dynein heavy chain 6, axonemal

Overview
Namedynein heavy chain 6, axonemal
Smed IDSMED30006652
Length (bp)14080
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of dynein heavy chain 6, axonemal (SMED30006652) t-SNE clustered cells

Violin plots show distribution of expression levels for dynein heavy chain 6, axonemal (SMED30006652) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of dynein heavy chain 6, axonemal (SMED30006652) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for dynein heavy chain 6, axonemal (SMED30006652) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006652

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006652SMESG000004475.1 SmedASXL_002782SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30006652SMESG000004475.1 SmedASXL_002251SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30006652SMESG000004475.1 SmedASXL_003154SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30006652SMESG000004477.1 SMESG000004475.1 SmedASXL_017832SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30006652SMESG000004475.1 SmedASXL_017831SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30006652SMESG000004477.1 SMESG000004475.1 dd_Smed_v4_10969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30006652SMESG000004477.1 SMESG000004475.1 dd_Smed_v4_10969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30006652SMESG000004477.1 SMESG000004475.1 dd_Smed_v4_10969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30006652SMESG000004477.1 SMESG000004475.1 dd_Smed_v4_10969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30006652SMESG000004477.1 SMESG000004475.1 dd_Smed_v4_10969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30006652SMESG000004477.1 SMESG000004475.1 dd_Smed_v6_10969_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30006652SMESG000004477.1 SMESG000004475.1 dd_Smed_v4_10969_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30006652SMESG000004475.1 dd_Smed_v4_38225_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Human
Match: DNAH14 (dynein axonemal heavy chain 14 [Source:HGNC Symbol;Acc:HGNC:2945])

HSP 1 Score: 860.907 bits (2223), Expect = 0.000e+0
Identity = 572/1742 (32.84%), Postives = 933/1742 (53.56%), Query Frame = 2
Query:  446 FQVVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLT---MFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKR---------NISKFCQFIVESIN------YDENSDENKKSKIKNIPIFIVDANLSFLSNEEVEKLSDENDTKLSSRLYFSADNQLQSSYKSRSLIKI-ENIDTSSYSSILSTETPRSNLTTPE------DKIDESRNTIYPIMLPERLI---------------------INEEFYNEFYSFKIPGISVQISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKE-----DQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEA------LKEYERISEPEFQWDIDEFQ---KHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNR--DTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFA-LEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINL 5482
             QVV+A  AK  K FW ++AS ++ V     +  E ++           P  +WL E+  ++ L     F+ FR  KAF TW+ N+   K  K R+ L  +L   D +FQ C+  +  L ED ++  + N    E+NL+   +  +D S+TY+L EF + QL Q     + L  + +  +  +  T     +K  +  Y E  SK    D++     H +  + R+ ++   +F+ L+D    +L  +++           N S    F VE  N      + +NS    K+   +    + ++ L  +S ++ E  +D +  ++ + +    D  L+ +Y     + +   I   S SS  S E    +   PE      D++ E+++        E L+                     I  EF N++  ++ P     + + P        +++++   E  I ++        L +F +     D  NK     S+I+     R      P   ++ +TD  Y   +  +L +  NS+  +  Y       C   ++A      +     ++  EF+  ++ F+   +H+V         N  I+ KRIG  ++ + +   +   YI+ VI + +  +       N   + ++ ++ + L+ DP  +EEF+EH  F+N I++++  ++KE  +++Q++++  + ++ ++ EQ+A+++ L     +LK+++   +  KD  I KF  +LE  I  + + +  +K K R    L      S  ++ + TL  E   L NK + YS+YQ+ F  S S   S + +              +  ++ ++E D+++R  LWE + EW+R    +    L   +V +V++ VS+  H + VLEK LP+++++  +K +V E K  LP+IIAL NP L+ RHW  ++++IG S+  +KN  +  L++ K+ QY+  I ++S  A NE  LE ML K+ D +      L+ H       +II  +DDI+  LEES + ++TIKGS ++  I+  V +W++ L+  +  L+EW+NCQ++WLYLE +F + +I+RQLP E  LF +V   W+ +M + + K   L+  T  GVL+ILQ CN  LE I+KSLEDYLE+KR+IFPR +FLSN ELL+IL+ +++PE+VQ HL K F N+ +L I        ++  ++S EGE   LP+ IRVR   EQWL  +E+ +F+ +K++           +++      +   +L  +Q+ F  +  ++   +   E      +  + + L+ +LE +A  V  D  + +  A L A++++ VH RD   +LL  ++ +  DFEW + ++Y WNE    C V+Q ++ F YG EYLGC+ RLVITPLTDRC++T+  AL+ NLGGC  GPAGTGKTET+KDL+K +G+ CVVFNC + LD   V K   G++Q G+W CFDEFN ++LEVLSVIA+QI +IKAAKD+   RF+ E KEI++N  C +FITMNP Y G VELPDNL  LFRPVAMMVP Y +I E+ILFS GF +A  LS K+TNLY L   QLS Q HY+FGLRS+K VLI+ G  + E   +SE       +E  I+I+AI+ ++ P+   +D+PLF++I+GD+F +   +  N   LE+ I  + ++LG + W  Q EKI    +QL+   GVML+GP+  GKT +R IL+KALT LP+ + 
Sbjct:  193 LQVVSAHTAKHCKEFWVITASFISKVINIVGSVKEVEL----------IPTLEWLSERRHYYLLRQFKIFSDFRMNKAFVTWKLNVKRIKTEKSRSFLYHHLFLADDLFQTCLVYIRGLCEDAINLKNYNDH--ENNLSAICLVKLDSSRTYSLDEFCEEQLQQATQALKQLEDIRNKAISEMKSTFLKVAEKNEIKEYFE--SKLSEDDTT-----HFKLPKYRRLLETFFKFVMLVDYIFQELIRQLMNTAVTLLLELFNGSAGMPFSVEKKNENLIRTFKDNSFPTGKT-TNDCEELVDNSKLHAISVQKSEVKTDTDINEILNSVEVGKD--LRKTYAPIFEVNLCLRIPAESDSSENSKENFHESDQCPEECVMFEDEMSENKDNCVKKHSSEELLPKAKKSKEISYNLEDIISDTEIETEFENKYMYYEFPEFPTNLFIDPNRLEFSVKIQNMLTNMEKCITTITPLCQDPQLSIFIDLVSIMDLPNKTG---SIIHYKEQTR-----WPDCHILFETDPAYQNIIVNLLTIIGNSMGLVNAYSHKFIKYCTMTEKAKIMSMKISSMGELTSKEFEAILNRFRNYFRHIV---------NMAIE-KRIGIFNVVSLDYQSECLLYIDNVIHMSHTLIQSVIEKKNKNLLEVVESSLQQLECDPTEIEEFLEHFIFLNAISSKISKLEKEFLTMSQLYSVAKHHQIHISEEQIAIFQVLLLKFSQLKSSMKLSKINKDTAITKFRDNLEACISGLHVDVGNLKAKIRTPLLLCAGTQVSTAMEMIQTLSGEAASLTNKAKAYSHYQDCFSDSQSHMHSVNVEE---------ITQIVLSEISDIEGDLTLRKKLWEAQEEWKRASWEWRNSSLQSIDVESVQRNVSKLMHIISVLEKGLPKSDMVTHLKQVVTEFKQELPIIIALGNPCLKPRHWEALQEIIGKSVPLDKNCKVENLLALKMFQYENEINDMSTSATNEAALEKMLFKIIDFWNTTPLPLILHHTEIYSIFIIPSIDDISAQLEESQVILATIKGSPHIGPIKDLVNEWDQNLTLFSYTLEEWMNCQRNWLYLEPVFHSSEIRRQLPAETELFSQVISMWKKIMSKIQNKQNALQITTSAGVLEILQNCNIHLEHIKKSLEDYLEVKRLIFPRFYFLSNAELLDILADSRNPESVQPHLVKCFENIKQLLIWKQDIGPPAVKMLISAEGEGLVLPKKIRVRSAVEQWLVNVEKSMFDVLKKE-----------RYI------YNIILLFQSQIMFYNDCVKSFVSSYSREK-----LEKVHAGLMCHLEEVADLVVLDTSNSRTKAILGALLILYVHCRDIVINLLLKNIFNAEDFEWTRHLQYKWNEKQKLCYVSQGNASFTYGYEYLGCTSRLVITPLTDRCWLTLMEALHLNLGGCPAGPAGTGKTETVKDLAKSLGKHCVVFNCFEDLDYKIVRKFFFGLVQSGAWSCFDEFNLIDLEVLSVIASQILTIKAAKDNYSARFVLEGKEIRINMSCAVFITMNPRYGGGVELPDNLKSLFRPVAMMVPHYQMIAEIILFSFGFKSANSLSGKLTNLYELARKQLSQQDHYNFGLRSLKIVLIMAGTKKREFKCLSEA------DETLIVIEAIREASLPKCPPEDVPLFENIIGDIFPEVTVLKVNQLALEKVIYTATQQLGLQNWSSQKEKIIQFYNQLQVCVGVMLVGPTGGGKTTVRRILEKALTLLPIADF 1857          

HSP 2 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 462/1453 (31.80%), Postives = 748/1453 (51.48%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEIN--------------KEIGENVSISPETKLQ-----------KIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYS-----LEESDNRIGQKQWATF----IKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETW-------IKWNLSENPFDMSSYNFKE----------------------FSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQ--SEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNN-EVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIG--HLTDFQSINSFIH-SNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSN-----------SALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNV----LEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSI--GKSLSEWSSNVRIRIDFIGFWC----YSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVL 13289
            E   VE+Y+ K   +L SV P  + +I AL++L+KA ++E+RVY  PP LV  VMNAVC+LL   P+WA AKLLL +  FL+KL+N +KD+I  K++  L++     DFNP  +  VS+AC S+CQWV+A+ +YH V  ++ PK+  V EA+  L+I++Q+L  KQ  L+ VE+H+  L   Y+++V E++ L  R  + + R   A+ L+  ++ EK RW  +I   D   + I+G  + SAA   ++G  T  +R++   KW        I +   +  ++     Y I  WHN GLP      EN  +I+  ++WPLLIDP +Q  ++++       + +S +  +Y   +E A++ G ++ L+++   + P L  +L+K+ +++     I++G+ E EY+ +F+LYL + + NP  + SV   VT+INFTV   GL++QLLS +V+ E P +E++R++ L + + D  +L  LE+KTL LLQ +   I++D ++   L KSK+T+ +I KR+E T +AE ++Q  RK YLP+A RGA +YF++ADL  +NYMYQ+SL WF  +F   V   +              KE+ E +SIS E  L+             ID +T   + + S  LF+  +  F+F L T IM+ +     +++    + +++W  F    I ++  S++    L +    G    +  +++WL+   W +C+++   L + FS LC S       W         ++L   PF   + + +E                      F  + L SF++LIL+ +L    L +S R ++   +G K+      NL + +  S+A+ P++ I     D  N +++   EL+G T ++ I+S+GR QA KAE LI K      +W+FLQNC L  S+MP L  ++E+        D  F+L LS+  +S FPI +L+  LKIA+ESP G+K+ LL++F   G+G VTE I+ N    +  +K++F+LC FNAV+ ER+NYG LG+++ Y FN SDL ++IK +   L     + W AL  +IG + YGGR+ DN D+RCL  LL  +               +P+VL      +   SI  +IH       + L  +LG+   A     E Q + FI ++I  Q       KTT +N             +++L  +  ++P +VE+  I       LK       ++  L + +KD                  D   H V    L+QEIK+++ LL  IHK +K L   + G   +T+ LE + +      VP  W   +    K LS W  ++  R++F   W      +I R Y +++ +   +  S         D  N               N F+        YWLP FF PQ+ + AV+Q+  R    ++D LT +  V+
Sbjct: 2978 EVRIVEDYAQKTANELKSVLPAFDKAIVALNALDKADVAELRVYTRPPFLVLTVMNAVCILLQKKPNWATAKLLLSETGFLKKLINLDKDSIPDKVFVKLKKIVTLPDFNPHKISLVSVACCSLCQWVIALNNYHEVQKVVGPKQIQVAEAQNVLKIARQRLAEKQRGLQLVEEHLLFLQAAYKDTVAEKQLLANRKTMASRRFQCASVLLTVLEDEKTRWQETINQIDNKLEGILGDILLSAACIVYSGILTPEFRQLIVNKWETFCIENGISLSSKFSLIKVMAQKYEISRWHNQGLPHGQYSVENAILIKNGQQWPLLIDPHRQAHKWIRQMEGSRLQKLSIEDSNYTKKIENAMKTGGSVLLQNLLETLAPGLKAILKKDIYQKKGHYFIRVGDAEFEYNSNFRLYLSTEIDNPHFLPSVYNFVTMINFTVTFQGLQDQLLSTVVTHEVPHLEDQRSKLLESISLDAITLEELEEKTLNLLQKALGSILDDDKIVDTLRKSKMTSNEISKRIEATKKAESEIQAIRKNYLPIATRGALLYFLVADLTQINYMYQFSLDWFHQVFVSSVVSKSKEQEHSFKREKVSPKEVHEFISISKEPNLENEKNLLDKHIKSAIDMLTKSIFKVVSSALFNEDKLCFSFRLCTVIMQNNANGNLIQDDIGFLPEEEWNIFLYSGILINIKSALSQSRLTSTFEIG----ESQHLQWLSDSRWRQCQYVSTHL-EPFSLLCKSLLSNVSQWDTFKNSKAVYSLISTPFSSENASLEENTKPPEETELLNENKETCNPINFPWEKLTSFQRLILVKVLRPESLNNSVRKFITEKMGNKYLQRTGVNLKDAYKGSNARTPLILIQTHGIDLTNILLRFAQELKGTTHHVTIISLGRDQAAKAEDLILKALTKTQQWVFLQNCHLATSFMPRLCTIVESFNSPNVTIDPEFRLWLSSKSYSSFPIPVLKKGLKIAVESPQGLKSNLLQTFGCTGSGEVTEEIFENPDCGQWWKKLLFSLCFFNAVINERKNYGILGWNIAYKFNSSDLGVAIKVLENSLRGQPSISWQALRYLIGEVIYGGRVIDNWDKRCLKTLLYKFC--------------NPEVLKDDFSFSRSASIKDYIHIIQSLPDDDLPEVLGIHPEAIRSCWETQGEKFIENLIAMQP------KTTTANLMIRPEQSKDELVMEILSDLLKRLPLTVEKEEIAVGTPSTLKSMMSS-SIWESLSKNLKDH-----------------DPLIHCVLLTFLKQEIKRFDKLLFVIHKSLKDLQLAIKGEIILTQELEEIFNSFLNMRVPTLWQKHAYRSCKPLSSWIDDLIQRLNFFNTWAKVAYTAIQRRYMRFVTVWKQSIPSTSQKCKHPEDSEN---------------NFFEGFPSR---YWLPAFFFPQAFLAAVLQDYGRSRGIAVDALTFTHHVI 4369          

HSP 3 Score: 432.18 bits (1110), Expect = 0.000e+0
Identity = 274/839 (32.66%), Postives = 441/839 (52.56%), Query Frame = 1
Query: 5554 AKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQ--DSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETG----------------IRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEI------IVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYND------KNQNLLSSIQNLSKFS-----NSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDEL 7965
             K+D+ V+NPK ++++ LYG ++PN++EW +G++    +  + F               N  K      DL          R + R S L N+           F ++S D  +  D++  +  K  KI  + +  +WQWI+LDGP+++ WVENLN+VLDD++ LCLAN ERI +   ++ +FEVD+L  +SPATVSRCAM+Y+    + W+  VKSW+  +  K   +SG + L  + + S+  G++F+    K Q  P     + + TLC IL+A   ++  NGGF+  S D+ D S  +++ +  ES T F+D      I+K +    + +KNP +L  ++ KL+VFA+TW+FG A  R++  E   NI      +   S+ +   +FD  V  LF N+S+ G                I LP    +I+ YFVD+++  F PW  LVP+ + LI     L  +   +  N  ++ E         + D+   SFL +LL+ N+ PVLL G+SG+GK+  IN +L+++    G+      SILG   +Y++        QN+   I    K +     N     +    K L    +    + S+I F++  +  K  + +  K+++R +D +G PKN ++L+FIDD+N+P  D +G+Q  LE++RQ ++L G +D     W  + D S++ AC P +   IS RL KHF +L LP PS +    IFQ  +G YF   +F+ E++     I+   +++Y +       +P K HY+FNLR + K++ GLL AD  +V +KE       HE  R  HDRLI   D+ +F+++LS EL
Sbjct: 1874 GKVDICVLNPKCVTLSELYGQLDPNTMEWTDGLLSATIRSYVYF---------------NTPKNTKKDIDL----------RLKSRISDLSNV-----------FKLDSSDTTETDDNIFEEIEKVVKIPENHNF-DWQWIILDGPVDTFWVENLNSVLDDTRTLCLANSERIALTNKIRVIFEVDNLSQASPATVSRCAMVYMDPVDLGWEPYVKSWLL-KTSKIISQSGVDCLEFMIKNSVTDGLQFIRNRQKFQPYP-MEDITVVITLCRILDAFFDFMGKNGGFEQ-SDDLNDTSSKEANSQ-RESVT-FKD------IEKRDENTWYPEKNPDKLTKIIQKLFVFAFTWAFGGALNRED--EHRENIPFCPSLEPD-SLAKVTYDFDKLVHELFGNSSQVGWKHWGQSQGRRRKGNCINLPTGECSIFGYFVDIEQCEFIPWSDLVPNDQTLIQRGTSLLTNLQRSGGNFLKITECGECINYTATRDTTCLSFLMSLLLKNSCPVLLTGESGVGKTAAINQMLEKL-EGPGAFDIKHGSILGDTLLYSEIKKSSSLKQNITILIPETHKTATGSSDNPTKKPEVRTNKKLLKNNDHKGVVVSTINFSTNVTAAKTKEMILKKLIRRTKDTLGAPKNNRILIFIDDMNMPVSDMYGAQPPLELIRQLLDLGGVYDTEKNTWKNIQDLSIVAACVPVVND-ISPRLLKHFSMLVLPHPSQDILCTIFQAHLGIYFSINNFTPEVQKSKDQIISCSLAIYHQVRQNMLPTPTKCHYMFNLRDMFKLLLGLLQADRTVVNSKEMAALLFVHEATRVFHDRLIDFTDKSLFYRLLSREL 2659          

HSP 4 Score: 133.65 bits (335), Expect = 0.000e+0
Identity = 84/305 (27.54%), Postives = 168/305 (55.08%), Query Frame = 1
Query: 8200 FMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            F R+L++   +   IG++GCGK +   ++  +    ++R+ ++     I F+   KKV   + L+ +P V+ + +++ +  DSF++DL  +I+SG IPDL+EN EL++I   ++     S  + +   +     ++I K LH+ + +SP    +R   R  PS+I+ CTIDWY  W  E+L+ VA+          +     ++E+    L    + I+++  ++  ++  E  R Y+ +   +++F+  F  IL+    +  + R R   GL+ ++E  +L+T+M+E+L+ L P++++K++ETE
Sbjct: 2651 FYRLLSRELENCFQIGIDGCGKKTCATLACYLTDNKLYRVPISHKCAYIEFKEVFKKVFIHAGLKGKPTVLMVPNLN-IEQDSFLEDLNYIISSGRIPDLFENVELDSIAMKIRYLTEQSGHMDNRQSLLSFFQKRIYKNLHIFVIMSPEGPSFRQNCRVYPSMISSCTIDWYERWPEEALLIVAN------SFLKEKVNFENRENLKEKLAPTCVQIHKSMKDLNRKYFEETGRFYYTTPNSYLQFMETFAHILRAREEEMQTKRDRFHMGLSTILEATTLVTEMQEELLILGPQVEQKTKETE 2948          

