCILTRSDIELYFGGEMLASDQPQSFTCPYCKKMGFSDATLLEHVSAEHTETSLEVVCPVCAGLPGGEPNLVTDDFAGHLTLEH 136          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Zebrafish
Match: kcmf1 (potassium channel modulatory factor 1 [Source:NCBI gene;Acc:393927])

HSP 1 Score: 154.836 bits (390), Expect = 4.739e-41
Identity = 61/136 (44.85%), Postives = 92/136 (67.65%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C K  F  RRYKCL+C+DYDLC  C++    +  H ++HPMQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    3 RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTEHPMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Xenopus
Match: ube2k (ubiquitin conjugating enzyme E2 K [Source:Xenbase;Acc:XB-GENE-983372])

HSP 1 Score: 156.762 bits (395), Expect = 1.138e-41
Identity = 62/136 (45.59%), Postives = 92/136 (67.65%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C K  F  RRYKCL+C+DYDLC  C++    +  H +DHPMQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    3 RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Xenopus
Match: ube2k (ubiquitin conjugating enzyme E2 K [Source:Xenbase;Acc:XB-GENE-983372])

HSP 1 Score: 145.206 bits (365), Expect = 1.891e-37
Identity = 61/139 (43.88%), Postives = 89/139 (64.03%), Query Frame = 2
Query:   59 MNKKHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            M  KH    CD C K  F  RRYKCL+C+DYDLC  C++    +  H +DHPMQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    1 MISKHLA-DCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Xenopus
Match: rnf138 (ring finger protein 138 [Source:NCBI gene;Acc:549183])

HSP 1 Score: 53.5286 bits (127), Expect = 2.405e-7
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = 2
Query:  290 YTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKH 466
            Y CP+C +   +  +L +H N  H    +E++CP+CA+L  G+  Q T N+I HL+ +H
Sbjct:  134 YKCPLCSEQNLSQRSLLEHCNNVHYYQEVEMVCPICATLPWGDPIQTTGNIIAHLNARH 192          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Mouse
Match: Kcmf1 (potassium channel modulatory factor 1 [Source:MGI Symbol;Acc:MGI:1921537])

HSP 1 Score: 155.221 bits (391), Expect = 3.105e-41
Identity = 62/136 (45.59%), Postives = 92/136 (67.65%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C K  F  RRYKCL+C+DYDLC  C++    +  H +DHPMQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    3 RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Mouse
Match: Kcmf1 (potassium channel modulatory factor 1 [Source:MGI Symbol;Acc:MGI:1921537])

HSP 1 Score: 121.709 bits (304), Expect = 2.429e-32
Identity = 50/107 (46.73%), Postives = 74/107 (69.16%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVI 385
            +HEG+SCD C K  F  RRYKCL+C+DYDLC  C++    +  H +DHPMQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EV+
Sbjct:    3 RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVV 109          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Mouse
Match: Kcmf1 (potassium channel modulatory factor 1 [Source:MGI Symbol;Acc:MGI:1921537])

HSP 1 Score: 92.0485 bits (227), Expect = 8.704e-20
Identity = 36/87 (41.38%), Postives = 58/87 (66.67%), Query Frame = 2
Query:  215 MQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            MQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    1 MQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 87          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Mouse
Match: Rnf138 (ring finger protein 138 [Source:MGI Symbol;Acc:MGI:1929211])

HSP 1 Score: 52.7582 bits (125), Expect = 4.074e-7
Identity = 28/94 (29.79%), Postives = 46/94 (48.94%), Query Frame = 2
Query:  287 SYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNSLISGESQEYSPKVTRRFSKQTRNGTEISNSLQ 568
            ++ CP+C +   T   L DH N  H    + V CP+C SL  G+ +Q T+N + HL+ +H         +Y   V  +  ++T+  T +  S Q
Sbjct:  156 TFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQF-------DYGEFVNLQLDEETQYQTAVEESFQ 242          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Mouse
Match: Rnf138 (ring finger protein 138 [Source:MGI Symbol;Acc:MGI:1929211])