HSP 5 Score: 64.3142 bits (155), Expect = 0.000e+0
Identity = 41/111 (36.94%), Postives = 59/111 (53.15%), Query Frame = 2
Query: 13406 GVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAV-ISEK----NKKEDS--YTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCE 13717
            GV +FGL+++ A WN E   L  +      C  P I+ +   IS K    + + DS  Y F CP+Y+TP R  IL+++G  +NFL  + L + + PS WI    A L  CE
Sbjct: 4403 GVYIFGLFIEGARWNREQKILEDSLPLEMCCDFPDIYFLPTKISTKTPNASNQTDSELYAFECPVYQTPERSRILATTGLPTNFLTSVYLSTKKPPSHWITMRVALL--CE 4511          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Human
Match: DNAH14 (dynein axonemal heavy chain 14 [Source:HGNC Symbol;Acc:HGNC:2945])

HSP 1 Score: 860.907 bits (2223), Expect = 0.000e+0
Identity = 572/1742 (32.84%), Postives = 933/1742 (53.56%), Query Frame = 2
Query:  446 FQVVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLT---MFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKR---------NISKFCQFIVESIN------YDENSDENKKSKIKNIPIFIVDANLSFLSNEEVEKLSDENDTKLSSRLYFSADNQLQSSYKSRSLIKI-ENIDTSSYSSILSTETPRSNLTTPE------DKIDESRNTIYPIMLPERLI---------------------INEEFYNEFYSFKIPGISVQISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKE-----DQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEA------LKEYERISEPEFQWDIDEFQ---KHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNR--DTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFA-LEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINL 5482
             QVV+A  AK  K FW ++AS ++ V     +  E ++           P  +WL E+  ++ L     F+ FR  KAF TW+ N+   K  K R+ L  +L   D +FQ C+  +  L ED ++  + N    E+NL+   +  +D S+TY+L EF + QL Q     + L  + +  +  +  T     +K  +  Y E  SK    D++     H +  + R+ ++   +F+ L+D    +L  +++           N S    F VE  N      + +NS    K+   +    + ++ L  +S ++ E  +D +  ++ + +    D  L+ +Y     + +   I   S SS  S E    +   PE      D++ E+++        E L+                     I  EF N++  ++ P     + + P        +++++   E  I ++        L +F +     D  NK     S+I+     R      P   ++ +TD  Y   +  +L +  NS+  +  Y       C   ++A      +     ++  EF+  ++ F+   +H+V         N  I+ KRIG  ++ + +   +   YI+ VI + +  +       N   + ++ ++ + L+ DP  +EEF+EH  F+N I++++  ++KE  +++Q++++  + ++ ++ EQ+A+++ L     +LK+++   +  KD  I KF  +LE  I  + + +  +K K R    L      S  ++ + TL  E   L NK + YS+YQ+ F  S S   S + +              +  ++ ++E D+++R  LWE + EW+R    +    L   +V +V++ VS+  H + VLEK LP+++++  +K +V E K  LP+IIAL NP L+ RHW  ++++IG S+  +KN  +  L++ K+ QY+  I ++S  A NE  LE ML K+ D +      L+ H       +II  +DDI+  LEES + ++TIKGS ++  I+  V +W++ L+  +  L+EW+NCQ++WLYLE +F + +I+RQLP E  LF +V   W+ +M + + K   L+  T  GVL+ILQ CN  LE I+KSLEDYLE+KR+IFPR +FLSN ELL+IL+ +++PE+VQ HL K F N+ +L I        ++  ++S EGE   LP+ IRVR   EQWL  +E+ +F+ +K++           +++      +   +L  +Q+ F  +  ++   +   E      +  + + L+ +LE +A  V  D  + +  A L A++++ VH RD   +LL  ++ +  DFEW + ++Y WNE    C V+Q ++ F YG EYLGC+ RLVITPLTDRC++T+  AL+ NLGGC  GPAGTGKTET+KDL+K +G+ CVVFNC + LD   V K   G++Q G+W CFDEFN ++LEVLSVIA+QI +IKAAKD+   RF+ E KEI++N  C +FITMNP Y G VELPDNL  LFRPVAMMVP Y +I E+ILFS GF +A  LS K+TNLY L   QLS Q HY+FGLRS+K VLI+ G  + E   +SE       +E  I+I+AI+ ++ P+   +D+PLF++I+GD+F +   +  N   LE+ I  + ++LG + W  Q EKI    +QL+   GVML+GP+  GKT +R IL+KALT LP+ + 
Sbjct:  193 LQVVSAHTAKHCKEFWVITASFISKVINIVGSVKEVEL----------IPTLEWLSERRHYYLLRQFKIFSDFRMNKAFVTWKLNVKRIKTEKSRSFLYHHLFLADDLFQTCLVYIRGLCEDAINLKNYNDH--ENNLSAICLVKLDSSRTYSLDEFCEEQLQQATQALKQLEDIRNKAISEMKSTFLKVAEKNEIKEYFE--SKLSEDDTT-----HFKLPKYRRLLETFFKFVMLVDYIFQELIRQLMNTAVTLLLELFNGSAGMPFSVEKKNENLIRTFKDNSFPTGKT-TNDCEELVDNSKLHAISVQKSEVKTDTDINEILNSVEVGKD--LRKTYAPIFEVNLCLRIPAESDSSENSKENFHESDQCPEECVMFEDEMSENKDNCVKKHSSEELLPKAKKSKEISYNLEDIISDTEIETEFENKYMYYEFPEFPTNLFIDPNRLEFSVKIQNMLTNMEKCITTITPLCQDPQLSIFIDLVSIMDLPNKTG---SIIHYKEQTR-----WPDCHILFETDPAYQNIIVNLLTIIGNSMGLVNAYSHKFIKYCTMTEKAKIMSMKISSMGELTSKEFEAILNRFRNYFRHIV---------NMAIE-KRIGIFNVVSLDYQSECLLYIDNVIHMSHTLIQSVIEKKNKNLLEVVESSLQQLECDPTEIEEFLEHFIFLNAISSKISKLEKEFLTMSQLYSVAKHHQIHISEEQIAIFQVLLLKFSQLKSSMKLSKINKDTAITKFRDNLEACISGLHVDVGNLKAKIRTPLLLCAGTQVSTAMEMIQTLSGEAASLTNKAKAYSHYQDCFSDSQSHMHSVNVEE---------ITQIVLSEISDIEGDLTLRKKLWEAQEEWKRASWEWRNSSLQSIDVESVQRNVSKLMHIISVLEKGLPKSDMVTHLKQVVTEFKQELPIIIALGNPCLKPRHWEALQEIIGKSVPLDKNCKVENLLALKMFQYENEINDMSTSATNEAALEKMLFKIIDFWNTTPLPLILHHTEIYSIFIIPSIDDISAQLEESQVILATIKGSPHIGPIKDLVNEWDQNLTLFSYTLEEWMNCQRNWLYLEPVFHSSEIRRQLPAETELFSQVISMWKKIMSKIQNKQNALQITTSAGVLEILQNCNIHLEHIKKSLEDYLEVKRLIFPRFYFLSNAELLDILADSRNPESVQPHLVKCFENIKQLLIWKQDIGPPAVKMLISAEGEGLVLPKKIRVRSAVEQWLVNVEKSMFDVLKKE-----------RYI------YNIILLFQSQIMFYNDCVKSFVSSYSREK-----LEKVHAGLMCHLEEVADLVVLDTSNSRTKAILGALLILYVHCRDIVINLLLKNIFNAEDFEWTRHLQYKWNEKQKLCYVSQGNASFTYGYEYLGCTSRLVITPLTDRCWLTLMEALHLNLGGCPAGPAGTGKTETVKDLAKSLGKHCVVFNCFEDLDYKIVRKFFFGLVQSGAWSCFDEFNLIDLEVLSVIASQILTIKAAKDNYSARFVLEGKEIRINMSCAVFITMNPRYGGGVELPDNLKSLFRPVAMMVPHYQMIAEIILFSFGFKSANSLSGKLTNLYELARKQLSQQDHYNFGLRSLKIVLIMAGTKKREFKCLSEA------DETLIVIEAIREASLPKCPPEDVPLFENIIGDIFPEVTVLKVNQLALEKVIYTATQQLGLQNWSSQKEKIIQFYNQLQVCVGVMLVGPTGGGKTTVRRILEKALTLLPIADF 1857          

HSP 2 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 462/1453 (31.80%), Postives = 748/1453 (51.48%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEIN--------------KEIGENVSISPETKLQ-----------KIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYS-----LEESDNRIGQKQWATF----IKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETW-------IKWNLSENPFDMSSYNFKE----------------------FSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQ--SEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNN-EVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIG--HLTDFQSINSFIH-SNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSN-----------SALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNV----LEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSI--GKSLSEWSSNVRIRIDFIGFWC----YSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVL 13289
            E   VE+Y+ K   +L SV P  + +I AL++L+KA ++E+RVY  PP LV  VMNAVC+LL   P+WA AKLLL +  FL+KL+N +KD+I  K++  L++     DFNP  +  VS+AC S+CQWV+A+ +YH V  ++ PK+  V EA+  L+I++Q+L  KQ  L+ VE+H+  L   Y+++V E++ L  R  + + R   A+ L+  ++ EK RW  +I   D   + I+G  + SAA   ++G  T  +R++   KW        I +   +  ++     Y I  WHN GLP      EN  +I+  ++WPLLIDP +Q  ++++       + +S +  +Y   +E A++ G ++ L+++   + P L  +L+K+ +++     I++G+ E EY+ +F+LYL + + NP  + SV   VT+INFTV   GL++QLLS +V+ E P +E++R++ L + + D  +L  LE+KTL LLQ +   I++D ++   L KSK+T+ +I KR+E T +AE ++Q  RK YLP+A RGA +YF++ADL  +NYMYQ+SL WF  +F   V   +              KE+ E +SIS E  L+             ID +T   + + S  LF+  +  F+F L T IM+ +     +++    + +++W  F    I ++  S++    L +    G    +  +++WL+   W +C+++   L + FS LC S       W         ++L   PF   + + +E                      F  + L SF++LIL+ +L    L +S R ++   +G K+      NL + +  S+A+ P++ I     D  N +++   EL+G T ++ I+S+GR QA KAE LI K      +W+FLQNC L  S+MP L  ++E+        D  F+L LS+  +S FPI +L+  LKIA+ESP G+K+ LL++F   G+G VTE I+ N    +  +K++F+LC FNAV+ ER+NYG LG+++ Y FN SDL ++IK +   L     + W AL  +IG + YGGR+ DN D+RCL  LL  +               +P+VL      +   SI  +IH       + L  +LG+   A     E Q + FI ++I  Q       KTT +N             +++L  +  ++P +VE+  I       LK       ++  L + +KD                  D   H V    L+QEIK+++ LL  IHK +K L   + G   +T+ LE + +      VP  W   +    K LS W  ++  R++F   W      +I R Y +++ +   +  S         D  N               N F+        YWLP FF PQ+ + AV+Q+  R    ++D LT +  V+
Sbjct: 2978 EVRIVEDYAQKTANELKSVLPAFDKAIVALNALDKADVAELRVYTRPPFLVLTVMNAVCILLQKKPNWATAKLLLSETGFLKKLINLDKDSIPDKVFVKLKKIVTLPDFNPHKISLVSVACCSLCQWVIALNNYHEVQKVVGPKQIQVAEAQNVLKIARQRLAEKQRGLQLVEEHLLFLQAAYKDTVAEKQLLANRKTMASRRFQCASVLLTVLEDEKTRWQETINQIDNKLEGILGDILLSAACIVYSGILTPEFRQLIVNKWETFCIENGISLSSKFSLIKVMAQKYEISRWHNQGLPHGQYSVENAILIKNGQQWPLLIDPHRQAHKWIRQMEGSRLQKLSIEDSNYTKKIENAMKTGGSVLLQNLLETLAPGLKAILKKDIYQKKGHYFIRVGDAEFEYNSNFRLYLSTEIDNPHFLPSVYNFVTMINFTVTFQGLQDQLLSTVVTHEVPHLEDQRSKLLESISLDAITLEELEEKTLNLLQKALGSILDDDKIVDTLRKSKMTSNEISKRIEATKKAESEIQAIRKNYLPIATRGALLYFLVADLTQINYMYQFSLDWFHQVFVSSVVSKSKEQEHSFKREKVSPKEVHEFISISKEPNLENEKNLLDKHIKSAIDMLTKSIFKVVSSALFNEDKLCFSFRLCTVIMQNNANGNLIQDDIGFLPEEEWNIFLYSGILINIKSALSQSRLTSTFEIG----ESQHLQWLSDSRWRQCQYVSTHL-EPFSLLCKSLLSNVSQWDTFKNSKAVYSLISTPFSSENASLEENTKPPEETELLNENKETCNPINFPWEKLTSFQRLILVKVLRPESLNNSVRKFITEKMGNKYLQRTGVNLKDAYKGSNARTPLILIQTHGIDLTNILLRFAQELKGTTHHVTIISLGRDQAAKAEDLILKALTKTQQWVFLQNCHLATSFMPRLCTIVESFNSPNVTIDPEFRLWLSSKSYSSFPIPVLKKGLKIAVESPQGLKSNLLQTFGCTGSGEVTEEIFENPDCGQWWKKLLFSLCFFNAVINERKNYGILGWNIAYKFNSSDLGVAIKVLENSLRGQPSISWQALRYLIGEVIYGGRVIDNWDKRCLKTLLYKFC--------------NPEVLKDDFSFSRSASIKDYIHIIQSLPDDDLPEVLGIHPEAIRSCWETQGEKFIENLIAMQP------KTTTANLMIRPEQSKDELVMEILSDLLKRLPLTVEKEEIAVGTPSTLKSMMSS-SIWESLSKNLKDH-----------------DPLIHCVLLTFLKQEIKRFDKLLFVIHKSLKDLQLAIKGEIILTQELEEIFNSFLNMRVPTLWQKHAYRSCKPLSSWIDDLIQRLNFFNTWAKVAYTAIQRRYMRFVTVWKQSIPSTSQKCKHPEDSEN---------------NFFEGFPSR---YWLPAFFFPQAFLAAVLQDYGRSRGIAVDALTFTHHVI 4369          

HSP 3 Score: 432.18 bits (1110), Expect = 0.000e+0
Identity = 274/839 (32.66%), Postives = 441/839 (52.56%), Query Frame = 1
Query: 5554 AKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQ--DSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETG----------------IRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEI------IVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYND------KNQNLLSSIQNLSKFS-----NSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDEL 7965
             K+D+ V+NPK ++++ LYG ++PN++EW +G++    +  + F               N  K      DL          R + R S L N+           F ++S D  +  D++  +  K  KI  + +  +WQWI+LDGP+++ WVENLN+VLDD++ LCLAN ERI +   ++ +FEVD+L  +SPATVSRCAM+Y+    + W+  VKSW+  +  K   +SG + L  + + S+  G++F+    K Q  P     + + TLC IL+A   ++  NGGF+  S D+ D S  +++ +  ES T F+D      I+K +    + +KNP +L  ++ KL+VFA+TW+FG A  R++  E   NI      +   S+ +   +FD  V  LF N+S+ G                I LP    +I+ YFVD+++  F PW  LVP+ + LI     L  +   +  N  ++ E         + D+   SFL +LL+ N+ PVLL G+SG+GK+  IN +L+++    G+      SILG   +Y++        QN+   I    K +     N     +    K L    +    + S+I F++  +  K  + +  K+++R +D +G PKN ++L+FIDD+N+P  D +G+Q  LE++RQ ++L G +D     W  + D S++ AC P +   IS RL KHF +L LP PS +    IFQ  +G YF   +F+ E++     I+   +++Y +       +P K HY+FNLR + K++ GLL AD  +V +KE       HE  R  HDRLI   D+ +F+++LS EL
Sbjct: 1874 GKVDICVLNPKCVTLSELYGQLDPNTMEWTDGLLSATIRSYVYF---------------NTPKNTKKDIDL----------RLKSRISDLSNV-----------FKLDSSDTTETDDNIFEEIEKVVKIPENHNF-DWQWIILDGPVDTFWVENLNSVLDDTRTLCLANSERIALTNKIRVIFEVDNLSQASPATVSRCAMVYMDPVDLGWEPYVKSWLL-KTSKIISQSGVDCLEFMIKNSVTDGLQFIRNRQKFQPYP-MEDITVVITLCRILDAFFDFMGKNGGFEQ-SDDLNDTSSKEANSQ-RESVT-FKD------IEKRDENTWYPEKNPDKLTKIIQKLFVFAFTWAFGGALNRED--EHRENIPFCPSLEPD-SLAKVTYDFDKLVHELFGNSSQVGWKHWGQSQGRRRKGNCINLPTGECSIFGYFVDIEQCEFIPWSDLVPNDQTLIQRGTSLLTNLQRSGGNFLKITECGECINYTATRDTTCLSFLMSLLLKNSCPVLLTGESGVGKTAAINQMLEKL-EGPGAFDIKHGSILGDTLLYSEIKKSSSLKQNITILIPETHKTATGSSDNPTKKPEVRTNKKLLKNNDHKGVVVSTINFSTNVTAAKTKEMILKKLIRRTKDTLGAPKNNRILIFIDDMNMPVSDMYGAQPPLELIRQLLDLGGVYDTEKNTWKNIQDLSIVAACVPVVND-ISPRLLKHFSMLVLPHPSQDILCTIFQAHLGIYFSINNFTPEVQKSKDQIISCSLAIYHQVRQNMLPTPTKCHYMFNLRDMFKLLLGLLQADRTVVNSKEMAALLFVHEATRVFHDRLIDFTDKSLFYRLLSREL 2659          

HSP 4 Score: 133.65 bits (335), Expect = 0.000e+0
Identity = 84/305 (27.54%), Postives = 168/305 (55.08%), Query Frame = 1
Query: 8200 FMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            F R+L++   +   IG++GCGK +   ++  +    ++R+ ++     I F+   KKV   + L+ +P V+ + +++ +  DSF++DL  +I+SG IPDL+EN EL++I   ++     S  + +   +     ++I K LH+ + +SP    +R   R  PS+I+ CTIDWY  W  E+L+ VA+          +     ++E+    L    + I+++  ++  ++  E  R Y+ +   +++F+  F  IL+    +  + R R   GL+ ++E  +L+T+M+E+L+ L P++++K++ETE
Sbjct: 2651 FYRLLSRELENCFQIGIDGCGKKTCATLACYLTDNKLYRVPISHKCAYIEFKEVFKKVFIHAGLKGKPTVLMVPNLN-IEQDSFLEDLNYIISSGRIPDLFENVELDSIAMKIRYLTEQSGHMDNRQSLLSFFQKRIYKNLHIFVIMSPEGPSFRQNCRVYPSMISSCTIDWYERWPEEALLIVAN------SFLKEKVNFENRENLKEKLAPTCVQIHKSMKDLNRKYFEETGRFYYTTPNSYLQFMETFAHILRAREEEMQTKRDRFHMGLSTILEATTLVTEMQEELLILGPQVEQKTKETE 2948          