HSP 1 Score: 52.7582 bits (125), Expect = 4.074e-7
Identity = 28/94 (29.79%), Postives = 46/94 (48.94%), Query Frame = 2
Query:  287 SYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNSLISGESQEYSPKVTRRFSKQTRNGTEISNSLQ 568
            ++ CP+C +   T   L DH N  H    + V CP+C SL  G+ +Q T+N + HL+ +H         +Y   V  +  ++T+  T +  S Q
Sbjct:  156 TFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQF-------DYGEFVNLQLDEETQYQTAVEESFQ 242          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. UniProt/SwissProt
Match: sp|Q9P0J7|KCMF1_HUMAN (E3 ubiquitin-protein ligase KCMF1 OS=Homo sapiens OX=9606 GN=KCMF1 PE=1 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 5.245e-41
Identity = 62/136 (45.59%), Postives = 92/136 (67.65%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C K  F  RRYKCL+C+DYDLC  C++    +  H +DHPMQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    3 RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. UniProt/SwissProt
Match: sp|Q6GPB6|KCMF1_XENLA (E3 ubiquitin-protein ligase KCMF1 OS=Xenopus laevis OX=8355 GN=kcmf1 PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 6.028e-41
Identity = 62/136 (45.59%), Postives = 92/136 (67.65%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C K  F  RRYKCL+C+DYDLC  C++    +  H +DHPMQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    3 RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. UniProt/SwissProt
Match: sp|Q1LZE1|KCMF1_BOVIN (E3 ubiquitin-protein ligase KCMF1 OS=Bos taurus OX=9913 GN=KCMF1 PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 6.860e-41
Identity = 62/136 (45.59%), Postives = 92/136 (67.65%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C K  F  RRYKCL+C+DYDLC  C++    +  H +DHPMQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    3 RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. UniProt/SwissProt
Match: sp|Q80UY2|KCMF1_MOUSE (E3 ubiquitin-protein ligase KCMF1 OS=Mus musculus OX=10090 GN=Kcmf1 PE=1 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.172e-40
Identity = 62/136 (45.59%), Postives = 92/136 (67.65%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C K  F  RRYKCL+C+DYDLC  C++    +  H +DHPMQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    3 RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. UniProt/SwissProt
Match: sp|Q7T321|KCMF1_DANRE (E3 ubiquitin-protein ligase KCMF1 OS=Danio rerio OX=7955 GN=kcmf1 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 3.577e-40
Identity = 61/136 (44.85%), Postives = 92/136 (67.65%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C K  F  RRYKCL+C+DYDLC  C++    +  H ++HPMQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    3 RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTEHPMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. TrEMBL
Match: A0A1Z5LG59 (Uncharacterized protein (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.914e-41
Identity = 68/136 (50.00%), Postives = 96/136 (70.59%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGE-VQTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C K+ F  +RYKCL+C+DYDLCG C++    +  H  DHPMQC+LT+ D+  +Y GE V  +   S+TCPICGK+G T  TL++H+  EH+++++EV+CPVCASL  G  N  T++   HLS +H S
Sbjct:    3 RHEGVSCDSCLKANFRGKRYKCLICYDYDLCGTCYEAGATNTRHTPDHPMQCILTRSDFDLYYGGEAVSVEQPQSFTCPICGKMGFTEATLQEHVTSEHTDTSLEVVCPVCASLPGGEPNHVTEDFAAHLSLEHRS 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. TrEMBL
Match: A0A1D2NDM3 (E3 ubiquitin-protein ligase KCMF1 OS=Orchesella cincta OX=48709 GN=Ocin01_03357 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 8.217e-41
Identity = 74/160 (46.25%), Postives = 100/160 (62.50%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEVQTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNSLISGESQEYSPKV---TRRFSKQTR 538
            +HEG+SCD C KS F  RRYKCL C+DYDLC  C++    ++ H SDHP+QC+L++ DY  +Y+GE  T+LA S TCPICG+LG T   L+ H+  EH NSN EV+CP+CAS+  G  N  T +   HL+ +H         E +P      RR  + +R
Sbjct:    3 RHEGVSCDACLKSNFKGRRYKCLRCYDYDLCANCYEGGAATSRHTSDHPVQCILSRGDYDLYYSGESSTELAHSLTCPICGRLGFTESELQSHVTSEHQNSNTEVVCPICASMPGGEPNLVTDDFTAHLTLEHRQQPRDNYVEEAPSARHSLRRVQQPSR 162          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. TrEMBL
Match: A0A2R5L5J1 (Putative potassium channel modulatory factor 1 protein (Fragment) OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 2.932e-40
Identity = 66/136 (48.53%), Postives = 94/136 (69.12%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGE-VQTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C K+ F  +RYKCL+C+DYDLC  C++    +  H  DHPMQC+LT+ D+  +Y GE V  +   S+TCPICGK+G T  TL++H+  EH++++ EV+CPVCA+L  G  N  T++   HLS +H S
Sbjct:    6 RHEGVSCDSCLKANFRGKRYKCLICYDYDLCATCYEAGATNTRHTPDHPMQCILTRSDFDLYYGGEAVSVEQPQSFTCPICGKMGFTEATLQEHVTSEHTDTSFEVVCPVCAALPGGEPNHVTEDFAAHLSLEHRS 141          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. TrEMBL
Match: L7MHS4 (Putative potassium channel modulatory factor 1 protein (Fragment) OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 3.003e-40
Identity = 68/143 (47.55%), Postives = 100/143 (69.93%), Query Frame = 2
Query:   53 YFMNK--KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGE-VQTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            YF+++  +HEG+SCD C K+ F  +RYKCL+C+DYDLCG C++    +  H  DH MQC+LT+ D+  +Y GE V  +   S+TCPICGK+G T +TL++H+  EH++++ EV+CPVCA+L  G  N  T++   HLS +H S
Sbjct:   33 YFVSRMSRHEGVSCDSCMKANFRGKRYKCLICYDYDLCGTCYEAGATNTRHTPDHAMQCILTRSDFDLYYGGEAVSVEQPQSFTCPICGKMGFTELTLQEHVTAEHTDASSEVVCPVCAALPGGEPNHVTEDFAAHLSLEHRS 175          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. TrEMBL
Match: A0A131XB13 (Putative e3 ubiquitin-protein ligase kcmf1 (Fragment) OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 3.534e-40
Identity = 68/143 (47.55%), Postives = 100/143 (69.93%), Query Frame = 2
Query:   53 YFMNK--KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGE-VQTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            YF+++  +HEG+SCD C K+ F  +RYKCL+C+DYDLCG C++    +  H  DH MQC+LT+ D+  +Y GE V  +   S+TCPICGK+G T +TL++H+  EH++++ EV+CPVCA+L  G  N  T++   HLS +H S
Sbjct:   26 YFVSRMSRHEGVSCDSCMKANFRGKRYKCLICYDYDLCGTCYEAGATNTRHTPDHAMQCILTRSDFDLYYGGEAVSVEQPQSFTCPICGKMGFTELTLQEHVTAEHTDASSEVVCPVCAALPGGEPNHVTEDFAAHLSLEHRS 168          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Cavefish
Match: kcmf1 (potassium channel modulatory factor 1 [Source:NCBI gene;Acc:393927])

HSP 1 Score: 148.673 bits (374), Expect = 4.875e-39
Identity = 59/133 (44.36%), Postives = 89/133 (66.92%), Query Frame = 2
Query:   77 GISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            G+SCD C K  F  RRYKCL+C+DYDLC  C++    +  H ++HPMQC+LT+ D+  +Y GE    +   S+TCP CGK+G+T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    1 GVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTEHPMQCILTRVDFDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 133          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Sea Lamprey
Match: kcmf1 (potassium channel modulatory factor 1 [Source:NCBI gene;Acc:393927])

HSP 1 Score: 159.844 bits (403), Expect = 1.170e-43
Identity = 65/136 (47.79%), Postives = 94/136 (69.12%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEVQT-DLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C K  F  RRYKCL+C+DYDLC  C++    ++ H +DHPMQC+LT+ D+  +Y GE  T +   S+TCP CGK+G T  TL++H+  EH+ ++ EV+CPVCA+L  G+ N  T +L  HL+ +H +
Sbjct:    3 RHEGVSCDACMKGNFRGRRYKCLICYDYDLCASCYESGATTSRHAADHPMQCILTRVDFDLYYGGEALTAEQPQSFTCPYCGKMGLTEATLQEHVTSEHAEASTEVVCPVCAALPGGDPNHVTDDLAAHLTVEHRT 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Sea Lamprey
Match: rnf166 (ring finger protein 166 [Source:ZFIN;Acc:ZDB-GENE-061121-1])