HSP 5 Score: 64.3142 bits (155), Expect = 0.000e+0
Identity = 41/111 (36.94%), Postives = 59/111 (53.15%), Query Frame = 2
Query: 13406 GVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAV-ISEK----NKKEDS--YTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCE 13717
            GV +FGL+++ A WN E   L  +      C  P I+ +   IS K    + + DS  Y F CP+Y+TP R  IL+++G  +NFL  + L + + PS WI    A L  CE
Sbjct: 4403 GVYIFGLFIEGARWNREQKILEDSLPLEMCCDFPDIYFLPTKISTKTPNASNQTDSELYAFECPVYQTPERSRILATTGLPTNFLTSVYLSTKKPPSHWITMRVALL--CE 4511          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Human
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 762.681 bits (1968), Expect = 0.000e+0
Identity = 427/1175 (36.34%), Postives = 675/1175 (57.45%), Query Frame = 2
Query: 1997 RISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNK-NFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXX---------------XXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLEND-KLLERSI--ELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKAL 5458
            ++ EP    DI+ F + L +  ++  D      T+ +G + + T+ L +   P   + + ++N  L +++    D  I   + A   L+  P T  E+V  L F+++I   + S++ E   + QM+ ++  ++VP   E  A++ T+  +I  ++N +      ++ +I++F   L   +EE+   + E+K +A++   LD +  Q  I   L  L++ + DL  +   Y +YQ+ F   +SK                       E +EEV  ++ ++ LLW++ SEW++  + ++  K D  +   +   VS+    V  LEK LP N ++P +K  V + K  LPVII LRNP L+ RHW  IE+ +  +L   +   T+  L    +  + Q I +IS  A+ E  LE +L KV+D +   EF ++ H + +D +I+ G DDI V L++S + ++T+  S+Y+  ++T+V++W+++L+   + L+EW+ CQ++WLYLE IF   DIQRQLP E ++F +VD  W+ +M++    P  L+  T+ G+L+  Q  N+ L++IQK LE YLE KR+IFPR +FLSNDELLEIL++ ++P+ VQ HL K F ++ KL+          I                 ++S EGE   L + ++ RG  E+WL  +E+ +F  ++R  K  + + + K   DW +     Q IL  +Q+ + ++++  L+      S  +  + +      + L  LA  V   +    R  L A+I I VH RD    L+++ V++   F+W++Q+RY W+     C      S + YG EYLG  PRLVITPLTDRCY+ + GAL  +LGG   GPAGTGKTET KDL+K +  QCVVFNCSD LD   + +  SG+ Q G+WCCFDEFNR+++EVLSVIA Q+ +I+ AK ++  RF+FE +EIKL   C  FITMNP YAGR ELPDNL  LFRP AMMVP+Y LI EVIL+SEGF ++K+L+ K+T +Y+LC++QLS Q HYDFG+R++KSVL++ G L+ E   ++E V         +LI+A++ SN P+ +TDD  LF  I+ DLF    ++ E+D  +L+ +I   ++ + L  E+    + K+      +  RHGVML+GP+  GKT +  IL + L
Sbjct:  637 KLQEP----DINFFSEQLEKYHKQHKDAVALRPTRNVGLLLIDTRLLREKLIPSPLRCLEVLNFMLPRQSKKKVDAIIFEAQDAEYKLEFVPTTTTEYVHSLLFLDEIQERIESLEDEGNIVTQMYKLMEQYQVPTPPEDFAVFATMKPSIVAVRNAIDKSVGDRESSIKQFCVHLGSDLEELNNEVNEVKLQAQDPQILDISADQDKIRLILNNLQSVLADLQKRAFQYKSYQKNFKVEVSKF----------------------EALEEVSAELKLKQLLWDSFSEWDKLQQEWLKSKFDCLDPEVLNGQVSKYAKFVTQLEKGLPPNSVVPQLKYKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDATLVDAEIPLTLERLSQLHVFDFGQEIQDISGQASGEAALEAILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINVATLASSRYLGPLKTRVDEWQKQLALFNQTLEEWLTCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPAEGKIPGIDGEPEKVYTNDILAMLSPEGERVSLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKLRTDWVVAGHPSQVILTVSQIMWCRDLTECLETE---HSNHIQALKNFEKVNFERLNALAAIVQGSLPKLHRNILTALITIDVHARDIVTELVQSKVETVESFDWQRQLRYYWDIDLDNCVARMALSQYTYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLNEDV---------VLIRALQDSNLPKFLTDDALLFSGIISDLFPGV-QIPEHDYGILQSTIVDVMNRQNLQPEMC--MVRKVIQFYETMLVRHGVMLVGPTGGGKTTVYRILAETL 1770          

HSP 2 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 428/1423 (30.08%), Postives = 696/1423 (48.91%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIE--WLTLEVWNKCKFLEIELKDKFSGLCNSFKLTP--------ETWIKWNLSENPFDMSSYNFKEFSVKY----------------LNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDII-VQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYS-ILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLPRNLLGDLEEYFAQSELFDVTKTYSTSEIIP 13382
            ET+A+ +     + DL    P L+A+ KALDSL+KA ISE+RV+  PP LV  VM A+ +LL+  P W +AK LLGD+NFL++LL Y+K+ I  ++   LQ+Y    DF PE V  VS AC+S+C WV A++ Y  V  ++ PKR+ +  A+  L+I+   L  KQ  L++VED I+ L ++Y   V E++ L + + LT  RL RA  L  A++ E+ RW  SI+  ++   NI G+   +AA   + G +T  YR+   + WI    +  IPI+ ++  +      Y I  W+ +GLPRD    EN  ++ + ++WPL+IDPQ Q  R+++    K   ++I     +++ +LE +IR+G  + LE+++  +DP L P+L K+ F  G   +I+LG+++++Y  +F+ Y+ + + NP  +  V   VTIINFTV   GLE+QLLS +V  EKP +E +R + +     D   L+ +E+K L +L  S   I+++ EL   L+ SKIT+  IK RLEE    E+ + +AR+ Y P+A +G+ +YFV+A L  ++ MYQYSL +F+ LF   ++   K   EN+    + +L  +++     +Y   S GLF  H+ +++FML   +MR     SD      +W  F++                S G   ++P   E  WL    W  C  LE E    F GL  +    P        ET+I      NP     Y+  +   K+                L+SF KLILI      K++ +   +V   LG++F      +L  L+ +     P+VFIL   SDP+    +   E  G +  +  +S+G+GQ   AE ++ K  +  G W+FLQNC L +SWM ++++LI+            F+L LS+ P + FP+ +LQNS+K+  E P G++  + ++F         E I   +  QI   IF +C F+A++ ER+ +G LG+++ Y+FNDSD E ++  +  +    ++ W+AL  + G I YGGR+TD+ D+RCL  +L+ + S        + + +S           Q    +I  N   ++  E + G+ +NA +V    ++ + I  I+ VQ       +  ++     +++  +  ++P  +E          F+KD +      G+L+                             VL QE+ ++N LL  IH  ++ L   ++G   ++E +E V +    N VP            + WS+     +  +G W    ILR     L L      S                                        YW+ GFF PQ  +T  +QN AR  +  ID L+    V+P         Y  Q+ + +  KT    + +P
Sbjct: 2761 ETQAIAD---DAQRDLDEALPALDAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPSAKQLLGDSNFLKRLLEYDKENIKPQILAKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKVVEPKRQKLRAAQAELDITMATLREKQALLRQVEDQIQALQDEYDKGVNEKESLAKTMALTKARLVRAGKLTAALEDEQVRWEESIQKFEEEISNITGNVFIAAACVAYYGAFTAQYRQSLIECWIQDCQSLEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKIIKLTDSNFLRILENSIRLGLPVLLEELKETLDPALEPILLKQIFISGGRLLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPRLEEQRIKLIVRINTDKNQLKTIEEKILRMLFTSEGNILDNEELIDTLQDSKITSGAIKTRLEEAESTEQMINVAREKYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSVKT--ENL----QQRLDVLLEQTLLTAYVNVSRGLFEQHKLIYSFMLCVEMMRQQGTLSD-----AEWNFFLR---------------GSAGLEKERPPKPEAPWLPTATWFACCDLE-ESFPVFHGLTQNILSHPISIRLGSFETYI------NPQKWEGYSKMKHEDKHMRQEKEAAHQDPWSAGLSSFHKLILIKCCKEEKVVFALTDFVIENLGKQFIETPPVDLPTLYQDMSCNTPLVFILSTGSDPMGAFQRFARE-SGYSERVQSISLGQGQGPIAEKMV-KDAMKSGNWVFLQNCHLAVSWMLAMEELIKTFTDPDSAIKDTFRLFLSSMPSNTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGKKWRQI---IFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLKLYCKEGKIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPETLEEDYK-YSESGIYFAPMADSLQEFKDYIE-NLPLIDDPE-IFGMHENANLVFQYKETSTLINTILEVQPRSSTGGEGKSNDEIVQELVASVQTRVPEKLEME--GASESLFVKDLQ------GRLNS-------------------------LTTVLGQEVDRFNNLLKLIHTSLETLNKAIAGFVVMSEEMEKVYNSFLNNQVP------------ALWSNTAYPSLKPLGSWVKDLILRTSFVDLWLKRGQPKS----------------------------------------YWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYSVIP--------TYRDQAAVIEAAKTVQFGQELP 4046          

HSP 3 Score: 493.812 bits (1270), Expect = 0.000e+0
Identity = 310/1057 (29.33%), Postives = 539/1057 (50.99%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLS-KCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIV-SLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKP--EDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            +WI+ DGP+++ W+EN+NTVLDD+++LCLAN ERI +   +  LFEV DL+ +SPATVSRC M++V  + + W   VK+WMK  + K   E  +E++  LF++ +  G+ F++ KCS  Q IP     S++ TLCC+LE+LIL      G D ++L +                              E +K          LN +L + +VF Y WS G                               D FD F+++ FD+N +   RLP ++  ++S  +D D     PW+ ++P+ K                 N      E++V + D++RY +L   L+   H VL  G +G+GKS++   +L +I    G                                                YVP      +Y  + F++QTS  +  + + SK+ ++ ++I+G P NK++++F+DDLN+P +D +GSQ  +E++RQ+ +  GF+D   L W  + D ++I AC+P    ++P++ R  +HF +L LP PS ++ ++IFQ  +  +    DF   +K   +SIV+  + +Y K       +P KSHY+FNLR L K + G+L  D   +  +  + +   HE  R  HDRLI++ D+  F  IL++  +    +    +      I+FG F    G+  + ++Y  + D+EK     +  ++ ++  +      +FF+ +I+H+ R  R++ Q  G+ L++GV G GK S  ++++ I G    ++ ++  YN  SF  D++K+   + ++++  V   +D   +V + F++D+ N++NSG +P+L+E DELE +L+  +P  +++G  S  + ++V+   I K+++ LH+ + +SP    +RSR R  PSL+NCCTIDW++ W  E+L+SV+          F  +++   E+    L    + ++ +   +  ++  ELRR Y+ +   ++E +N +  +L     +  S R R+  GL +L+ET  L+ KMK DL  L P +  KSE+ E
Sbjct: 1833 KWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMKG-ISKKLTEETQEYILNLFQRYVDEGLHFINKKCS--QAIPQVDI-SKVTTLCCLLESLIL------GKDGVNLAM------------------------------EQTK----------LNTILCQTFVFCYLWSLGGNLTEN-----------------------YYDSFDTFIRTQFDDNPDA--RLP-NSGDLWSIHMDFDTKRLDPWERIIPTFK----------------YNRDVPFFEMLVPTTDTVRYGYLMEKLLAVKHSVLFTGITGVGKSVIAKGLLNKIQESAG------------------------------------------------YVP------VY--LNFSAQTSSARTQEIIESKLERKRKNILGAPGNKRIVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIISACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFL--SDFPPAVKQTASSIVEASVEIYNKMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREEIQIFRLFCHECQRVFHDRLINNEDKHYFHVILTEMANKHFGIAIDLEYFLNKPIIFGDFIKF-GADKADRIYDDMPDIEKTANVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDT-QIVVEEFLEDINNILNSGEVPNLFEKDELEQVLAATRPRAKEVGI-SEGNRDEVFQYFISKVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSK--------TFFSQVDAGNEELKEKLPLMCVNVHLSVSSMAERYYNELRRRYYTTPTSYLELINLYLSMLSEKRKQIISARDRVKNGLTKLLETNILVDKMKLDLSALEPVLLAKSEDVE 2728          

HSP 4 Score: 38.5058 bits (88), Expect = 0.000e+0
Identity = 21/81 (25.93%), Postives = 43/81 (53.09%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +   V+NPK++++  LYG VN  +LEW +G++ +  +  ++ ++++   +      D    EN N     N +  L N+E+
Sbjct: 1786 VKTYVLNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSER 1866          

HSP 5 Score: 70.8626 bits (172), Expect = 8.247e-11
Identity = 37/112 (33.04%), Postives = 63/112 (56.25%), Query Frame = 2
Query: 13394 NPDHGVLVFGLYLDNALWNLENSSL------AINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            +P+ GVLV G+++D + W+ +   +       +NP+      LP++H      ++N K     + CPLY+T +R G LS++G S+NF+  + L S R   +WI +G+A L Q
Sbjct: 4053 SPEDGVLVHGMFMDASRWDDKEMVIEDALPGQMNPV------LPVVHFEP---QQNYKPSPTLYHCPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRSKDYWIAKGSALLCQ 4155          

HSP 6 Score: 54.6842 bits (130), Expect = 7.577e-6
Identity = 43/171 (25.15%), Postives = 75/171 (43.86%), Query Frame = 2
Query:  488 FWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQ 1000
            ++T+S  +VT +Y      NE DI  I +         +W  E +   +LT +  F+ FR WKAF  WR N+ + K+   +  L  NL  ++P  +  + K++ L   L              + + +I+   TY L EF   Q+ ++    E L +  +     V + C+
Sbjct:  233 YYTISQRAVTHIY------NE-DIEFIEID--------RWEQEYLYHRELTKIPIFSLFRKWKAFSVWRKNVRSKKITGCQKSLQKNLFIVNPHLRPALLKINELCYHL------------SFMGLCYIEKCHTYTLQEFKAAQVIRLAEVTERLGEFRNEAKYVVRRACR 376          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 385/1355 (28.41%), Postives = 664/1355 (49.00%), Query Frame = 3
Query: 9234 CEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYR-EMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNI--EWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLI---GHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWG-LLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLT 13271
             ++DL    P LE +++AL+SLNK  I E++ Y  PP  VEIVM AV +L    P+WA AK  LG+ NF++ L+N++KD I+ K+ K +  Y  Q DF P+ +G VSLA +S+C WV A+E Y  +  ++ PKR  +N A   L   +  L   Q +L++V + ++ L  +Y   + ++++L+++      +L RA  L+  +  EK RW  +++  ++    ++G C+ +AA+ ++ GP+   YR E+  + WI  +    +P   ++    F  +   + +W+  GLP D+   EN  I+ +  +W L+IDPQ Q  ++++        ++I  +  DY+ +LE AI  G  + L++++  +DP L P+L K   R G   ++++G+ E+EY+ +F+ Y+ + LSNP      +   TI+NF V   GLE QLL ++V KE+PE+E +++  +   A     L+ LED+ L LL ++T  +++D +L   L  SKITA ++ ++LE +   E    LAR+ Y P A R + ++FVL D+G ++ MYQ+SL  + +LF   +D+ ++      S   E ++  + D  TY  Y      LF  H+ LF+F +   I+     E+  ++   ++  F++               D  GQ+    DN    WL    W+     E++    F GL NSF+  P  W  W  +  P         E +    N  ++++++  L   ++      ++   LG +F      N+ ++  +S  + P+VFIL    DP + +++L  E  G       +S+G+GQA  A  L+++  + +G W+FL NC L +SWMP+L KL+E LQ+  +D   +F+L LS+ PH DFPI ILQ S+K+  E P G+K  + + + L      +     ++  + +K++F+LC F++V+LER+ +  LG+++ Y FNDSD E+S   +  +L    E  W+AL  +I  INYGG +TD+ DRR L   + +Y  + +               I   G L  ++   S +   D          G   NA++                         + T++ +  D L         S++  I  T      ++ E+V+ L   + + I +       Y   + ++    SP + VL QEI++YN L+  I   +  L   + G   ++ SLE + + I    VPP WG      K L+ W+ ++ +R++    W                                                     + R  ++ +WL GF  P   +TAV+Q+ AR  + S+D L+
Sbjct: 3084 AQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHR------SNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKIL-----ETSGKLNMDEYNFFLRGGVV----------LDREGQM----DNPCSSWLADAYWD--NITELDKLTNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENAC---NEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLA-EHMGMAQRFHALSLGQGQAPIAARLLREG-VTQGHWVFLANCHLSLSWMPNLDKLVEQLQV--EDPHPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRC---SKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPP-----EAFGQHPNADVA-----------------------SQITEAQTLFDTL--------LSLQPQITPTRAGGQTRE-EKVLELAADVKQKIPE----MIDYEGTQKLLALDPSPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYPSQKPLAAWTRDLAMRVEQFELWA---------------------------------------------------SRARPPVI-FWLSGFTFPTGFLTAVLQSSARQNNVSVDSLS 4308          

HSP 2 Score: 275.404 bits (703), Expect = 0.000e+0
Identity = 200/778 (25.71%), Postives = 372/778 (47.81%), Query Frame = 1
Query: 6790 TIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFD-HEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            T+Y YFVD             P I++       L   S     N      ++ ++D++RY++L + L+ N +P+LL G  G GK                  TS + S+L          Q+L SS                  + S+ V           +  ++QT+ N     + S++ KR + +  P   K M+ F+DDLN+P  D FGSQ  LE++R WI+   ++D T     Y+ +  L+ A  P    ++ IS RL   F ++ +  P+ +   RIF   I +    +DF  E+K     + +  + +Y   + ++  +P K HY+FNLR + K+  G+L A+      K  + +   HE  R   DRL+   D E F  I+SD+L     L + H    K   +FG F          KVY+ +TD+  L    E+++N ++    +     + F+++I+H+ R +R++ Q  G+ML++G+ G G+ S  +++S+I     F++ +T  Y    FR DIK++  ++ ++ +       D   + ++SF++D+ N+++SG +P+LY+ DE E I S++  +    +     + ++  LIE++Q  LH+ + LSP    +R+ +R  P+L+NC TI+W+ +W  E+L+ VA                 ++E+    + +  + ++ +  +   +  +ELRR  +++   ++E L+ +  +L     +  +  ++L  GL ++ ETR  +  M  +L +   K+ E  ++ E
Sbjct: 2353 TVYEYFVD-------------PKIRSWTSFEDKLP-KSWRYPPNAPFYKIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGK------------------TSIAQSVL----------QSLPSS------------------QWSVLV-----------VNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKL--QDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDFL------KEPKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDT-QIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAE-------KCLIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCE 3043          

HSP 3 Score: 67.0106 bits (162), Expect = 0.000e+0
Identity = 41/116 (35.34%), Postives = 59/116 (50.86%), Query Frame = 2
Query: 13373 DNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRI-PSFWILRGTAALLQCE 13717
            D+S  +Y P  GV V GLYL+ A W+ +NS L      +  C +P IH     S K   +  Y+  CP Y  P+R G    S   ++F+  + L+S  + P  WI RGTA L+  +
Sbjct: 4317 DDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYS--CPCYYYPNRAG----SSDRASFVIGIDLRSGAMTPDHWIKRGTALLMSLD 4426          