HSP 1 Score: 49.6766 bits (117), Expect = 4.347e-7
Identity = 22/61 (36.07%), Postives = 32/61 (52.46%), Query Frame = 2
Query:  284 FSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKH 466
            F++ CP CG        L  H  + H +    V+CPVCAS+  G+ N  + N I HL+ +H
Sbjct:  106 FTFMCPYCGTRNLDQDDLLRHCMERHHSDRTRVVCPVCASMPWGDPNYCSSNFIQHLTHRH 166          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Nematostella
Match: EDO37139 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGR5])

HSP 1 Score: 151.369 bits (381), Expect = 2.607e-40
Identity = 63/136 (46.32%), Postives = 91/136 (66.91%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEVQT-DLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C+K  F  +R+KCL+C+DYDLC  CF+    +  H +DHPMQC+LT+ D+  +Y GE  T D   S+TCP C K+G T   L +H+  EHS++++EV+CPVCA+L  G+ N  T +   HL+  H +
Sbjct:    3 RHEGVSCDSCNKGNFRGKRFKCLICYDYDLCATCFENGVTTTRHTADHPMQCILTRADFDLYYGGEAFTADQPQSFTCPYCSKIGFTEALLLEHVTSEHSDASLEVVCPVCAALPGGDPNYVTDDFAAHLTLGHRT 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Nematostella
Match: EDO25942 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDB0])

HSP 1 Score: 112.464 bits (280), Expect = 1.857e-29
Identity = 49/104 (47.12%), Postives = 71/104 (68.27%), Query Frame = 2
Query:   80 ISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEVQT-DLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVIC 388
            +SCD C+K  F  +R+KCL+C+DYDLC  CF+    +  H +DHPMQC+LT+ D+  +Y GE  T D   S+TCP C K+G T   L +H+  EHS++++EV+C
Sbjct:    2 VSCDSCNKGNFRGKRFKCLICYDYDLCATCFENGVTTTRHTADHPMQCILTRADFDLYYGGEAFTADQPQSFTCPYCSKIGFTEALLLEHVTSEHSDASLEVVC 105          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Nematostella
Match: EDO47831 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKW6])

HSP 1 Score: 50.0618 bits (118), Expect = 2.298e-6
Identity = 33/121 (27.27%), Postives = 55/121 (45.45%), Query Frame = 2
Query:   65 KKHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEVQTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIE---VICPVCASLSDGN 418
            K    ++C  C        RYKCL C++Y LC  CF   + S +H +DH M+      +Y T+ AGE  + L   +   +CG       +L D   +   +  ++   ++ P+ + LS  N
Sbjct:  217 KTEHQVACQVCKNKPVVGFRYKCLHCYNYVLCQDCFWRGKVSQHHKTDHDMR------EYSTWNAGEKGSSLRSKF---LCGSGKKKRPSLPDFPREPEPSRTLDMTNIVPPLPSDLSGPN 328          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Medaka
Match: ENSORLT00000032467.1 (E3 ubiquitin-protein ligase KCMF1 [Source:NCBI gene;Acc:105354713])

HSP 1 Score: 152.91 bits (385), Expect = 3.434e-40
Identity = 59/136 (43.38%), Postives = 93/136 (68.38%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            +HEG+SCD C K  F  RRYKCL+C+DYDLC  C++    +  H ++HPMQC+LT+ D+  +Y GE    +   ++TCP CG++G+T ++L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    3 RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTEHPMQCILTRVDFDLYYGGEAFSVEQPQAFTCPYCGRMGYTEISLQEHVAAEHTETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRA 138          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Medaka
Match: ENSORLT00000002293.2 (E3 ubiquitin-protein ligase KCMF1 [Source:NCBI gene;Acc:105354713])

HSP 1 Score: 152.14 bits (383), Expect = 5.143e-40
Identity = 59/134 (44.03%), Postives = 92/134 (68.66%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKH 466
            +HEG+SCD C K  F  RRYKCL+C+DYDLC  C++    +  H ++HPMQC+LT+ D+  +Y GE    +   ++TCP CG++G+T ++L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H
Sbjct:    3 RHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTEHPMQCILTRVDFDLYYGGEAFSVEQPQAFTCPYCGRMGYTEISLQEHVAAEHTETSTEVICPICAALPGGDPNHVTDDFAAHLTLEH 136          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Medaka
Match: KCMF1 (potassium channel modulatory factor 1 [Source:NCBI gene;Acc:101167220])