HSP 4 Score: 560.836 bits (1444), Expect = 1.582e-162
Identity = 345/1090 (31.65%), Postives = 581/1090 (53.30%), Query Frame = 2
Query: 2270 PKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQN--EILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTK-NKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXY--EGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVD----WALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMG-HLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFD-EVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL-----PLINLSKE 5491
            P+T+EE    L+ ++ +  ++ +++ +   I++ F I+  ++VPV    L +  +LN      +  ++  +    ++  KF   L    ++ + +   + E          N      LDQ+  ++  +                    ++    ++  R    +F      +  +D++ +E+++     +WE   +WE  +  +   +    +  T+  T       +  L K       EI+   ++ + + K ++P+I  LRNP L+ RHW ++   I     + +++FT+ +++   + Q+ + I EIS  A  E+ +E  L  +   + V +  +V + ++    + G +++   LE++ + +ST+K S++V      V+ WER LS   +V++  +  Q+ W+YLE IF   DI++QLPNE  LF +V+  W+++M +  +    L+     G+L  L   N+ LE IQKSL+ YLE KR IFPR +FLSND+LLEIL ++++PE VQ HL K F N+  L+I      S     V  +  +GE      ++ + G  E WL  +EQ +   ++  ++ C + +  ++F++    W     GQ ++ ++Q++++ +V++ L    +     +L +  +  + +  L   +  +  ++    R  + A++ I++H RD  + L ++ +     F+W  Q+R+ W +    C + Q ++ F+Y  EYLG S RLVITPLTDRCYMT+T AL+ + GG  KGPAGTGKTET+KDL K +G   +V NCS+ LD  ++ ++ SG+ Q G+W CFDEFNR+N+EVLSV+A QI  I +A  +    F F+  EI L   CGIFITMNP YAGR ELP+NL  +FRP+AM+VPD  LI E+ILF EGF   K+L+ K+  LY L   QLS Q HYDFGLR++ S+L   G   RL+  L  E V L    ++NI           +L + D PLF +I+ DLF + +  V++  KL E ++E   +++G +  P  + K+  L     SRH  M++G + SGKT    ILQ +L+ L     P  N+ +E
Sbjct: 1065 PQTLEELGVSLQLVDALKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKKHKEKFKTGLIHSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAML--------------------MAMREEENSLRANLGIFKIEQPPS--KDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKDKGHHRLRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKWEAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLAL--RKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKV--MKKNQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHFDGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNI----------AKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRE-TVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAGDPNFNIVRE 2117          

HSP 5 Score: 36.965 bits (84), Expect = 1.582e-162
Identity = 23/76 (30.26%), Postives = 38/76 (50.00%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +NPKALS+  LYG  + ++ EW +GI+  V +   +    ++  +      D    EN N     N + TL+N E+
Sbjct: 2120 LNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGER 2195          

HSP 6 Score: 116.701 bits (291), Expect = 1.123e-24
Identity = 57/145 (39.31%), Postives = 92/145 (63.45%), Query Frame = 1
Query: 5950 KKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLS-KCSKIQIIPNTSKQSQLFTLCCILEAL 6381
            K + +WI+ DGP+++ W+EN+N+V+DD+++L L NGERI +P  +  LFEV+DL  +SPATVSRC M+Y     + WK  V+SW++ +     P++  E L ++FEK I   + F    C ++  +P   + S + +LC +  AL
Sbjct: 2158 KPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEKR-----PKAEVEPLQRMFEKLINKMLAFKKDNCKELVPLP---EYSGITSLCKLYSAL 2294          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 385/1355 (28.41%), Postives = 664/1355 (49.00%), Query Frame = 3
Query: 9234 CEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYR-EMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNI--EWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLI---GHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWG-LLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLT 13271
             ++DL    P LE +++AL+SLNK  I E++ Y  PP  VEIVM AV +L    P+WA AK  LG+ NF++ L+N++KD I+ K+ K +  Y  Q DF P+ +G VSLA +S+C WV A+E Y  +  ++ PKR  +N A   L   +  L   Q +L++V + ++ L  +Y   + ++++L+++      +L RA  L+  +  EK RW  +++  ++    ++G C+ +AA+ ++ GP+   YR E+  + WI  +    +P   ++    F  +   + +W+  GLP D+   EN  I+ +  +W L+IDPQ Q  ++++        ++I  +  DY+ +LE AI  G  + L++++  +DP L P+L K   R G   ++++G+ E+EY+ +F+ Y+ + LSNP      +   TI+NF V   GLE QLL ++V KE+PE+E +++  +   A     L+ LED+ L LL ++T  +++D +L   L  SKITA ++ ++LE +   E    LAR+ Y P A R + ++FVL D+G ++ MYQ+SL  + +LF   +D+ ++      S   E ++  + D  TY  Y      LF  H+ LF+F +   I+     E+  ++   ++  F++               D  GQ+    DN    WL    W+     E++    F GL NSF+  P  W  W  +  P         E +    N  ++++++  L   ++      ++   LG +F      N+ ++  +S  + P+VFIL    DP + +++L  E  G       +S+G+GQA  A  L+++  + +G W+FL NC L +SWMP+L KL+E LQ+  +D   +F+L LS+ PH DFPI ILQ S+K+  E P G+K  + + + L      +     ++  + +K++F+LC F++V+LER+ +  LG+++ Y FNDSD E+S   +  +L    E  W+AL  +I  INYGG +TD+ DRR L   + +Y  + +               I   G L  ++   S +   D          G   NA++                         + T++ +  D L         S++  I  T      ++ E+V+ L   + + I +       Y   + ++    SP + VL QEI++YN L+  I   +  L   + G   ++ SLE + + I    VPP WG      K L+ W+ ++ +R++    W                                                     + R  ++ +WL GF  P   +TAV+Q+ AR  + S+D L+
Sbjct: 3084 AQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHR------SNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKIL-----ETSGKLNMDEYNFFLRGGVV----------LDREGQM----DNPCSSWLADAYWD--NITELDKLTNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENAC---NEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLA-EHMGMAQRFHALSLGQGQAPIAARLLREG-VTQGHWVFLANCHLSLSWMPNLDKLVEQLQV--EDPHPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRC---SKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPP-----EAFGQHPNADVA-----------------------SQITEAQTLFDTL--------LSLQPQITPTRAGGQTRE-EKVLELAADVKQKIPE----MIDYEGTQKLLALDPSPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYPSQKPLAAWTRDLAMRVEQFELWA---------------------------------------------------SRARPPVI-FWLSGFTFPTGFLTAVLQSSARQNNVSVDSLS 4308          

HSP 2 Score: 275.404 bits (703), Expect = 0.000e+0
Identity = 200/778 (25.71%), Postives = 372/778 (47.81%), Query Frame = 1
Query: 6790 TIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFD-HEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            T+Y YFVD             P I++       L   S     N      ++ ++D++RY++L + L+ N +P+LL G  G GK                  TS + S+L          Q+L SS                  + S+ V           +  ++QT+ N     + S++ KR + +  P   K M+ F+DDLN+P  D FGSQ  LE++R WI+   ++D T     Y+ +  L+ A  P    ++ IS RL   F ++ +  P+ +   RIF   I +    +DF  E+K     + +  + +Y   + ++  +P K HY+FNLR + K+  G+L A+      K  + +   HE  R   DRL+   D E F  I+SD+L     L + H    K   +FG F          KVY+ +TD+  L    E+++N ++    +     + F+++I+H+ R +R++ Q  G+ML++G+ G G+ S  +++S+I     F++ +T  Y    FR DIK++  ++ ++ +       D   + ++SF++D+ N+++SG +P+LY+ DE E I S++  +    +     + ++  LIE++Q  LH+ + LSP    +R+ +R  P+L+NC TI+W+ +W  E+L+ VA                 ++E+    + +  + ++ +  +   +  +ELRR  +++   ++E L+ +  +L     +  +  ++L  GL ++ ETR  +  M  +L +   K+ E  ++ E
Sbjct: 2353 TVYEYFVD-------------PKIRSWTSFEDKLP-KSWRYPPNAPFYKIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGK------------------TSIAQSVL----------QSLPSS------------------QWSVLV-----------VNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKL--QDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDFL------KEPKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDT-QIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAE-------KCLIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCE 3043          

HSP 3 Score: 67.0106 bits (162), Expect = 0.000e+0
Identity = 41/116 (35.34%), Postives = 59/116 (50.86%), Query Frame = 2
Query: 13373 DNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRI-PSFWILRGTAALLQCE 13717
            D+S  +Y P  GV V GLYL+ A W+ +NS L      +  C +P IH     S K   +  Y+  CP Y  P+R G    S   ++F+  + L+S  + P  WI RGTA L+  +
Sbjct: 4317 DDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYS--CPCYYYPNRAG----SSDRASFVIGIDLRSGAMTPDHWIKRGTALLMSLD 4426          

HSP 4 Score: 560.836 bits (1444), Expect = 1.582e-162
Identity = 345/1090 (31.65%), Postives = 581/1090 (53.30%), Query Frame = 2
Query: 2270 PKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQN--EILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTK-NKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXY--EGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVD----WALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMG-HLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFD-EVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL-----PLINLSKE 5491
            P+T+EE    L+ ++ +  ++ +++ +   I++ F I+  ++VPV    L +  +LN      +  ++  +    ++  KF   L    ++ + +   + E          N      LDQ+  ++  +                    ++    ++  R    +F      +  +D++ +E+++     +WE   +WE  +  +   +    +  T+  T       +  L K       EI+   ++ + + K ++P+I  LRNP L+ RHW ++   I     + +++FT+ +++   + Q+ + I EIS  A  E+ +E  L  +   + V +  +V + ++    + G +++   LE++ + +ST+K S++V      V+ WER LS   +V++  +  Q+ W+YLE IF   DI++QLPNE  LF +V+  W+++M +  +    L+     G+L  L   N+ LE IQKSL+ YLE KR IFPR +FLSND+LLEIL ++++PE VQ HL K F N+  L+I      S     V  +  +GE      ++ + G  E WL  +EQ +   ++  ++ C + +  ++F++    W     GQ ++ ++Q++++ +V++ L    +     +L +  +  + +  L   +  +  ++    R  + A++ I++H RD  + L ++ +     F+W  Q+R+ W +    C + Q ++ F+Y  EYLG S RLVITPLTDRCYMT+T AL+ + GG  KGPAGTGKTET+KDL K +G   +V NCS+ LD  ++ ++ SG+ Q G+W CFDEFNR+N+EVLSV+A QI  I +A  +    F F+  EI L   CGIFITMNP YAGR ELP+NL  +FRP+AM+VPD  LI E+ILF EGF   K+L+ K+  LY L   QLS Q HYDFGLR++ S+L   G   RL+  L  E V L    ++NI           +L + D PLF +I+ DLF + +  V++  KL E ++E   +++G +  P  + K+  L     SRH  M++G + SGKT    ILQ +L+ L     P  N+ +E
Sbjct: 1065 PQTLEELGVSLQLVDALKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKKHKEKFKTGLIHSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAML--------------------MAMREEENSLRANLGIFKIEQPPS--KDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKDKGHHRLRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKWEAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLAL--RKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKV--MKKNQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHFDGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNI----------AKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRE-TVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAGDPNFNIVRE 2117          

HSP 5 Score: 36.965 bits (84), Expect = 1.582e-162
Identity = 23/76 (30.26%), Postives = 38/76 (50.00%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +NPKALS+  LYG  + ++ EW +GI+  V +   +    ++  +      D    EN N     N + TL+N E+
Sbjct: 2120 LNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGER 2195          

HSP 6 Score: 116.701 bits (291), Expect = 1.123e-24
Identity = 57/145 (39.31%), Postives = 92/145 (63.45%), Query Frame = 1
Query: 5950 KKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLS-KCSKIQIIPNTSKQSQLFTLCCILEAL 6381
            K + +WI+ DGP+++ W+EN+N+V+DD+++L L NGERI +P  +  LFEV+DL  +SPATVSRC M+Y     + WK  V+SW++ +     P++  E L ++FEK I   + F    C ++  +P   + S + +LC +  AL
Sbjct: 2158 KPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEKR-----PKAEVEPLQRMFEKLINKMLAFKKDNCKELVPLP---EYSGITSLCKLYSAL 2294          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 461.07 bits (1185), Expect = 8.936e-134
Identity = 278/829 (33.53%), Postives = 456/829 (55.01%), Query Frame = 2
Query: 3041 VIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIF-GTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLA-EQWLATLEQGIFEGVKRQIKRCLIE--------MEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQ----CQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFI-FENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIE-------LSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKAL 5458
            ++  L++  L+ RHWH++ K + ++   + + T+G++  + IL+++  I +I   A  EM LE  L ++++ +   E  LV++ N+ T +I G DD+   L+E   ++S +K S Y        + W+ KL+    + D WI+ Q+ W+YLE +F G+ +I   LP E   F  +  +  +LM++    P +L     QG  ++L+     L KIQK+L +YLE +R  FPR +F+ +++LLEI+  ++D   +Q+HL K+FA +  + I+       +       EGE   L + +  + +    WL  LE  +   + RQ+   L          M    +V+W L+ F  Q I ++ ++ +   + + L      E+        +   +++ LELLA +V ++    +R  +EA+I   VH RD+ + L+   +++  DF W + +R+ ++         C V   +S F YG EYLG   RLV TPLTDRCY+TMT AL+  LGG   GPAGTGKTE++K L   +GR  +VFNC +  D   + ++L G+ QVG+W CFDEFNR+   +LS ++ QI +I+ A  +  +  +    K + +N   GIFITMNP Y+GR  LPDNL  LFR +AM  PD  LI +V+LFS+GF TA+ L++KI  L+ LC +QLS Q HYDFGLR++K VL+  G+++ +++    +  L    E  +LIQ++  +  P+L+ +D+ L  S++ D+F          + L + +        L Y ++  E+    ++K+  L       HG+ML+G S SGKT+   +L KAL
Sbjct:  434 LVAELKSEALKERHWHQMMKEMRVNWNLS-DLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNK-TRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSR---EGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEW-LDKFPAQVITLTAEIWWCDEMEKTLADGKGAEN--------VEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKAL 1248          

HSP 2 Score: 39.6614 bits (91), Expect = 8.936e-134
Identity = 15/37 (40.54%), Postives = 26/37 (70.27%), Query Frame = 1
Query: 5569 QVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMI 5679
             V++ KA+S + LYG ++PN+ EW +G+   V +K+I
Sbjct: 1259 HVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKII 1295          

HSP 3 Score: 320.857 bits (821), Expect = 8.318e-87
Identity = 290/1282 (22.62%), Postives = 576/1282 (44.93%), Query Frame = 3
Query: 9237 EEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLS--VTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKK-ALEISKQKLEWK--QNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKD-SFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQS-YHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENP-------FDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFT----ESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQA---TKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEI----------SIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDR---RCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLS--EWSSNVRIRI 12974
            E DL  V P +  +  A+  + K+ + EV+   +PP  V++ + A+C+LL   V   W   + ++   +F+ ++L ++ + +  ++ K +++Y    D+  + V   S+AC  + +W  A   Y ++ + + P R   NE K+   E +K+  E K    ++ ++E+ I     +Y   + + + +K+ +    E++ R+  L+ +++SE+DRW S      +   +++G  + S+A+  + G +  + R+    KW + + N  +    +   +E+  +    L W  N LP D    EN  ++ +  ++PL+IDP  Q   ++   F   + +  S   + +   LE A+R G+++ ++D+E   DP+L P+L +E  R G   +I +G+ +++ SPSF++++++  S  +    +   VT +NFTV    L  Q L+ ++  E+P+++ +RN  L+        LR+LE   L  L +S  KI++D+ + + LEK K  A ++ ++  ET +   ++      Y  L+   + IY  L  L  ++++Y YSL +   +FT  +     +  E  S +   K  +II +  +Q+ +   S G+    + L A +L    MR  +  + +    +Q   F  L   S    +N +A DST      P  +++LT+E  NK    +      F  +    +        W  ++NP       +D +        +  +NS   LI++  L   +L+ SA   V     + F  + +  ++++ +    E     P++       D    +  L +E     +N  + S+  G A    +A+S +  T    GRW+ L+N  L  SW+  L+K + +++       A F+L L+   H   P  IL+ S  +  E   G+K  LL+S +      +T+      +E+ R  +  +C  +A+V ER  Y  LG+S  Y+F+D+DL +          ++ Q    +    + W  L  ++    YGG+I +  D+    C++  L    S   +   I  +     +   +++    +  ++   +   E+L   LGL +NAE V L  + +S + +++          K TD   A +            V+   +   G +  K + Q++P      E +K   +R    + K+ + RFF        E+E+   + LL  I +D+  +       K        +   +    VP  W   ++ + ++  +W +++  R+
Sbjct: 2290 ENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLR---NELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVEA-YDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVL-----KTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL----MRIHIRSNPSAPAYEQ--HFDLLLGRSDFVAKNDEA-DST-----IPGGLDFLTVE--NKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIA-MNS---LIVVHALRPDRLMASAHRVVSTAFDDHF--MQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVE-----TNRQLTSIAIGSAEGFNQADSAL-GTATKSGRWVLLKNVHLAPSWLAQLEKRLHSMK-----PHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKA----PTERSRLYLL-VCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVE--ELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNML----------KVTDEELAFN------EDGKEEVKPQWMAQLG-ELAKQWLQLLP-----KEIVK---MRRTVENIKDPLFRFF--------EREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERL 3491          

HSP 4 Score: 170.629 bits (431), Expect = 2.333e-41
Identity = 139/600 (23.17%), Postives = 283/600 (47.17%), Query Frame = 1
Query: 7378 MLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNI---QSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIE--IKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKL-VVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPND-VYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFI-----YRTAI---------EVGNQFQMELRRPYFL---SSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSE 9105
            +++F D++N+P  D++G+Q  +  +RQ +ELNGF+  +   W  +     + AC+P     + P++ R  +H  ++ +  P   + Q+I+       F++    +   ++     + +  + VY  +  ++ T   + HY+++ R L + + G+  A   L  ++ E + +  AHE IR   DRL+++ +RE   K++              DE  K         PL  S   ++ Y  +T  E+L  +  + +  F  E L+    + F Q + H++R  RI  QS GH+L+IG  G GK +  +  + + G  +F+L + S Y    F  D++ V+ ++  +N   + ++ D  ++++  F++ L  L+ +G +P L+E DE   +++ +K        + D +D +Y    +++ + LHV   ++P+ S  R R   +P+L N C ++W+ DWS  +L  V        +        T  E ++  LT +   +     YR A+          V    +ME ++ + +   +   F++F+  F  +           +  L+ GLN++ ET   + ++++ L   + +++EK E
Sbjct: 1669 LVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-----FNRAMLKMTPAVRGLADQLTNAMVDVYLAS-QEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALK--------RPLLYSCWLSRNYVPVTR-EELQDYVSARLKGFYEEELDVK-LVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEK-LCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVG-----SELTRTMDLDRTDYEGSVR-LTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKE 2245          

HSP 5 Score: 90.5077 bits (223), Expect = 4.288e-17
Identity = 36/71 (50.70%), Postives = 56/71 (78.87%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSI 6174
            QWI+ DG ++  WVENLN+VLDD+++L L NGER++IP +++ +FEV DLK ++ ATVSRC M++  ++ +
Sbjct: 1306 QWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVV 1376          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 460.685 bits (1184), Expect = 9.703e-134
Identity = 278/829 (33.53%), Postives = 456/829 (55.01%), Query Frame = 2
Query: 3041 VIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIF-GTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLA-EQWLATLEQGIFEGVKRQIKRCLIE--------MEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQ----CQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFI-FENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIE-------LSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKAL 5458
            ++  L++  L+ RHWH++ K + ++   + + T+G++  + IL+++  I +I   A  EM LE  L ++++ +   E  LV++ N+ T +I G DD+   L+E   ++S +K S Y        + W+ KL+    + D WI+ Q+ W+YLE +F G+ +I   LP E   F  +  +  +LM++    P +L     QG  ++L+     L KIQK+L +YLE +R  FPR +F+ +++LLEI+  ++D   +Q+HL K+FA +  + I+       +       EGE   L + +  + +    WL  LE  +   + RQ+   L          M    +V+W L+ F  Q I ++ ++ +   + + L      E+        +   +++ LELLA +V ++    +R  +EA+I   VH RD+ + L+   +++  DF W + +R+ ++         C V   +S F YG EYLG   RLV TPLTDRCY+TMT AL+  LGG   GPAGTGKTE++K L   +GR  +VFNC +  D   + ++L G+ QVG+W CFDEFNR+   +LS ++ QI +I+ A  +  +  +    K + +N   GIFITMNP Y+GR  LPDNL  LFR +AM  PD  LI +V+LFS+GF TA+ L++KI  L+ LC +QLS Q HYDFGLR++K VL+  G+++ +++    +  L    E  +LIQ++  +  P+L+ +D+ L  S++ D+F          + L + +        L Y ++  E+    ++K+  L       HG+ML+G S SGKT+   +L KAL
Sbjct: 1366 LVAELKSEALKERHWHQMMKEMRVNWNLS-DLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNK-TRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSR---EGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEW-LDKFPAQVITLTAEIWWCDEMEKTLADGKGAEN--------VEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKAL 2180          