HSP 1 Score: 90.5077 bits (223), Expect = 2.748e-19
Identity = 36/87 (41.38%), Postives = 57/87 (65.52%), Query Frame = 2
Query:  215 MQCLLTKYDYGTFYAGEV-QTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNS 472
            MQC+LT+ DY  +Y G+    +   S+TCP CGK+G T  +L++H+  EH+ ++ EVICP+CA+L  G+ N  T +   HL+ +H +
Sbjct:    1 MQCILTRVDYDLYYGGDTFSVEQPQSFTCPYCGKMGFTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFTAHLTLEHRA 87          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 52.7582 bits (125), Expect = 1.140e-6
Identity = 22/51 (43.14%), Postives = 28/51 (54.90%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQ 220
            +H  I CD C K G    R+KC +CFDYDLC  C+     +N H   HP +
Sbjct:  130 RHSNIICDSCKKHGIMGMRWKCKVCFDYDLCTQCY----MNNKHDLSHPFE 176          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 51.9878 bits (123), Expect = 2.014e-6
Identity = 22/51 (43.14%), Postives = 28/51 (54.90%), Query Frame = 2
Query:   68 KHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQ 220
            +H  I CD C K G    R+KC +CFDYDLC  C+     +N H   HP +
Sbjct:   77 RHSNIICDSCKKHGIMGMRWKCKVCFDYDLCTQCY----MNNKHDLSHPFE 123          
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Planmine SMEST
Match: SMESG000028809.1 (SMESG000028809.1)