HSP 2 Score: 40.0466 bits (92), Expect = 9.703e-134
Identity = 15/37 (40.54%), Postives = 26/37 (70.27%), Query Frame = 1
Query: 5569 QVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMI 5679
             V++ KA+S + LYG ++PN+ EW +G+   V +K+I
Sbjct: 2191 HVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKII 2227          

HSP 3 Score: 322.013 bits (824), Expect = 4.487e-87
Identity = 290/1282 (22.62%), Postives = 576/1282 (44.93%), Query Frame = 3
Query: 9237 EEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLS--VTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKK-ALEISKQKLEWK--QNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKD-SFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQS-YHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENP-------FDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFT----ESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQA---TKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEI----------SIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDR---RCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLS--EWSSNVRIRI 12974
            E DL  V P +  +  A+  + K+ + EV+   +PP  V++ + A+C+LL   V   W   + ++   +F+ ++L ++ + +  ++ K +++Y    D+  + V   S+AC  + +W  A   Y ++ + + P R   NE K+   E +K+  E K    ++ ++E+ I     +Y   + + + +K+ +    E++ R+  L+ +++SE+DRW S      +   +++G  + S+A+  + G +  + R+    KW + + N  +    +   +E+  +    L W  N LP D    EN  ++ +  ++PL+IDP  Q   ++   F   + +  S   + +   LE A+R G+++ ++D+E   DP+L P+L +E  R G   +I +G+ +++ SPSF++++++  S  +    +   VT +NFTV    L  Q L+ ++  E+P+++ +RN  L+        LR+LE   L  L +S  KI++D+ + + LEK K  A ++ ++  ET +   ++      Y  L+   + IY  L  L  ++++Y YSL +   +FT  +     +  E  S +   K  +II +  +Q+ +   S G+    + L A +L    MR  +  + +    +Q   F  L   S    +N +A DST      P  +++LT+E  NK    +      F  +    +        W  ++NP       +D +        +  +NS   LI++  L   +L+ SA   V     + F  + +  ++++ +    E     P++       D    +  L +E     +N  + S+  G A    +A+S +  T    GRW+ L+N  L  SW+  L+K + +++       A F+L L+   H   P  IL+ S  +  E   G+K  LL+S +      +T+      +E+ R  +  +C  +A+V ER  Y  LG+S  Y+F+D+DL +          ++ Q    +    + W  L  ++    YGG+I +  D+    C++  L    S   +   I  +     +   +++    +  ++   +   E+L   LGL +NAE V L  + +S + +++          K TD   A +            V+   +   G +  K + Q++P      E +K   +R    + K+ + RFF        E+E+   + LL  I +D+  +       K        +   +    VP  W   ++ + ++  +W +++  R+
Sbjct: 3222 ENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLR---NELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVEA-YDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVL-----KTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL----MRIHIRSNPSAPAYEQ--HFDLLLGRSDFVAKNDEA-DST-----IPGGLDFLTVE--NKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIA-MNS---LIVVHALRPDRLMASAHRVVSTAFDDHF--MQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVE-----TNRQLTSIAIGSAEGFNQADSAL-GTATKSGRWVLLKNVHLAPSWLAQLEKRLHSMK-----PHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKA----PTERSRLYLL-VCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVE--ELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNML----------KVTDEELAFN------EDGKEEVKPQWMAQLG-ELAKQWLQLLP-----KEIVK---MRRTVENIKDPLFRFF--------EREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERL 4423          

HSP 4 Score: 170.244 bits (430), Expect = 2.866e-41
Identity = 139/600 (23.17%), Postives = 283/600 (47.17%), Query Frame = 1
Query: 7378 MLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNI---QSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIE--IKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKL-VVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPND-VYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFI-----YRTAI---------EVGNQFQMELRRPYFL---SSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSE 9105
            +++F D++N+P  D++G+Q  +  +RQ +ELNGF+  +   W  +     + AC+P     + P++ R  +H  ++ +  P   + Q+I+       F++    +   ++     + +  + VY  +  ++ T   + HY+++ R L + + G+  A   L  ++ E + +  AHE IR   DRL+++ +RE   K++              DE  K         PL  S   ++ Y  +T  E+L  +  + +  F  E L+    + F Q + H++R  RI  QS GH+L+IG  G GK +  +  + + G  +F+L + S Y    F  D++ V+ ++  +N   + ++ D  ++++  F++ L  L+ +G +P L+E DE   +++ +K        + D +D +Y    +++ + LHV   ++P+ S  R R   +P+L N C ++W+ DWS  +L  V        +        T  E ++  LT +   +     YR A+          V    +ME ++ + +   +   F++F+  F  +           +  L+ GLN++ ET   + ++++ L   + +++EK E
Sbjct: 2601 LVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-----FNRAMLKMTPAVRGLADQLTNAMVDVYLAS-QEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALK--------RPLLYSCWLSRNYVPVTR-EELQDYVSARLKGFYEEELDVK-LVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEK-LCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVG-----SELTRTMDLDRTDYEGSVR-LTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKE 3177          

HSP 5 Score: 90.5077 bits (223), Expect = 4.249e-17
Identity = 36/71 (50.70%), Postives = 56/71 (78.87%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSI 6174
            QWI+ DG ++  WVENLN+VLDD+++L L NGER++IP +++ +FEV DLK ++ ATVSRC M++  ++ +
Sbjct: 2238 QWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVV 2308          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 460.685 bits (1184), Expect = 9.703e-134
Identity = 278/829 (33.53%), Postives = 456/829 (55.01%), Query Frame = 2
Query: 3041 VIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIF-GTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLA-EQWLATLEQGIFEGVKRQIKRCLIE--------MEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQ----CQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFI-FENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIE-------LSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKAL 5458
            ++  L++  L+ RHWH++ K + ++   + + T+G++  + IL+++  I +I   A  EM LE  L ++++ +   E  LV++ N+ T +I G DD+   L+E   ++S +K S Y        + W+ KL+    + D WI+ Q+ W+YLE +F G+ +I   LP E   F  +  +  +LM++    P +L     QG  ++L+     L KIQK+L +YLE +R  FPR +F+ +++LLEI+  ++D   +Q+HL K+FA +  + I+       +       EGE   L + +  + +    WL  LE  +   + RQ+   L          M    +V+W L+ F  Q I ++ ++ +   + + L      E+        +   +++ LELLA +V ++    +R  +EA+I   VH RD+ + L+   +++  DF W + +R+ ++         C V   +S F YG EYLG   RLV TPLTDRCY+TMT AL+  LGG   GPAGTGKTE++K L   +GR  +VFNC +  D   + ++L G+ QVG+W CFDEFNR+   +LS ++ QI +I+ A  +  +  +    K + +N   GIFITMNP Y+GR  LPDNL  LFR +AM  PD  LI +V+LFS+GF TA+ L++KI  L+ LC +QLS Q HYDFGLR++K VL+  G+++ +++    +  L    E  +LIQ++  +  P+L+ +D+ L  S++ D+F          + L + +        L Y ++  E+    ++K+  L       HG+ML+G S SGKT+   +L KAL
Sbjct: 1366 LVAELKSEALKERHWHQMMKEMRVNWNLS-DLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNK-TRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSR---EGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEW-LDKFPAQVITLTAEIWWCDEMEKTLADGKGAEN--------VEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKAL 2180          

HSP 2 Score: 40.0466 bits (92), Expect = 9.703e-134
Identity = 15/37 (40.54%), Postives = 26/37 (70.27%), Query Frame = 1
Query: 5569 QVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMI 5679
             V++ KA+S + LYG ++PN+ EW +G+   V +K+I
Sbjct: 2191 HVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKII 2227          

HSP 3 Score: 322.013 bits (824), Expect = 4.487e-87
Identity = 290/1282 (22.62%), Postives = 576/1282 (44.93%), Query Frame = 3
Query: 9237 EEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLS--VTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKK-ALEISKQKLEWK--QNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKD-SFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQS-YHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENP-------FDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFT----ESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQA---TKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEI----------SIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDR---RCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLS--EWSSNVRIRI 12974
            E DL  V P +  +  A+  + K+ + EV+   +PP  V++ + A+C+LL   V   W   + ++   +F+ ++L ++ + +  ++ K +++Y    D+  + V   S+AC  + +W  A   Y ++ + + P R   NE K+   E +K+  E K    ++ ++E+ I     +Y   + + + +K+ +    E++ R+  L+ +++SE+DRW S      +   +++G  + S+A+  + G +  + R+    KW + + N  +    +   +E+  +    L W  N LP D    EN  ++ +  ++PL+IDP  Q   ++   F   + +  S   + +   LE A+R G+++ ++D+E   DP+L P+L +E  R G   +I +G+ +++ SPSF++++++  S  +    +   VT +NFTV    L  Q L+ ++  E+P+++ +RN  L+        LR+LE   L  L +S  KI++D+ + + LEK K  A ++ ++  ET +   ++      Y  L+   + IY  L  L  ++++Y YSL +   +FT  +     +  E  S +   K  +II +  +Q+ +   S G+    + L A +L    MR  +  + +    +Q   F  L   S    +N +A DST      P  +++LT+E  NK    +      F  +    +        W  ++NP       +D +        +  +NS   LI++  L   +L+ SA   V     + F  + +  ++++ +    E     P++       D    +  L +E     +N  + S+  G A    +A+S +  T    GRW+ L+N  L  SW+  L+K + +++       A F+L L+   H   P  IL+ S  +  E   G+K  LL+S +      +T+      +E+ R  +  +C  +A+V ER  Y  LG+S  Y+F+D+DL +          ++ Q    +    + W  L  ++    YGG+I +  D+    C++  L    S   +   I  +     +   +++    +  ++   +   E+L   LGL +NAE V L  + +S + +++          K TD   A +            V+   +   G +  K + Q++P      E +K   +R    + K+ + RFF        E+E+   + LL  I +D+  +       K        +   +    VP  W   ++ + ++  +W +++  R+
Sbjct: 3222 ENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLR---NELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVEA-YDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVL-----KTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL----MRIHIRSNPSAPAYEQ--HFDLLLGRSDFVAKNDEA-DST-----IPGGLDFLTVE--NKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIA-MNS---LIVVHALRPDRLMASAHRVVSTAFDDHF--MQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVE-----TNRQLTSIAIGSAEGFNQADSAL-GTATKSGRWVLLKNVHLAPSWLAQLEKRLHSMK-----PHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKA----PTERSRLYLL-VCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVE--ELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNML----------KVTDEELAFN------EDGKEEVKPQWMAQLG-ELAKQWLQLLP-----KEIVK---MRRTVENIKDPLFRFF--------EREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERL 4423          

HSP 4 Score: 170.244 bits (430), Expect = 2.866e-41
Identity = 139/600 (23.17%), Postives = 283/600 (47.17%), Query Frame = 1
Query: 7378 MLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNI---QSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIE--IKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKL-VVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPND-VYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFI-----YRTAI---------EVGNQFQMELRRPYFL---SSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSE 9105
            +++F D++N+P  D++G+Q  +  +RQ +ELNGF+  +   W  +     + AC+P     + P++ R  +H  ++ +  P   + Q+I+       F++    +   ++     + +  + VY  +  ++ T   + HY+++ R L + + G+  A   L  ++ E + +  AHE IR   DRL+++ +RE   K++              DE  K         PL  S   ++ Y  +T  E+L  +  + +  F  E L+    + F Q + H++R  RI  QS GH+L+IG  G GK +  +  + + G  +F+L + S Y    F  D++ V+ ++  +N   + ++ D  ++++  F++ L  L+ +G +P L+E DE   +++ +K        + D +D +Y    +++ + LHV   ++P+ S  R R   +P+L N C ++W+ DWS  +L  V        +        T  E ++  LT +   +     YR A+          V    +ME ++ + +   +   F++F+  F  +           +  L+ GLN++ ET   + ++++ L   + +++EK E
Sbjct: 2601 LVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-----FNRAMLKMTPAVRGLADQLTNAMVDVYLAS-QEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALK--------RPLLYSCWLSRNYVPVTR-EELQDYVSARLKGFYEEELDVK-LVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEK-LCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVG-----SELTRTMDLDRTDYEGSVR-LTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKE 3177          

HSP 5 Score: 90.5077 bits (223), Expect = 4.249e-17
Identity = 36/71 (50.70%), Postives = 56/71 (78.87%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSI 6174
            QWI+ DG ++  WVENLN+VLDD+++L L NGER++IP +++ +FEV DLK ++ ATVSRC M++  ++ +
Sbjct: 2238 QWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVV 2308          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 433.335 bits (1113), Expect = 8.255e-123
Identity = 267/818 (32.64%), Postives = 448/818 (54.77%), Query Frame = 2
Query: 3056 RNPNLQLRHWHKIEKMIGLSLTKNKNFTIGEL-------ISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVS--HSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDW--ALNNFGQSIL-VSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIR-YLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPS---YAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKAL 5458
            R   L   HWH++ + +GL     +  TI +L       +S  I++    + +++  A  E+ +   + ++    A  EF L    HSN ++  II    +    L++S   + ++K S Y      +   WE +L+     L +    Q+ W+YLE IFG    +  LP+E   F  VD E+R+++    +   ++  C++Q + + L+    +L + QK+L  +LE KR  FPR +F+ +D+LLEIL ++ +P+ +Q H+ KLF  ++++Q  S+     S+      EGE  PL + +R+    E WL  L          +++R L ++  +   D   +L  +   +L ++ +VKFS ++   L G+ D        + S  S L++ L+       +D VS     L+++I+  +H+ D    LL N  KS   + W++Q+R YL N       + QV S FEY  EY G   +LV TPLTD+CY+T+T A+   LGG   GPAGTGKTE++K L+ +MGRQ +VFNC + +D +++ ++ +G+++ G+W CFDEFNR++  VLS ++ QI +I+ A  SR     F  K +++NP   IF+T+NP+   Y GR ++PDNL  LFR V M  PD  LI   IL+SEGF+ A  L+ KI ++++L    LS QQHYD+GLR++K VL   G LR  +   +ET         ++++QA+ ++   +L   D   F S++ D+F +  + +   + L   + ++ +E+G ++   Q+EK+  L  Q++ R GV+++G + SGK+ I  ILQ++L
Sbjct: 1162 RGDVLSADHWHEMFRFLGLP----RGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTLWAAQTEFTLADYKHSNGQNLKIIKEWKESINSLKDSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFG----RGALPSEASRFSRVDSEYRAILNDVSKDARLVSLCSRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFSSTGETIISMVSS---EGETVPLSKAVRIVPQVESWLQELSD--------EMRRTLKDLTAQAVADAQPSLAKYPSQVLCLAEEVKFSASIENNLNGSSD--------LNSFKSQLLEKLKAYTNMKVDDKVS--DLKLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLVN---GGIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTFGGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNET---------DLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSL 1938          

HSP 2 Score: 30.8018 bits (68), Expect = 8.255e-123
Identity = 13/39 (33.33%), Postives = 25/39 (64.10%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKM 5676
            + V   NPKA++ + L G ++ ++ EW +GII M  +++
Sbjct: 1945 LKVTQFNPKAVNRSKLLGNMDMDTREWSDGIITMAAREV 1983          

HSP 3 Score: 273.863 bits (699), Expect = 4.759e-91
Identity = 268/1062 (25.24%), Postives = 470/1062 (44.26%), Query Frame = 3
Query: 9213 VENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSV-TPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKD--FNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDI----VSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQN-YASENNNGNGIEMFVKSPKVL--------IGHLT 12350
            +E    K +E L  V P+++ + +A+ S+   S+SE+R  R PP  V  ++ AV + + +   SW   +  L  +     ++N++ + I  +++K +     QK   F   +    S A   +  WV A   Y  +   I P     N+  K L+ +++++E     L+ V++ +  L  K++  +KE  Q+K  +    + +  A  L+E++  E +RW   I+   +    +    + ++A+ T+ G  +   R+   K    +       +   +K + F       LNW   GLP D    EN +I+  S   PL+ID   Q   FL + F +        Q D +  +E AIR G TI ++DI  + D  L P+LRK+   +G   +I  G   ++++P FK+Y  +      +  +    + I+NFT  +  L  QLL + +  EKPE+E   +  LR        L  LE   L  L  S   ++ ++ L  +L KSK +A  I K + E+ Q  K+L   +  Y+PL++  + ++F  ++L   N MY YS+    +LF + +     +          T+++ +   +    ++  S G+F   R +FA     + M    +        K+W  F  +    S     L+      Q I  PD ++ L              ++     L N+F++  +    WN         +   K   +K +  F+K++ I  +   +L +    +V   L           L ++F ES +  PI+FIL   +DP         EL    S++++    +SMG+GQ   A   I+++   KG W+ L N  LM+  +PS+ K      +S      NF+L L+T   + FP  +LQ SLKI  E P G++N LL+++        T+ +   QS      IF L   +A++ ERR +   G++  Y+F  SD+ ++ K     LT N+  W  +  ++  + YGGRI ++ D + L   L   +  E  NG      VK   +L        IGH++
Sbjct: 2862 IEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMGILDTSWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLLKSMCKMFN-----MPPTFKPLSFASLETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLFL-SKFLEKSETFKAAQPDLMTQIELAIRFGKTIIIDDI-VEFDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCEDK--------SSTRVETLARQMQLTVFYHISRGIFRQDRLMFAVAFINATMPKMFQP-------KEWELFTGVLVDESTDLSALRV-----QWIS-PDRLQSLA------------RIRTHLPSLFNNFQIQDDA--TWNEFSKTLQCENAFPKNVELK-MTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADP-------SQELSEFASSMNVPYHSISMGQGQEIAAYEAIRES-ASKGEWLCLNNLHLMLQAVPSIFK-----HLSLTTPHENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYT--QIDRSTKNVITCQS------IFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVA-KSFVEQLTANKADWEFVRGILKFVIYGGRIENDFDFKVLDSYLNVLFCDEKINGRAGSQLVKGIDLLATTNVQEYIGHIS 3858          

HSP 4 Score: 84.3445 bits (207), Expect = 4.759e-91
Identity = 132/629 (20.99%), Postives = 275/629 (43.72%), Query Frame = 1
Query: 7267 SSIKFNSQTSINKALQHMTSKMVKRGQDI--IGPPKNKK-MLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP---NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQ-KDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKS-HYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLN-----TNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            +S+  ++Q+S +  LQ +    V+       +  PK++  M+LF+  +N+P  D++G+   L +++Q +   GFFD+ +L+W  + +   + + +P        IS RL      ++L    S+    I++  +     +  + + EI A+   +VDI    Y K  + ++  P  S  ++F+ R L   +  LL  +    +++  +   +  E  R   DRL ++ D+  F +IL + + +S + N       K  +  G   P + ++        ++D  +L+     SIN F  E  N     T+   FF   I       R+L    GH+ + G  G G+  +V++ + +    +F   +T++++   F  ++K  I +++  N   V+ L D   L  + F+  + +L+ SG++P L+   EL+ +++ +      +   S    +   L  +I+  +HV + L    + ++  +  NP+++  C + +   +   SL+ +   ++E         I T   D + NL E                         +    + +F+ NFF +L    +  +    RL  G+++L E R  + KM++   + +  + EK  E +
Sbjct: 2249 ASLYCSAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFFDH-NLEWVSIENIQFVGSMNPIGDGAAVSISNRLFSLLRCVSLNTTDSSQLTSIYRTYLTPILEEVGERNSEIIAN--RMVDI----YNKVQSNFR--PTDSVVFLFSPRDLTNWVVSLLRHE----LDQGKLEAVICFEARRIFADRLPTENDKLKFEEILRNVIPIS-QANETVIFKEKVYVTTGTVVPGESNTGLPLTPINMSDFNQLL---AKSINRFAFEIANFNCPLTSQLAFFCACID------RVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILED-HQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVALVSE---AANQASFTGALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEIPKIQMESQGITTTDAILTGFNDVLVNLPEH----------------------LSIQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEAD 2828          

HSP 5 Score: 88.5817 bits (218), Expect = 1.608e-16
Identity = 40/81 (49.38%), Postives = 57/81 (70.37%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWM 6204
             WIV DG I+  WVE LN+VLDD+++L + +GERI   +++ FLFE D L+ +SPATVSR  MIY+ ++ +  K  V SW+
Sbjct: 1991 HWIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWL 2071          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 140.198 bits (352), Expect = 3.426e-32
Identity = 73/238 (30.67%), Postives = 144/238 (60.50%), Query Frame = 3
Query: 9210 AVENYSLKCEED--LLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPS-------------WANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQ-YTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSI 9875
            A +  SLK E +  L S  P LE++++AL+++ ++ +S ++  R PP  V + M AVC+LL V P+             W + + LL D +FL K+ ++ +D ++KK  K +++ Y  +++F+PE+V   SLA   +C+WVLAI+ Y+ ++ ++ PKR+ + +A+  ++   ++LE K+  L KV + ++ L +++    +++++L+ ++     R+ RA  L++A+  EKD+W + I
Sbjct: 2192 ATKAQSLKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKITNEIGEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKWKNKI 2429          

HSP 2 Score: 98.9821 bits (245), Expect = 9.180e-20
Identity = 125/590 (21.19%), Postives = 247/590 (41.86%), Query Frame = 2
Query: 2966 EKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQ-TKEKPLVLKCCTKQGVLQILQTCNSKLE----KIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRV-RGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQK-QFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSEL----DFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFN 4702
            E      E L  ++ ++ E +  LPV+ A+    ++ RHW  I +    S+    N  + EL+    ++      ++   A  E  LE  + K+K  +    F  V+H   +         +   L  S   +S+      +DHIR     W   L +    +  +  C   W  +E +F T DI  Q+P+E R F ++   W  +  Q T+E+P++     +  ++Q L    S+LE    +++     YL  KR +FPRLF LS++ +L ++  +++P N + ++  LF +   L     +++   I+     E  +   P N+ + +   E+W+  L+  I   ++ +I+  + +M  K   V+  LN   Q   V  ++ F+  +  ++K          LTI  + S+L      + +   +  V +K    E + V+  H   S+  L+   +  ++    D+ W  Q+RY W+  +   +V  V + ++Y  + + C   ++   L D          +F   G   G          + ++  +G+   + +   ++D      L+ G +  G     +E N
Sbjct:  669 EHETTSKEALLKIEIVLAEFEKLLPVLGAISCQAMKDRHWKMILQDSETSVKVEGNPLVSELLEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQWVTATF--VTHQGGELLTTELNVQMQAHLARSQTILSSPHAFSILDHIR----HWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPIL----EQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPS---LTTFDQNTKMEIISVSTKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEKMNYKLSPVETILNEPIQVAAVYLKIAFTWQMENSMKQNS-------LTI--LASEL-----KICIRDCQHAVLHKHDRWEFLPVL-YHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYWHLENVFIRVGTVSTRYDYEVQGVDC---MIDNQLVDEAVKYFICMNHFGFNGFVNG----MDVNLARQIAGALGKPFAICDTEQEID---CKMLIEGALLFGGTVFIEEKN 1220          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Fly
Match: Dhc16F (gene:FBgn0283476 transcript:FBtr0074509)

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 381/1132 (33.66%), Postives = 606/1132 (53.53%), Query Frame = 2
Query: 2105 IGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNF---TIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXY------EGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNI-LIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            +G + L   N      P   ++  ++   L K A           +  +  +  +P    E V H+ F++K + E+  +      ++ +  II +F +P+  +    Y      + + +  +     K+ + I +    ++  I  ++  I E+  +A     LD N  +  + ++L ++   +         +  YQ+ F               Q DL        + +++     DI MR  L+ T S+WE     +IV   +   V  + +  S+T       +K LP+N I+P ++      K  LPVI  LRNPNL+ RHW +IE ++     + K+    T  ++ +   +   + +M+IS  A  E+ LE+ML  ++  +   E  +V H + +D +I+ G +++   L++S++ I+TI  SK+V  I+++V++W   +   AK  + W++CQ  W+YLE IF + DIQRQLP+E ++F  VD  ++  ++Q K+  L L   +   V ++L   N  L+ I + LE YLE+KR++FPR +FLSNDELLEIL++ + P+ VQ HL K F  +++L+  S       +            EGE     + ++ RG  E+WL+ +E+ +F   KR ++        K+  DW  ++  Q +L  +QV+++ ++ R  +G        L  +       +++L  LA    ++I S  R  L A+I I VH +DS + L+E +V    DF W K +R+ W + +         +   Y  EYLG    LV+TPLTDRCY+ + GA   +LGG   GPAGTGKTET KDL+K + +QCVVFNCSD LD   + +  SG+ Q G+WCCFDEFNR+++EVLSVIA Q+ +I+ AK  R +RFIFE +EIK+N  C +FITMNP YAGR ELPDNL  LFRP++MMVPDY LI EVIL+SEGF   K+L+ K+  +Y+LC+ QLS Q HYDFG+R++KSVL++ G L+          + + N+  +I LI A++ SN P+ + DD  LF+ I+ DLF   +        LE S+ L  ++   +  P  I K   L   +  R GVML+GP+  GK+V+   L+ AL+ L
Sbjct:  613 LGLLKLTQTNFKDTVTPVCSRLQNVLATYLPKLAEEETTRLYEEAQDFHGRICYEPHETLEIVAHIRFLDKCSTELDGIFDGIDYVHDLLLIIKDFGIPIDDDSKEDYMDTEDYLNRTRETLEEIREKRQDFINRLEDAMQDDIAALKEDIHEVAIEALQPWLLDANSNRLSVTNKLDSMLERLNKCRETADEFLGYQKEF---------------QIDL-------TMYDEMASGFYDIRMRQNLYRTWSDWEESLAEWIVSDFNTLNVVDMVELNSKTIKNCMQFQKYLPENNIVPVLQKSAEAFKEKLPVIGYLRNPNLRARHWAEIEDLLNRKFFQEKDILIQTYEDVHAFDDVAIGEALMQISSQATGEVQLENMLKGIETTWKETELSIVPHHDAKDVFILAGTEELQAVLDDSNVNINTIAASKFVGPIKSKVDEWINAMDQFAKTFESWMDCQGAWIYLEAIFASADIQRQLPHEAKMFFTVDKSFKETVRQAKKVALALPTMSSVDVHKVLVENNRLLDLISRGLEAYLEVKRVVFPRFYFLSNDELLEILAQTRIPQAVQPHLRKCFDAIYRLEFGSKEGGDGKMVATNDIVAFLSPEGEKLQFGKGLKARGAVEEWLSKVEEAMFVSCKRYMRFGYQCYPAKEREDWFQDHPNQVVLTVSQVQWAADIHRIYEGKERNPLNILEKMAKFEIKCLKDLGALAALTRKNISSLLRKILCALITIDVHAKDSVRMLIEKEVCKASDFNWLKMLRFYWADETETVYSRMAAANIPYYYEYLGAGGVLVLTPLTDRCYLCLMGAFQMDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKMMGRFFSGLAQCGAWCCFDEFNRIDIEVLSVIAQQLITIRTAKAMRVKRFIFEGREIKINRSCCVFITMNPGYAGRTELPDNLKALFRPISMMVPDYALISEVILYSEGFEDPKILARKMVQMYQLCSQQLSQQNHYDFGMRAVKSVLVMAGALK----------RASPNQREDITLIAALRDSNIPKFLADDAVLFRGILSDLFPGVELPDSQHPHLEASLRLGLRQKNLQAVPTTIRKCLQLYETMCVRWGVMLVGPTGGGKSVVLHALEFALSHL 1712          

HSP 2 Score: 44.2838 bits (103), Expect = 0.000e+0
Identity = 33/112 (29.46%), Postives = 55/112 (49.11%), Query Frame = 1
Query: 5566 VQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDS 5901
            +Q +NPKA+++N LYGYV+  +LEW +G++ +  +   +  ++    +      D    EN     L T+L++        +   L N E I KL+       E QD+LQ S
Sbjct: 1727 IQTMNPKAVTMNELYGYVDLKTLEWQDGLLGLAVRTATTVEDEIHQWIMCDGPVDAVWIEN-----LNTVLDDN-------KMLCLANSERI-KLTAWIHMLFEVQDLLQAS 1825          

HSP 3 Score: 547.74 bits (1410), Expect = 2.254e-155
Identity = 374/1272 (29.40%), Postives = 643/1272 (50.55%), Query Frame = 3
Query: 9240 EDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFK-DSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTEC--VDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSV--KYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLL-ESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNN--QSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN---NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASEN------NNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWG---LLSIGKSLSEWSSNVRIRIDFIGFWC 12995
            +DL    P L  + +AL  L KA I+E++ +  PP LV+  M AVC+LL V P+WA+AK ++ D NF+++L  Y+K+ + +   K +++Y   KDF P     VS   +S+  WV++++ +  V  ++ PK K    A+  L+     L  KQ +L  VE  I+ L +  +   +E + +++ V LT  R+ RA  L  A+  E+ RW  ++K        + G  + +AA   + G ++  YR      W+       IP    +  ++     Y +  W+ +GLP+D+   EN     ++ +W L+IDPQ+Q  R+++   + ++ +VI       + +LE A+R G  + LE+I   IDP L P+L++E +R    T +KLG+  ++Y  +FKLY+ + L NP  +  V   VT++NF V   GLE+QLL+ IV+ E P +E +RN  +    +D + L  LEDK L LL +S   I++D EL + L  +K T+L I  RL +T + EK +  +R+ Y  LA RGA +YFV+A L  ++ MYQYSL +F  +F     +D   + +   +S     +L+ I D++        S GLF  H+ +F+F+L+ S+     E  + R+ ++++  F+      ++            +   QP  I+   +E W+ C FLE      FSGL +  +L    +I+   ++  FD +  N        K L  F KL+ IS     + + +   Y++  +G+ F+     + L +++ ++ A  P++F+L   SDP++  +K   +++  T     +S+G+GQ   AE+LI+K+ +  G W+FLQNC L  S+M +L+ ++ NL +       +F+L LS+ P   FPI +LQNS+KI  E P GIK  +  +       ++ +  +    Q+   R ++F LC+F+AV+LERR +G LG+++ Y+F++SD E  +K +  F+     +E+ W A+  + G+I +GGR+TD  D RCL  +L  ++S+           G + + + P+     LT++ +     +     V +   + G+  NA IV    ++  FI  +++ Q +   D+     N        I+ +    +++ +     ++ + D   V+   G++                              VL QEI ++N  L  IH  +  L   + G   ++E LE V   +  N VP SW     LSI K L  + S+ + RIDFI  W 
Sbjct: 2706 KDLEIAMPALREAEEALKGLTKADINELKSFTTPPALVQFCMEAVCILLGVKPTWASAKAIMADINFIKRLFEYDKEHMKEDTLKKVKKYIDHKDFVPAKFEKVSKVAKSMSMWVISMDKFSKVYKVVEPKIKRKEAAEAELKEVMTVLRQKQKELAAVEAKIQGLRDSLEEKQREFQVIQDNVDLTYGRINRAGRLTSALSDEQVRWRETVKSLTGDLACVPGDVLVAAACVAYLGAFSHEYRRDMSALWVSKCREHKIPSSPEFNLLKVLGDPYEMRQWNVDGLPKDNISIENGIYATRALRWALMIDPQEQANRWIRNMERANNLQVIKMTDSTMMRVLENAVRQGYPVLLEEINETIDPSLRPILQRETYRFEGRTYLKLGDMVIDYDDNFKLYMTTKLPNPHYLPEVCINVTLVNFLVTESGLEDQLLADIVAIELPAMEIQRNDLVVKINSDKQQLLALEDKVLKLLFNSEGNILDDEELVETLNDAKETSLIIAARLIDTEETEKVITASRERYRILASRGAILYFVVAGLAEIDPMYQYSLKYFTQVFCNVLRLDHPPQSVEVRISTLMTDELRAIFDNI--------SRGLFENHKIIFSFLLALSV-----ERQEGRVTEEEF-LFLSRGPVGNI------------RTKIQPAKIKMSQIE-WDSCIFLEDNFSSFFSGLTD--ELDKPFFIQMQENKEVFDFAQTNQPPTDKWNKRLRVFHKLMFISAFRKPRFLLNVVCYLQSTVGKYFTEASGGTQLSSVYLDTSAVTPLIFVLSTGSDPMSGFLKFTTQMQF-TDKYYSISLGQGQGPLAENLIEKS-LRLGHWVFLQNCHLATSFMQTLETIVRNLTLGITKAHVDFRLYLSSMPIQTFPISVLQNSVKITNEPPKGIKANVFGALT-----DLKQDFFEQHIQNGNWRAIVFGLCMFHAVLLERRKFGPLGWNITYEFSESDRECGLKTLDFFIDREVLDEIPWEAILYINGDITWGGRVTDYWDLRCLRTILTIFSSKRIIQPDYKYCRG-DSYYRDPRK--KTLTEYSA-----YVQGFPVLEDPEIFGMNQNANIVFQTKETAFFINTLLLGQPRSAADEGQAMENE-------IAQQTIARIQKALATKIKREPIHDTLSVLDAKGQV-------------------------PSLTIVLVQEIDRFNIALGIIHDSLVNLSKAIKGLVVMSEELENVFKALLSNQVPASWAKRSFLSI-KPLPSYISDFQRRIDFIQQWA 3900          

HSP 4 Score: 394.43 bits (1012), Expect = 6.997e-109
Identity = 286/1057 (27.06%), Postives = 497/1057 (47.02%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTF--DHEHLNTN---NFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDP---NDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKS 9102
            QWI+ DGP+++ W+ENLNTVLDD+++LCLAN ERI + A +  LFEV DL  +SPATVSRC M+YV    + W   + +W +  +    P    EF Y+LF       + +  K  KI+      ++  ++T+  +L                       SK     ++N +             Q E  K S + +  ++   L+ K++ +A  W+  +     E +  E     A  +    +                           L N T+++Y +D++K  +  W          ID      F    +  +       + ++D+ +Y ++S LL     PV++ GD+G+GK+     +L   C K  S                    N++  I N                                  F++QTS N+  + +   + KR +  +G P  K +++FIDD+N+P +D +G+   +E++RQ+++  GF+D   L W  + D  L  AC+P    ++P++ R  +HF + +LP+P+     +IF   I R F Q  FS  ++A    +V+  + VY +       +P KSHYIFNLR L K I G+L A +     +  + +   HE  R  HDRLI+  D+ I FK L  E+ M    N       +  I+FG F    G   + ++Y +I D  KL    ES +N +  D+  +        I F+ +++H +R  R+L    G+ L++GV G GK S  +++S +   + +++ M  +Y+  +F  D++ +   + + N+P    L D   +V + F++D+ N++NSG +P+L+E DE E I+ + + +        DP   +D+Y   I +++  LHV + +SP    +R R R  PSL+NC TIDW+  W TE+L SVA            +     K +   +L   ++F+++T  +   +F  E++R Y+ +   ++E L  + ++L+   ++  + R R++ GLN+L+ET  +I  M ++L  + P++ EKS
Sbjct: 1772 QWIMCDGPVDAVWIENLNTVLDDNKMLCLANSERIKLTAWIHMLFEVQDLLQASPATVSRCGMVYVDPGDLGWIPLIDTWREVDMKHKLPAPLAEFCYQLF-------VGYFDKALKIE------RKRAVYTIHQVL----------------------GSKVRLCCELNSA-------------QFEAVKWSAMSE--EQGKELVTKIFAWAVLWAIASNLKDAEKVSFEEQWSKAIAQHPNMT---------------------------LPNFTLWNYRIDLEKMDWGSW----------IDIMAKFVFDPETSYYDMQ-----VPTVDTTKYGYVSDLLFKRGMPVMVTGDTGVGKT-----VLAISCMKRLSQG------------------NVIPVILN----------------------------------FSAQTSSNRTQEMIEGPLEKRKKTQLGAPVGKTVIVFIDDVNMPKLDTYGASPAIELLRQFLDFKGFYDREKLYWKEILDVVLGCACAPPGGGRNPLTPRFVRHFALFSLPKPNEETLTQIFN-GILRGFLQT-FSSAVRALSEPMVNACVDVYMRVATVMLPTPDKSHYIFNLRDLSKCIQGILQASNLHYNQENQILRLFYHETTRVFHDRLINIEDKNI-FKALMKEVCMD-HFNRPVINDNEPPILFGDFMVF-GKPKNERIYDEIRDHTKL----ESVLNDYIADYNSVAVGKQMKLILFQDAMEHTVRLARLLRSDRGNGLLVGVAGMGKQSLTRLASHVNEYNCWQIEMRRNYDLNAFHEDLRVLYRIAGIDNQPVTFLLID-SQIVEEEFLEDINNILNSGEVPNLFEGDEFEKIILDAR-DGCNENRKDDPCTRDDIYKFFINRVRNNLHVVMSMSPVGDAFRRRCRMFPSLVNCTTIDWFTSWPTEALYSVA---------LGLLTKIAPKMEDRISLASTTVFMHKTVEDASVKFYKEMKRHYYTTPSSYLELLKLYQNLLKIKNMEIIAKRKRIANGLNKLLETNEVIAVMGKELEVMVPQLDEKS 2659          

HSP 5 Score: 63.1586 bits (152), Expect = 2.069e-15
Identity = 29/95 (30.53%), Postives = 52/95 (54.74%), Query Frame = 2
Query: 13415 VFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTA 13699
            V G++++ A W+L    L        + ++P++     +    +   +  +  PLY+T  R G+LS++G S+NF+  + L+S   P FWI+RGTA
Sbjct: 3981 VHGIFIEAARWDLSKGGLCDANFGELFSRMPVVRFKPCL----EISPTVRYEAPLYKTQQRSGVLSTTGHSTNFILAVLLRSHNDPEFWIMRGTA 4071          

HSP 6 Score: 42.3578 bits (98), Expect = 2.069e-15
Identity = 19/43 (44.19%), Postives = 25/43 (58.14%), Query Frame = 3
Query: 13176 YWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLPRNLL 13304
            YW+ GFF PQS +T V+Q  AR     ID L +  +V  R L+
Sbjct: 3908 YWISGFFFPQSFLTGVLQTYARRRVLPIDSLKIDFDVFERELV 3950          