HSP 1 Score: 961.059 bits (2483), Expect = 0.000e+0
Identity = 545/548 (99.45%), Postives = 547/548 (99.82%), Query Frame = 2
Query:   59 MNKKHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEVQTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNSLISGESQEYSPKVTRRFSKQTRNGTEISNSLQPSNNRSRKTIQPNINSEPTNTSSSTVHSFSTGNFFTSHDQSSFGSSEEPLLHTLLNHLYTWRSRRENATPITKKNFGSEIKTLTNTSSENNSILNETVINQAQPIRRGSSLLNEXXXXXXXXXXXXXXXXVRSTFHDKNKSIRRKLGSRHIIDLTGDNWRXXXXXXXXXXXXXXXXXXXXXXXNQASLQAGXXXXXXXXXXXXXXASLIPWGQDLGPESIFNQLKAIADPKSSLVSSNNSFVRXXXXXXXXXXXXXXXXXHMVTMMNSSLIPGSDSLDFKLSNNIHLPGTCEFITDNEKNPIYVNLEEHLGSIGLFPRDIHSLNQQNVDEQNSILKQRSHFLRDLILSTFITNLDATGDICYGEKKRQYNKNSKAVLI 1702
            MNKKHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEVQTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNSLISGESQEYSPKVTRRFSKQTRNGTEISNSLQPSNNRSRKTIQPNINSEPTNTSSSTVH+FSTGNFFTSHDQSSFGSSEEPLLHTLLNHLYTWRSRRENATPITKKNFGSEIKTLTNTSSENNSILNETVINQAQPIRRGSSLLNETSTSNQSSGNLSRSSTVRSTFHDKNKSIRRKLGSRHIIDLTGDNWRLLDPDNDLFSFDDDDLESISLSLNQASLQAGDIDDSEYMDDDEDIASLIPWGQDLGPESIFNQLKAIADPKSSLVSSNNSFVRLNGSLSSNSNISASSLLHMVTMMNSSLIPGSDSLDFKLSNNIHLPGTCEFITDNEKNPIYVNLEEHLGSIGLFPRDIHSLNQQNVDEQNSILKQRSHFLRDLILSTF+TNLDATGDICYGEKK QYNKNSKAVLI
Sbjct:    1 MNKKHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSDHPMQCLLTKYDYGTFYAGEVQTDLAFSYTCPICGKLGHTVVTLKDHLNQEHSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNSLISGESQEYSPKVTRRFSKQTRNGTEISNSLQPSNNRSRKTIQPNINSEPTNTSSSTVHTFSTGNFFTSHDQSSFGSSEEPLLHTLLNHLYTWRSRRENATPITKKNFGSEIKTLTNTSSENNSILNETVINQAQPIRRGSSLLNETSTSNQSSGNLSRSSTVRSTFHDKNKSIRRKLGSRHIIDLTGDNWRLLDPDNDLFSFDDDDLESISLSLNQASLQAGDIDDSEYMDDDEDIASLIPWGQDLGPESIFNQLKAIADPKSSLVSSNNSFVRLNGSLSSNSNISASSLLHMVTMMNSSLIPGSDSLDFKLSNNIHLPGTCEFITDNEKNPIYVNLEEHLGSIGLFPRDIHSLNQQNVDEQNSILKQRSHFLRDLILSTFVTNLDATGDICYGEKKGQYNKNSKAVLI 548          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCMF11.092e-4145.59potassium channel modulatory factor 1 [Source:HGNC... [more]
KCMF11.365e-2041.38potassium channel modulatory factor 1 [Source:HGNC... [more]
RNF1381.168e-729.79ring finger protein 138 [Source:HGNC Symbol;Acc:HG... [more]
KCMF12.289e-743.48potassium channel modulatory factor 1 [Source:HGNC... [more]
RNF1385.988e-729.79ring finger protein 138 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ZK652.61.634e-1734.01pep chromosome:WBcel235:III:7829411:7832503:1 gene... [more]
back to top
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcmf12.636e-3746.27gene:FBgn0037655 transcript:FBtr0300747[more]
Kcmf12.636e-3746.27gene:FBgn0037655 transcript:FBtr0300743[more]
Kcmf12.636e-3746.27gene:FBgn0037655 transcript:FBtr0300748[more]
Kcmf12.636e-3746.27gene:FBgn0037655 transcript:FBtr0300744[more]
Kcmf12.636e-3746.27gene:FBgn0037655 transcript:FBtr0300745[more]
back to top
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
kcmf14.739e-4144.85potassium channel modulatory factor 1 [Source:NCBI... [more]
back to top
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ube2k1.138e-4145.59ubiquitin conjugating enzyme E2 K [Source:Xenbase;... [more]
ube2k1.891e-3743.88ubiquitin conjugating enzyme E2 K [Source:Xenbase;... [more]
rnf1382.405e-737.29ring finger protein 138 [Source:NCBI gene;Acc:5491... [more]
back to top
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcmf13.105e-4145.59potassium channel modulatory factor 1 [Source:MGI ... [more]
Kcmf12.429e-3246.73potassium channel modulatory factor 1 [Source:MGI ... [more]
Kcmf18.704e-2041.38potassium channel modulatory factor 1 [Source:MGI ... [more]
Rnf1384.074e-729.79ring finger protein 138 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1384.074e-729.79ring finger protein 138 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9P0J7|KCMF1_HUMAN5.245e-4145.59E3 ubiquitin-protein ligase KCMF1 OS=Homo sapiens ... [more]
sp|Q6GPB6|KCMF1_XENLA6.028e-4145.59E3 ubiquitin-protein ligase KCMF1 OS=Xenopus laevi... [more]
sp|Q1LZE1|KCMF1_BOVIN6.860e-4145.59E3 ubiquitin-protein ligase KCMF1 OS=Bos taurus OX... [more]