HSP 7 Score: 63.5438 bits (153), Expect = 7.029e-9
Identity = 57/232 (24.57%), Postives = 99/232 (42.67%), Query Frame = 2
Query:  590 TPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTC-QNYTDKINLSSYL--EEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFC-QFIVESINYDENSDENKKSKI 1273
            TP+ QW  E   F  +  + +F+ FR WK F+ W   I   K+ + R++L  NL  + P        + R+  D++    +N           F++ S   N   FY  +   +R++ E LHK ++   E + KT  +  TD I    +   +E++   +L     +    +R R R   K +  FL   D  + Q+ +RI K++       F V        +D NK  ++
Sbjct:  225 TPLDQWQQEFKQFLSIIQIRSFSIFRLWKGFKVWEKTIKWRKLNEARDYLQNNLFIVIP---QLAKAILRMRSDIVQLQRLN-----------FVNVSNIENWHPFYFLE-THMRIY-EQLHKTFTDFREFIAKTIFRACTDAIQARGFYPDDEVNYYPSLKKMREAHSFMDRARKRAFCKTLTNFLTYCDMMVYQMLYRITKKSFEDLATSFEVHDEVGPSEADINKHDRV 440          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Fly
Match: Dnah3 (gene:FBgn0035581 transcript:FBtr0289982)

HSP 1 Score: 493.041 bits (1268), Expect = 0.000e+0
Identity = 371/1391 (26.67%), Postives = 658/1391 (47.30%), Query Frame = 3
Query: 9234 CEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPS-------------WANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQ-YTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDS-FRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNI-EWLTLEVWNK-CKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKY--LNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQ---SEQIRKM----IFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNE-VQWNALHNVIGNINYGGRITDNLDRRCLMHLLQ-----NYASENN---NGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDS-----NSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEV 13286
            CE DL    P +EA+++AL++L  A I  V+  +NPP  V++ M AVCV+  + P              W  +  +L D  FL  L  ++KD I   + K +++ Y   +DF PE +   S+AC  IC+WV A++ Y  V  +++PK+  + EA+  L    +KL  K+ +L+ + D ++ L++ +    +E+K+L++ +    ++L RA  L+  +  EK RW  + K+  ++  NI+G  + +     + G +T  YR      W  +   K IP  + +          TI  W   GLP D+   EN  I+  S ++ LLIDPQ Q  ++++   K++  +VI     +Y+ +LE AI  G  + +E++  ++D  L P+L K   +      IK G+  +EY+P+F+LY+ + L NP+    V  +VT++NF +   GL EQLL+++V+ E+P+++ ++ + +   A + ++L  +E K L +L  S   ++ D      L  SKI + DI+++    +  E ++  AR+ Y+P++   A ++F +++L  V+ MYQYSL+WF NLF   + +  K      S     +L+ + D  T   Y      LF   + + + ++   I+      S  R+ +     F+                   G     P+ +  WL  + W   CK  ++E      GL N  ++      +W+   N +D S+ +  +    +  +N    LI+I  L   KL+ + R ++   L   F      +L   F +S  KIP+VF+L A SDP+  +     + R     L  +S+G+GQ  +AE +I +   H G+W+ LQNC + ISWM  L+++  +  ++   N  +++L  +++P + FP+ +LQNS+K+  E P G++  + +SF  D    + +  + N    S+   K     +F L  F+AVV ERR +G LG+++PY+FN+SDL+IS+ Q+  F+  ++ + +     + G  NYGGR+TD+ DRR ++ LL      N   E+N   + +G      SP      L   + ++SF  S    V       GL +NA+I R   ++ + I  +++ Q+      K + S     + A+ + K +  ++P   E+  ID   K +        P+                 Y+N            + VL QE+ ++N LL  I K +  +   + G   +   LE             +   + IGK  ++W                  L++ +  L+ + S  S + A           L + +E ++  +            + YW+ GF+  QS IT V+QN +R     IDM+ +   V
Sbjct: 3008 CETDLAEAIPAMEAALEALNTLKPADIFIVKSMKNPPYGVKLTMEAVCVIRGIKPDRKPDPSGHMVEDYWGPSMRMLSDMKFLDSLKTFDKDNIPPPIIKRIREKYIADRDFVPEKIKAASMACEGICRWVRAMDVYDKVARIVMPKKAALAEAEGELSQQMEKLNAKRAELQVILDKLQKLNDFFAEKSREKKRLEDEIDNCEKKLNRAEKLLGGLGGEKTRWSEAAKNLHESISNIVGDVLLAGGCTAYLGYFTTEYRVNILDDWNALCKRKHIPSSETFSLATTLGHPMTIRAWSLAGLPADNFSVENGIIVTNSSRYSLLIDPQVQANKWIKNMEKNNNLKVIKQSDANYMQVLELAITFGQPVLIENVGEKLDSNLTPILEKNVIKHKGGLFIKSGDQMIEYNPNFRLYITTCLRNPRYPPEVMVMVTVLNFMITEQGLREQLLAIVVAHERPDLQEKKEQLIIESARNRDALYTIESKILEVLSTSEGNVLEDENAINILSSSKILSEDIQEKQVIAVATEIEIDAARQQYIPVSKHSAILFFCISELANVDPMYQYSLSWFLNLFVNTILKAPK------SDQLSERLKNLNDYFTKSIYTNVCRSLFEKDKLVISLVMCLGIL-----VSQGRVEKAALLFFLT---------------GGIGYKTIPPNPLGAWLPDKSWASVCKAADLE------GLKNLPQMMETYSDEWH---NFYDASNPDQLQLPAPHNTVNDMYFLIVIKSLRPDKLVPAVRAFITRNLDRSFVEPPPFDLAASFADSSPKIPLVFLLSAGSDPMASLFMFAKQ-RNMYDKLKTISLGQGQGPRAEKMIMEAARH-GQWVVLQNCHVAISWMGDLERICNDTTLTDGANH-DYRLWCTSYPSAVFPVSVLQNSVKMTNEPPKGLRANMHRSFTSDPL--MRDKFFTNAFLFSDSANKCWLRGVFALVFFHAVVQERREFGPLGWNIPYEFNESDLKISLLQLKMFINQSQSIPFRGHVYLTGECNYGGRVTDDKDRRLILSLLNMIYNPNTIEEDNYALSQSGTYRVPLSPT----RLNSIEYVSSFPLSPHPEV------YGLHENADINRNVKETNALISGVLLTQTDLMASVKASSSGGAKEDPAIAICKQVLKQLP---EEFNIDEVSKTY--------PVI----------------YTNS----------MNTVLRQELIRFNRLLSYIRKSLVNVGKAVVGQIAMIPELER------------THASMVIGKLPADW------------------LKKSYPSLKPLGSYVSDLLAR----------LAFFQEWIDNGEP-----------MVYWISGFYFTQSFITGVLQNYSRKNRFQIDMILIEFAV 4260          

HSP 2 Score: 226.098 bits (575), Expect = 0.000e+0
Identity = 184/790 (23.29%), Postives = 357/790 (45.19%), Query Frame = 1
Query: 6892 SFSSGINANNQNRVNEIIVSLDSIRY-SFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFF----DNTSLQWTYVT-DCSLIVACSPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHD-----ELGK-------CDIMFGKFFPLKGSSSSTKVYQQ---ITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLK--PEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVA------------HFRXXXXXXXXXXXXXTSKEDTMH--------------NLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            S S+  N     +++E+IV      Y S+     +  ++ +L+ G +G GKS +I                                 NLL+    + KF+N  ++                      I F+++TS       + SK+ +R + + GP   KK  +F DD+ +P+ D +GSQ+ LE++R W++ +G++    D T ++   +T  C++      N   P   RL +H  V+ +     +   RIF   IG +   K +  ++      + +  +SVY   I  +  +P KSHY F+LR + ++  G++    K + + E +G+  AHE  R  +DRL+   DR+    +  D    +L+           E G+        ++ +G +       +  K Y +      +EKL++++    N+F    +   + + F+ +I+H+ R  R+L    G++LM+G+ G G+ S+ ++++ I  C +  + ++  Y    +R D+KK++  +       V   SD     ++ +++D+  ++N+G +P+LY+ ++   I+ N+    + LG    + P++VY   I++I++ LH+ +  SP    ++ R+R  PSLINCCTIDWYM W  E+L  V             H    +     K   +  +E+                 +L +  ++ +++ ++   +  +EL R  +++   ++E L  F         +    R R + GL +L      + +M+ +L +L PK+K  SEET+
Sbjct: 2247 SASTTSNFPENAQISELIVPTKETGYISYWQEFCISKSYAMLVVGPTGTGKSAIIT-------------------------------SNLLA----MPKFANLVNV----------------------INFSARTSAQMVQDTIMSKLDRRRKGVFGPSLGKKCTVFCDDVAMPSKDTYGSQAPLELLRTWLD-HGYWSDLVDTTKIELVDMTLMCAMGTLGGSNFIFP---RLYRHMFVVAVDSFEDSTIVRIF-TTIGDWHFSKGYPEKVALLSRGLSEAMVSVYRDAIRSFLPTPAKSHYSFSLRDITRVFQGIVMVPPKRMPDPEKLGRLWAHETYRVFYDRLVDQQDRDRLLVMAVDACKSNLRFPLEQAFGERIEPGEKLTDNDLRNLFYGNYM---EPDAEPKFYDEGDTYEKLEKLMKYYLREYNSFSSTPM---DLVMFRFAIEHVSRVSRVLQMPRGNILMVGMGGSGRRSSARLAAYIADCRLMTVQVSKSYTITDWRDDLKKILMSASFNLNHTVFLFSDA-QATDEGYVEDINGILNTGDLPNLYQLEDKATIMENMANVAKQLGKILDTLPSEVYAYYIDRIREQLHIALAFSPIGDSFKERIRVYPSLINCCTIDWYMPWPEEALSRVGVYFVSSMNLNRPHGEETQEPVQSKDAADPDEEEVRRETVGVEREQTQLEADLVDCVMYFHQSVVDASEKCYLELNRRNYVTPSAYLELLKAFRTFYTRKLDEITRLRDRYTTGLEKLDFAAGQVGEMQTNLYDLQPKLKVLSEETD 2967          

HSP 3 Score: 71.633 bits (174), Expect = 0.000e+0
Identity = 38/117 (32.48%), Postives = 62/117 (52.99%), Query Frame = 2
Query: 13394 NPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVIS-------EKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCEID 13723
             PD G  + G++++ A WN +   +  +     +  LP+I+L  V+             E    + CP+Y+T  R G+LS++G S+NF+ +L L+  R P  WI RGTA L  C++D
Sbjct: 4270 TPDIGAYIRGIFIEGARWNRKTKEVDESFSKVLFDTLPVIYLRPVLKALEDLPRSTAGGEPETIYDCPVYKTSERRGVLSTTGHSTNFVMYLQLRCSRKPMHWINRGTACL--CQLD 4384          

HSP 4 Score: 533.872 bits (1374), Expect = 6.324e-155
Identity = 331/927 (35.71%), Postives = 501/927 (54.05%), Query Frame = 2
Query: 2720 SKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILP----AVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIR---VRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDP---ESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLW--NEFSSQ--CQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKAL 5458
            +KA +      Q D+      + + E +E +E+       LW+T  E+E+ Y  ++ ++ +    + VR+ V   +  +  L + L  N +       ++  + + +  LPV+ ++    L+ RHW +I K++G  +      T+ ++I   I+     + EI+  A  E  L + L  ++  +  + F ++ + + DT I+  +DDI   L++  M    +K S ++  + ++ +DWE +L     ++D W   Q  W+YLE IF + DI RQ+P EGR F  VD  WR +M+ T +   V+       +L++       LE + K L  YLE KR+ F R FFLSNDELLEILS  +DP  VQ HL K F  +  L  D +      ++     E E   L R I      GL E WL  +E  + + VK Q++    +    + + W ++  GQ +   + + ++  V  A++    P   E + L      I+DL+Q        V  D+ +  R A+EA+IV+ VH+RD  + L +  + +  DF+W  Q+RY W  NE +    C V+ V +  EYG EYLG  PRLV+TPLTDRCY T+ GAL   LGG  +GPAGTGKTET KDL+K + ++CVVFNCSD LD   + K   G+ Q G+W CFDEFNR+ LEVLSV+A QI +I+ A   +  +F FE+  +KL+P C IFITMNP YAGR ELPDNL  LFR VAMMVPDY +I E+ L+S GF  A+ LS KI   Y+LC++QLS Q HYD+G+R++KSVL+    LR   V + E           I+++AI   N P+ +  D+ LF  I  DLF   +  +     + + + ++  +   +  P  +EKI  +   L  RHG+M++G S  GKT    +L + L
Sbjct: 1063 AKAINTEETLLQIDVSAFPLLAEIIEKMEPIEK-------LWKTSYEFEKDYLIWMFERFECLNADGVREQVENMHKIMYKLSRQLAYNPVAKRAAEQMRMKIEKFRVYLPVLDSICRHGLEKRHWDQISKILGRKVNPKLFPTLKDMIDVDIMSILPQLEEIANAAGKEYDLNNGLRIMQADWRDVMFEVLQYRDSDTHILASLDDIQTLLDDHIMRTQAMKRSPFITALGSKADDWEARLLLIQNIIDAWTQVQITWMYLEPIFSSEDIMRQMPLEGRNFKAVDKLWRKIMKHTLKDRHVMAATEYPEMLEVFTKAIEDLETVTKGLNTYLEQKRLFFARFFFLSNDELLEILSETKDPMRVQPHLRKCFEGIGSLTFDDNMEIVEMVSD----EEERVALVRKINPQLANGLVEMWLKEVEMVMLDSVKEQMREAWEDYAMVERISWVVSWPGQVVQGISCMAWTYEVEEAIETKELPAYLEKSNLQ-----IADLVQ-------LVRTDLQAGVRIAVEALIVLDVHDRDVVKYLTDCRITNIQDFDWISQLRYYWKVNEKNEDWVC-VSMVVTDVEYGMEYLGNLPRLVVTPLTDRCYRTLMGALKLCLGGAPEGPAGTGKTETCKDLAKAVAKKCVVFNCSDGLDYKALGKFFKGLAQSGAWACFDEFNRIELEVLSVVAQQILTIQRAIGRKVVKFFFEDTMLKLDPTCSIFITMNPGYAGRTELPDNLKVLFRTVAMMVPDYAMIGEITLYSNGFDMARNLSQKIVQAYKLCSEQLSSQSHYDYGMRAVKSVLLASASLRRLYVDLPEP---------EIVLRAIVDVNLPKFLEQDISLFIGIYMDLFPGVELPMPQRGDILKWLHINLADRNLQATPWYLEKILQIYEMLLVRHGLMIVGGSMGGKTTAYQVLAQTL 1956          

HSP 5 Score: 37.7354 bits (86), Expect = 6.324e-155
Identity = 12/32 (37.50%), Postives = 23/32 (71.88%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGII 5655
            +  +++NPKA+++  LYG  +P S EW +G++
Sbjct: 1972 VTFRIINPKAITMGQLYGRFDPVSHEWYDGVL 2003          

HSP 6 Score: 91.2781 bits (225), Expect = 3.117e-17
Identity = 42/118 (35.59%), Postives = 71/118 (60.17%), Query Frame = 1
Query: 5965 WIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPK-SFPESGKEFLYKLFEKSIKPGMKFLSKCSKI 6315
            W++ DGP+++ W+ENLNTVLDD++ LCL +GE + +   +  +FE  DL+ +SPATVSRC MIY+    + W+   KS++   + K    +        + E  +   ++FL +C ++
Sbjct: 2020 WVMFDGPVDAVWIENLNTVLDDNKKLCLMSGEIMQMTKLMNMMFEPADLEQASPATVSRCGMIYMEPSQLGWRALHKSFINVLVNKVGLGDIYMTLFEDMTEWLVPAALEFLPQCKQM 2137          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309029)

HSP 1 Score: 472.241 bits (1214), Expect = 0.000e+0
Identity = 348/1288 (27.02%), Postives = 601/1288 (46.66%), Query Frame = 3
Query: 9234 CEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLL--------------SVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTF-KDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKY---LNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSE-QIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNE----VQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFI-HSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKH-----HEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRF-FDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSIL 13007
             EE L +  P LE +  AL+++  A I+ VR    PP L+  +M+ V +L                  PSW  +  ++  A FL +L NY KD IN +M   LQ Y   +D+N +    V      +  W  A+  +HSVN  ++P +  +   +  L+++   L   + QL++ E+ ++ + ++Y  +V E+++L +   +   ++  A ALI  +  EK RW +  K+       ++G  + +  + ++ GP+   +R    K W+ IL  K+IP       +     + T+  W   GLP D    +N  I  KS  +PLL+DPQ QGK +++    ++  ++ S   K +   LE ++ +G  + +ED+   +DPV+  +L K F + G+I  + +G+ E +  P F LY+ + L NP     V+   +II+FTV + GLE+QLL  ++  EK ++E ER     T   +  +++ LE   L  L  S   +V+D  L + L  +K TA ++ ++L+ +   E+++  AR+ +  +A RG+ +YF++ ++  VN MYQ SL  F  +F   + +  K      S   E ++  I+  +TY+ Y   +  L+  H+ LF  ML+  I     +  +  I  +++ TFIK        G +L     T +  +   +I WL L        +EI   + FS +    +L  + W  W   E P +      +E    Y   L+ F KL+LI   C  + I  A+ Y++  LG ++S +   +L  ++ ES  + P V +L   SDP   +  L    +  +  L  VSMG+GQ   A  +I ++ +  G W+ LQN  L    +P   ++I+ L  S+  +D+ F++ ++T PH++FPIG+LQ +LK   E P GI+  L +S+      + T+   +  S  Q   +++ +   + +V ERR +G LG+++PY+FN +D   S++ I   L   +    V W  L  +IG + YGGR+TD+ D+R L      +  E    N  E F K  KV        +S+  FI + N         + GL  NA+I    N +K  +  I+  Q K       E +++     A DML+    K+P                                      ++N Y  +E + R     P +  L QEI +   ++ R+H  +  L   + G   ++ +L+  LD +    +P +W  +S       W S        +GFW   +L
Sbjct: 3355 AEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTK------SSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKI-----DYHNGNISHEEFLTFIK-------GGASLDLNAVTPKPFRWILDITWLNL--------VEISKLETFSTVLQVIELNEKDWRCWYECEKPEN------EEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALA---KQKSIVLKSVSMGQGQEYHARKMIIES-MAIGGWVLLQNVHLS---LPFCSEIIDMLVESEHIDDS-FRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQ-----SFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFE-FYKGYKV-----PGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLR----KLP-------------------------------------AQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKIS-------WESTT------LGFWYTELL 4537          

HSP 2 Score: 291.582 bits (745), Expect = 0.000e+0
Identity = 259/1071 (24.18%), Postives = 475/1071 (44.35%), Query Frame = 1
Query: 5965 WIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQ--IIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILV-PSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFD-NTSLQWTYVTDCSLIVACS--PNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQV-KIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFF-----PLKGSSSST-----KVYQQITDVEKLIRFFESSINTFDHEHLNTN-NFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKP--EDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVA-HFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            W+VLDGP++S W+ENLN+VLDD++ L LANG+R+ +  ++K +FE  ++ N+SPATVSR  M+Y+    +  +  V++W+KN+ P       K     LF+++      +  +  K+Q  ++     Q  LF    ILE LI                    K +  + V+ S+    D    P       + S  +K        L +LY+FA  W  G   +            T+  ++    + E+  + D    S  +N             TI+ +FV    G++Q W  LV P +   +     LS               ++  +D++R  +L   +      V++ G+ G GK++++ + +K++         N +S +G+                                                S  F+S TS  +  + + S + KR     GPP  +K+++FIDD+N+P I+E+G Q T E+VRQ +++ GF+       +T + D   + A       ++ I  RL + FCV     P +++  +IF+V   G Y  ++ F  EI++ +  ++ +   ++ +T  +   +P K HY+F+LR L +I  G++     ++ ++  +     HE  R   DR  +  D+E F   L+    +  +L  +H ++   + +F  F      P       T     KVY+ +   E L       +  F+     +  + +FF  ++ H+++  RI+    G ++++GV G GK S  K++S I G   F++ +T  YN  +F  D+K +     +Q +      +DM D+  + F++ L N+++SG I +L+  DE   I+  L P  +       + P  V    + +    LHV    SP    +RSR++  P+L++ CTIDW   W  ++L+SVA HF    + +         KE+ ++ L      +  T+ E   +F    RR   ++   ++ F+  + +I Q    +      ++  GL +L E  + +  +K+DL+ +  ++ E S+  E
Sbjct: 2386 WLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGE-----KSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLF----ILEGLI------------------PVKKEDEQAVSMSSKESHDEDLPP-------ETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLS------------TSDRQRMNLFVKESFPQLDYPKGSAHEN-------------TIFDFFVS-PAGVWQSWKTLVTPYMYPELSTPDYLSI--------------LVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKM---------NVESYMGR------------------------------------------------SFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELA--CLVREELGDSHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDM-DIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHF----LSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRF----RRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAE 3314          