sp|Q80UY2|KCMF1_MOUSE2.172e-4045.59E3 ubiquitin-protein ligase KCMF1 OS=Mus musculus ... [more]
sp|Q7T321|KCMF1_DANRE3.577e-4044.85E3 ubiquitin-protein ligase KCMF1 OS=Danio rerio O... [more]
back to top
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z5LG592.914e-4150.00Uncharacterized protein (Fragment) OS=Ornithodoros... [more]
A0A1D2NDM38.217e-4146.25E3 ubiquitin-protein ligase KCMF1 OS=Orchesella ci... [more]
A0A2R5L5J12.932e-4048.53Putative potassium channel modulatory factor 1 pro... [more]
L7MHS43.003e-4047.55Putative potassium channel modulatory factor 1 pro... [more]
A0A131XB133.534e-4047.55Putative e3 ubiquitin-protein ligase kcmf1 (Fragme... [more]
back to top
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
kcmf14.875e-3944.36potassium channel modulatory factor 1 [Source:NCBI... [more]
back to top
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
kcmf11.170e-4347.79potassium channel modulatory factor 1 [Source:NCBI... [more]
rnf1664.347e-736.07ring finger protein 166 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO371392.607e-4046.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259421.857e-2947.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478312.298e-627.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000032467.13.434e-4043.38E3 ubiquitin-protein ligase KCMF1 [Source:NCBI gen... [more]
ENSORLT00000002293.25.143e-4044.03E3 ubiquitin-protein ligase KCMF1 [Source:NCBI gen... [more]
KCMF12.748e-1941.38potassium channel modulatory factor 1 [Source:NCBI... [more]
mib21.140e-643.14mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib22.014e-643.14mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-protein ligase KCMF1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000028809.10.000e+099.45SMESG000028809.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006656 ID=SMED30006656|Name=E3 ubiquitin-protein ligase KCMF1|organism=Schmidtea mediterranea sexual|type=transcript|length=1915bp
ATCATATTTATTAAGCAGCGGTTTCGAATTAATATTACATTAATCAAATT
GTTATTTTATGAATAAAAAACACGAAGGCATTAGTTGTGATTTCTGTCAC
AAAAGTGGATTTTCTCTACGTCGTTATAAGTGCCTATTATGCTTTGATTA
TGACTTGTGTGGACCTTGTTTTGATTTTAAAAGAGAATCAAACAATCATC
ATAGTGACCATCCGATGCAATGCTTGCTAACAAAATATGATTATGGAACA
TTTTATGCAGGCGAAGTACAGACGGATTTAGCATTTAGTTACACATGTCC
TATTTGTGGTAAATTAGGCCATACAGTTGTTACGCTGAAAGATCATTTAA
ATCAAGAACATTCTAATTCGAATATAGAAGTAATATGCCCTGTGTGTGCA
AGTTTATCAGATGGAAATGCTAACCAGCAGACTAAAAACCTTATATATCA
TTTATCAACCAAACATAATTCATTAATATCTGGGGAAAGTCAAGAATATT
CTCCAAAAGTGACGAGGCGTTTTTCGAAGCAGACTCGCAATGGAACTGAA
ATATCAAATTCTCTACAACCATCAAATAACAGAAGTAGGAAAACGATTCA
ACCCAATATTAATTCAGAACCAACCAATACTAGTAGTTCTACTGTACACT
CGTTTTCTACCGGCAACTTTTTTACAAGTCATGATCAAAGTTCATTTGGA
AGTTCTGAAGAGCCATTATTACATACACTTTTGAATCATTTATATACTTG
GAGATCTAGACGGGAAAATGCAACTCCGATAACAAAAAAGAATTTTGGCT
CAGAAATTAAAACTCTAACAAATACTTCAAGTGAAAATAACTCAATTTTA
AATGAAACAGTGATTAATCAGGCTCAGCCTATTAGACGGGGCTCATCATT
ATTAAATGAGACATCAACCTCCAATCAAAGTAGTGGTAACCTATCTAGAT
CATCTACAGTTAGATCTACCTTTCATGACAAAAACAAAAGTATCAGGCGA
AAGCTAGGTTCTAGACATATCATTGATCTGACAGGTGATAATTGGCGTCT
TTTAGATCCAGATAATGATTTGTTTAGTTTTGATGATGATGATTTGGAAA
GTATATCATTGAGCCTTAATCAAGCTTCTCTTCAAGCTGGAGACATCGAT
GACTCTGAATATATGGATGATGACGAAGATATTGCATCATTAATTCCGTG
GGGCCAAGATCTTGGTCCAGAATCAATTTTTAACCAACTTAAAGCAATTG
CTGACCCGAAATCATCTTTGGTTTCTTCAAATAATAGTTTTGTGAGATTG
AATGGATCTCTTTCATCGAATTCGAATATTAGTGCGAGCAGTTTATTACA
TATGGTTACTATGATGAATTCCAGTTTGATTCCTGGTAGTGATAGTTTAG
ATTTCAAACTATCAAACAATATTCATCTACCTGGAACTTGCGAATTTATT
ACGGATAACGAAAAAAATCCTATTTATGTCAACCTCGAAGAACATCTTGG
GTCTATCGGCTTGTTTCCTAGAGATATTCATTCATTGAACCAACAAAATG
TCGACGAACAAAATTCTATTTTAAAACAGAGATCTCATTTTCTTCGGGAT
TTAATTTTATCAACATTTATAACTAATCTTGATGCTACCGGTGATATTTG
TTATGGTGAGAAAAAGAGACAGTATAATAAGAATTCAAAGGCTGTACTTA
TAAAAGATTCTTTAGATAAAAAGGAAAAAGAATAATTAAATGTGATTCTT
ATTCATTAGGTTTTATTCACAATTCCATACATGCCTGTTGCAACTGTTGT
ATTTTAAATTTAATCAACTTCGCCGAACTATGATGAATTTTATAAATAGA
TAACAAGATTATTGTTTTATTTTATTATGAAGTAGTTCAATTTTATGTTG
AAAATTTTAGTATTG
back to top

protein sequence of SMED30006656-orf-1

>SMED30006656-orf-1 ID=SMED30006656-orf-1|Name=SMED30006656-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=559bp
MNKKHEGISCDFCHKSGFSLRRYKCLLCFDYDLCGPCFDFKRESNNHHSD
HPMQCLLTKYDYGTFYAGEVQTDLAFSYTCPICGKLGHTVVTLKDHLNQE
HSNSNIEVICPVCASLSDGNANQQTKNLIYHLSTKHNSLISGESQEYSPK
VTRRFSKQTRNGTEISNSLQPSNNRSRKTIQPNINSEPTNTSSSTVHSFS
TGNFFTSHDQSSFGSSEEPLLHTLLNHLYTWRSRRENATPITKKNFGSEI
KTLTNTSSENNSILNETVINQAQPIRRGSSLLNETSTSNQSSGNLSRSST
VRSTFHDKNKSIRRKLGSRHIIDLTGDNWRLLDPDNDLFSFDDDDLESIS
LSLNQASLQAGDIDDSEYMDDDEDIASLIPWGQDLGPESIFNQLKAIADP
KSSLVSSNNSFVRLNGSLSSNSNISASSLLHMVTMMNSSLIPGSDSLDFK
LSNNIHLPGTCEFITDNEKNPIYVNLEEHLGSIGLFPRDIHSLNQQNVDE
QNSILKQRSHFLRDLILSTFITNLDATGDICYGEKKRQYNKNSKAVLIKD
SLDKKEKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
Vocabulary: molecular function
TermDefinition
GO:0061630ubiquitin protein ligase activity
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
GO:0016874ligase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000224cement gland
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR043145Znf_ZZ_sf
IPR039858KCMF1
IPR015880Znf_C2H2-like
IPR000433Znf_ZZ
IPR008598Di19_Zn_binding_dom
IPR007087Znf_C2H2
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 108..136
e-value: 170.0
score: 2.5
coord: 78..101
e-value: 0.045
score: 22.9
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 78..106
score: 8.725
IPR000433Zinc finger, ZZ-typeSMARTSM00291zz_5coord: 4..53
e-value: 5.7E-6
score: 35.8
IPR000433Zinc finger, ZZ-typePFAMPF00569ZZcoord: 4..48
e-value: 6.8E-9
score: 35.4
IPR000433Zinc finger, ZZ-typePROSITEPS01357ZF_ZZ_1coord: 10..37
IPR000433Zinc finger, ZZ-typePROSITEPS50135ZF_ZZ_2coord: 4..51
score: 12.331
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 69..142
e-value: 3.7E-5
score: 25.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 283..302
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 155..195
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 283..306
NoneNo IPR availablePANTHERPTHR12268E3 UBIQUITIN-PROTEIN LIGASE KCMF1coord: 4..301
NoneNo IPR availableCDDcd02338ZZ_PCMF_likecoord: 8..56
e-value: 7.89133E-16
score: 69.6832
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 4..57
IPR043145Zinc finger, ZZ-type superfamilyGENE3DG3DSA:3.30.60.90coord: 1..57
e-value: 2.8E-13
score: 51.2
IPR008598Drought induced 19 protein type, zinc-binding domainPFAMPF05605zf-Di19coord: 77..137
e-value: 2.2E-15
score: 56.7
IPR039858E3 ubiquitin-protein ligase KCMF1PANTHERPTHR12268:SF13E3 UBIQUITIN-PROTEIN LIGASE KCMF1coord: 4..301