HSP 3 Score: 515.768 bits (1327), Expect = 1.621e-146
Identity = 338/1101 (30.70%), Postives = 544/1101 (49.41%), Query Frame = 2
Query: 2180 VNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLT-KNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITG--VDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVL-QILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQF--VDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKE-IKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALT 5461
            + + + K+     D    ++   ++ LD   + +++    +E + KI  + + M+     I + F ++T ++V V  EQ  L   L    Q L    +  + K  +    F  DL   ++  +   +    + R +  +    T     D+L   +N    +  +++ Y + +E FG   +      + R++ +L        L  DV  ++R  S   + W                  +E ++  +   +    +    L K L +     A+K  +++     P++  + N  ++ RHW +I  +        ++ F++  ++ + +L++K+ I +I   A  E  +E  L +V + ++V E + +S +NR   ++ G    +    LE+S M + ++  ++Y    R Q++ W   LS++ ++L+ W+  Q  W+YLE +F   DI +QLP E + F ++D  W+ +MQ+  E P V+ CC    +L Q+L     +LE  QKSL  YLE KR++FPR FF+S+  LLEIL +A D   +Q HL  +F N   ++                 EGE   L R IR  G  E WL  L       +   I+     +    F  + +      Q  L+  Q+ ++++   AL    + +      +    +  ++ L  L    + ++   +R   E +I I VH RD    L   ++KS  DFEW KQ R+ + E   +  ++  D  F Y NEYLGC+ RLVITPLTDRCY+T+  AL  ++GG   GPAGTGKTET+KD+ K + +  VVFNCSD++D   + ++  G+ Q GSW CFDEFNR+ L VLSV A Q+  +  AK  + + F+F + + I++NP  GIFITMNP YAGR ELP+NL   FR VAMMVPD  +I  V L S GF+    L+ K   LY+LC +QL+ Q HYDFGLR+I SVL         R L +   + + + E  I+++ ++  N  +LI DD PLF S++ DLF +      N   LE +I     E      P  + K+  L      RHG+M LGPS +GKT     L KA+T
Sbjct: 1270 IGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLL--QKLYKLYNDV--IDRVSSYYDIPW------------------NEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISS--EGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGRERK-----VMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVL---------RTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMT 2332          

HSP 4 Score: 27.7202 bits (60), Expect = 1.621e-146
Identity = 17/69 (24.64%), Postives = 35/69 (50.72%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQN--VLNDQLSTDNFEKENSNQNDLQTL 5775
            +NPKA++   ++G ++  + +W +GI   + +K +          VL+  + +   E  NS  +D +TL
Sbjct: 2343 MNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTL 2411          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309027)

HSP 1 Score: 471.47 bits (1212), Expect = 0.000e+0
Identity = 348/1288 (27.02%), Postives = 601/1288 (46.66%), Query Frame = 3
Query: 9234 CEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLL--------------SVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTF-KDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKY---LNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSE-QIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNE----VQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFI-HSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKH-----HEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRF-FDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSIL 13007
             EE L +  P LE +  AL+++  A I+ VR    PP L+  +M+ V +L                  PSW  +  ++  A FL +L NY KD IN +M   LQ Y   +D+N +    V      +  W  A+  +HSVN  ++P +  +   +  L+++   L   + QL++ E+ ++ + ++Y  +V E+++L +   +   ++  A ALI  +  EK RW +  K+       ++G  + +  + ++ GP+   +R    K W+ IL  K+IP       +     + T+  W   GLP D    +N  I  KS  +PLL+DPQ QGK +++    ++  ++ S   K +   LE ++ +G  + +ED+   +DPV+  +L K F + G+I  + +G+ E +  P F LY+ + L NP     V+   +II+FTV + GLE+QLL  ++  EK ++E ER     T   +  +++ LE   L  L  S   +V+D  L + L  +K TA ++ ++L+ +   E+++  AR+ +  +A RG+ +YF++ ++  VN MYQ SL  F  +F   + +  K      S   E ++  I+  +TY+ Y   +  L+  H+ LF  ML+  I     +  +  I  +++ TFIK        G +L     T +  +   +I WL L        +EI   + FS +    +L  + W  W   E P +      +E    Y   L+ F KL+LI   C  + I  A+ Y++  LG ++S +   +L  ++ ES  + P V +L   SDP   +  L    +  +  L  VSMG+GQ   A  +I ++ +  G W+ LQN  L    +P   ++I+ L  S+  +D+ F++ ++T PH++FPIG+LQ +LK   E P GI+  L +S+      + T+   +  S  Q   +++ +   + +V ERR +G LG+++PY+FN +D   S++ I   L   +    V W  L  +IG + YGGR+TD+ D+R L      +  E    N  E F K  KV        +S+  FI + N         + GL  NA+I    N +K  +  I+  Q K       E +++     A DML+    K+P                                      ++N Y  +E + R     P +  L QEI +   ++ R+H  +  L   + G   ++ +L+  LD +    +P +W  +S       W S        +GFW   +L
Sbjct: 3371 AEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTK------SSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKI-----DYHNGNISHEEFLTFIK-------GGASLDLNAVTPKPFRWILDITWLNL--------VEISKLETFSTVLQVIELNEKDWRCWYECEKPEN------EEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALA---KQKSIVLKSVSMGQGQEYHARKMIIES-MAIGGWVLLQNVHLS---LPFCSEIIDMLVESEHIDDS-FRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQ-----SFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFE-FYKGYKV-----PGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLR----KLP-------------------------------------AQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKIS-------WESTT------LGFWYTELL 4553          

HSP 2 Score: 292.738 bits (748), Expect = 0.000e+0
Identity = 257/1074 (23.93%), Postives = 481/1074 (44.79%), Query Frame = 1
Query: 5965 WIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQ--IIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQ---FPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILV-PSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFD-NTSLQWTYVTDCSLIVACS--PNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQV-KIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFF-----PLKGSSSST-----KVYQQITDVEKLIRFFESSINTFDHEHLNTN-NFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKP--EDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVA-HFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            W+VLDGP++S W+ENLN+VLDD++ L LANG+R+ +  ++K +FE  ++ N+SPATVSR  M+Y+    +  +  V++W+KN+ P       K     LF+++      +  +  K+Q  ++     Q  LF    ILE LI         D  ++ +      D+++++       +  +Q      ++    + S  +K        L +LY+FA  W  G   +            T+  ++    + E+  + D    S  +N             TI+ +FV    G++Q W  LV P +   +     LS               ++  +D++R  +L   +      V++ G+ G GK++++ + +K++         N +S +G+ F                                                 F+S TS  +  + + S + KR     GPP  +K+++FIDD+N+P I+E+G Q T E+VRQ +++ GF+       +T + D   + A       ++ I  RL + FCV     P +++  +IF+V   G Y  ++ F  EI++ +  ++ +   ++ +T  +   +P K HY+F+LR L +I  G++     ++ ++  +     HE  R   DR  +  D+E F   L+    +  +L  +H ++   + +F  F      P       T     KVY+ +   E L       +  F+     +  + +FF  ++ H+++  RI+    G ++++GV G GK S  K++S I G   F++ +T  YN  +F  D+K +     +Q +      +DM D+  + F++ L N+++SG I +L+  DE   I+  L P  +       + P  V    + +    LHV    SP    +RSR++  P+L++ CTIDW   W  ++L+SVA HF    + +         KE+ ++ L      +  T+ E   +F    RR   ++   ++ F+  + +I Q    +      ++  GL +L E  + +  +K+DL+ +  ++ E S+  E
Sbjct: 2378 WLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGE-----KSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLF----ILEGLIPVKKE----DEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLS------------TSDRQRMNLFVKESFPQLDYPKGSAHEN-------------TIFDFFVS-PAGVWQSWKTLVTPYMYPELSTPDYLSI--------------LVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKM---------NVESYMGRSF------------------------------------------------NFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELA--CLVREELGDSHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDM-DIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHF----LSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRF----RRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAE 3330          

HSP 3 Score: 515.383 bits (1326), Expect = 2.417e-146
Identity = 338/1101 (30.70%), Postives = 544/1101 (49.41%), Query Frame = 2
Query: 2180 VNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLT-KNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITG--VDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVL-QILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQF--VDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKE-IKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALT 5461
            + + + K+     D    ++   ++ LD   + +++    +E + KI  + + M+     I + F ++T ++V V  EQ  L   L    Q L    +  + K  +    F  DL   ++  +   +    + R +  +    T     D+L   +N    +  +++ Y + +E FG   +      + R++ +L        L  DV  ++R  S   + W                  +E ++  +   +    +    L K L +     A+K  +++     P++  + N  ++ RHW +I  +        ++ F++  ++ + +L++K+ I +I   A  E  +E  L +V + ++V E + +S +NR   ++ G    +    LE+S M + ++  ++Y    R Q++ W   LS++ ++L+ W+  Q  W+YLE +F   DI +QLP E + F ++D  W+ +MQ+  E P V+ CC    +L Q+L     +LE  QKSL  YLE KR++FPR FF+S+  LLEIL +A D   +Q HL  +F N   ++                 EGE   L R IR  G  E WL  L       +   I+     +    F  + +      Q  L+  Q+ ++++   AL    + +      +    +  ++ L  L    + ++   +R   E +I I VH RD    L   ++KS  DFEW KQ R+ + E   +  ++  D  F Y NEYLGC+ RLVITPLTDRCY+T+  AL  ++GG   GPAGTGKTET+KD+ K + +  VVFNCSD++D   + ++  G+ Q GSW CFDEFNR+ L VLSV A Q+  +  AK  + + F+F + + I++NP  GIFITMNP YAGR ELP+NL   FR VAMMVPD  +I  V L S GF+    L+ K   LY+LC +QL+ Q HYDFGLR+I SVL         R L +   + + + E  I+++ ++  N  +LI DD PLF S++ DLF +      N   LE +I     E      P  + K+  L      RHG+M LGPS +GKT     L KA+T
Sbjct: 1262 IGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLL--QKLYKLYNDV--IDRVSSYYDIPW------------------NEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISS--EGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGRERK-----VMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVL---------RTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMT 2324          

HSP 4 Score: 27.7202 bits (60), Expect = 2.417e-146
Identity = 17/69 (24.64%), Postives = 35/69 (50.72%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQN--VLNDQLSTDNFEKENSNQNDLQTL 5775
            +NPKA++   ++G ++  + +W +GI   + +K +          VL+  + +   E  NS  +D +TL
Sbjct: 2335 MNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTL 2403          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0344344)

HSP 1 Score: 471.855 bits (1213), Expect = 0.000e+0
Identity = 347/1288 (26.94%), Postives = 601/1288 (46.66%), Query Frame = 3
Query: 9234 CEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLL--------------SVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTF-KDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKY---LNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYN-NQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNE----VQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFI-HSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKH-----HEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRF-FDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSIL 13007
             EE L +  P LE +  AL+++  A I+ VR    PP L+  +M+ V +L                  PSW  +  ++  A FL +L NY KD IN +M   LQ Y   +D+N +    V      +  W  A+  +HSVN  ++P +  +   +  L+++   L   + QL++ E+ ++ + ++Y  +V E+++L +   +   ++  A ALI  +  EK RW +  K+       ++G  + +  + ++ GP+   +R    K W+ IL  K+IP       +     + T+  W   GLP D    +N  I  KS  +PLL+DPQ QGK +++    ++  ++ S   K +   LE ++ +G  + +ED+   +DPV+  +L K F + G+I  + +G+ E +  P F LY+ + L NP     V+   +II+FTV + GLE+QLL  ++  EK ++E ER     T   +  +++ LE   L  L  S   +V+D  L + L  +K TA ++ ++L+ +   E+++  AR+ +  +A RG+ +YF++ ++  VN MYQ SL  F  +F   + +  K      S   E ++  I+  +TY+ Y   +  L+  H+ LF  ML+  I     +  +  I  +++ TFIK        G +L     T +  +   +I WL L        +EI   + FS +    +L  + W  W   E P +      +E    Y   L+ F KL+LI   C  + I  A+ Y++  LG ++S +   +L  ++ ES  + P V +L   SDP   +  L    +  +  L  VSMG+GQ   A  +I ++ +  G W+ LQN  L    +P   ++I+ L  S+  +D+ F++ ++T PH++FPIG+LQ +LK   E P GI+  L +S+      + T+   +   + Q   +++ +   + +V ERR +G LG+++PY+FN +D   S++ I   L   +    V W  L  +IG + YGGR+TD+ D+R L      +  E    N  E F K  KV        +S+  FI + N         + GL  NA+I    N +K  +  I+  Q K       E +++     A DML+    K+P                                      ++N Y  +E + R     P +  L QEI +   ++ R+H  +  L   + G   ++ +L+  LD +    +P +W  +S       W S        +GFW   +L
Sbjct: 3379 AEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTK------SSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKI-----DYHNGNISHEEFLTFIK-------GGASLDLNAVTPKPFRWILDITWLNL--------VEISKLETFSTVLQVIELNEKDWRCWYECEKPEN------EEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALA---KQKSIVLKSVSMGQGQEYHARKMIIES-MAIGGWVLLQNVHLS---LPFCSEIIDMLVESEHIDDS-FRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQ-----SFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFE-FYKGYKV-----PGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLR----KLP-------------------------------------AQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKIS-------WESTT------LGFWYTELL 4561          

HSP 2 Score: 293.123 bits (749), Expect = 0.000e+0
Identity = 257/1074 (23.93%), Postives = 481/1074 (44.79%), Query Frame = 1
Query: 5965 WIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQ--IIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQ---FPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILV-PSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFD-NTSLQWTYVTDCSLIVACS--PNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQV-KIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFF-----PLKGSSSST-----KVYQQITDVEKLIRFFESSINTFDHEHLNTN-NFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKP--EDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVA-HFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            W+VLDGP++S W+ENLN+VLDD++ L LANG+R+ +  ++K +FE  ++ N+SPATVSR  M+Y+    +  +  V++W+KN+ P       K     LF+++      +  +  K+Q  ++     Q  LF    ILE LI         D  ++ +      D+++++       +  +Q      ++    + S  +K        L +LY+FA  W  G   +            T+  ++    + E+  + D    S  +N             TI+ +FV    G++Q W  LV P +   +     LS               ++  +D++R  +L   +      V++ G+ G GK++++ + +K++         N +S +G+                                                S  F+S TS  +  + + S + KR     GPP  +K+++FIDD+N+P I+E+G Q T E+VRQ +++ GF+       +T + D   + A       ++ I  RL + FCV     P +++  +IF+V   G Y  ++ F  EI++ +  ++ +   ++ +T  +   +P K HY+F+LR L +I  G++     ++ ++  +     HE  R   DR  +  D+E F   L+    +  +L  +H ++   + +F  F      P       T     KVY+ +   E L       +  F+     +  + +FF  ++ H+++  RI+    G ++++GV G GK S  K++S I G   F++ +T  YN  +F  D+K +     +Q +      +DM D+  + F++ L N+++SG I +L+  DE   I+  L P  +       + P  V    + +    LHV    SP    +RSR++  P+L++ CTIDW   W  ++L+SVA HF    + +         KE+ ++ L      +  T+ E   +F    RR   ++   ++ F+  + +I Q    +      ++  GL +L E  + +  +K+DL+ +  ++ E S+  E
Sbjct: 2386 WLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGE-----KSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLF----ILEGLIPVKKE----DEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLS------------TSDRQRMNLFVKESFPQLDYPKGSAHEN-------------TIFDFFVS-PAGVWQSWKTLVTPYMYPELSTPDYLSI--------------LVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKM---------NVESYMGR------------------------------------------------SFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELA--CLVREELGDSHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDM-DIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHF----LSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRF----RRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAE 3338          

HSP 3 Score: 515.383 bits (1326), Expect = 2.169e-146
Identity = 338/1101 (30.70%), Postives = 544/1101 (49.41%), Query Frame = 2
Query: 2180 VNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLT-KNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITG--VDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVL-QILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQF--VDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKE-IKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALT 5461
            + + + K+     D    ++   ++ LD   + +++    +E + KI  + + M+     I + F ++T ++V V  EQ  L   L    Q L    +  + K  +    F  DL   ++  +   +    + R +  +    T     D+L   +N    +  +++ Y + +E FG   +      + R++ +L        L  DV  ++R  S   + W                  +E ++  +   +    +    L K L +     A+K  +++     P++  + N  ++ RHW +I  +        ++ F++  ++ + +L++K+ I +I   A  E  +E  L +V + ++V E + +S +NR   ++ G    +    LE+S M + ++  ++Y    R Q++ W   LS++ ++L+ W+  Q  W+YLE +F   DI +QLP E + F ++D  W+ +MQ+  E P V+ CC    +L Q+L     +LE  QKSL  YLE KR++FPR FF+S+  LLEIL +A D   +Q HL  +F N   ++                 EGE   L R IR  G  E WL  L       +   I+     +    F  + +      Q  L+  Q+ ++++   AL    + +      +    +  ++ L  L    + ++   +R   E +I I VH RD    L   ++KS  DFEW KQ R+ + E   +  ++  D  F Y NEYLGC+ RLVITPLTDRCY+T+  AL  ++GG   GPAGTGKTET+KD+ K + +  VVFNCSD++D   + ++  G+ Q GSW CFDEFNR+ L VLSV A Q+  +  AK  + + F+F + + I++NP  GIFITMNP YAGR ELP+NL   FR VAMMVPD  +I  V L S GF+    L+ K   LY+LC +QL+ Q HYDFGLR+I SVL         R L +   + + + E  I+++ ++  N  +LI DD PLF S++ DLF +      N   LE +I     E      P  + K+  L      RHG+M LGPS +GKT     L KA+T
Sbjct: 1270 IGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLL--QKLYKLYNDV--IDRVSSYYDIPW------------------NEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISS--EGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGRERK-----VMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVL---------RTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMT 2332          

HSP 4 Score: 27.7202 bits (60), Expect = 2.169e-146
Identity = 17/69 (24.64%), Postives = 35/69 (50.72%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQN--VLNDQLSTDNFEKENSNQNDLQTL 5775
            +NPKA++   ++G ++  + +W +GI   + +K +          VL+  + +   E  NS  +D +TL
Sbjct: 2343 MNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTL 2411          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Zebrafish
Match: dnah6 (dynein, axonemal, heavy chain 6 [Source:ZFIN;Acc:ZDB-GENE-030616-623])

HSP 1 Score: 780.4 bits (2014), Expect = 0.000e+0
Identity = 462/1302 (35.48%), Postives = 717/1302 (55.07%), Query Frame = 2
Query: 1634 ISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMS--TNSLIDLVHYLPILNFCCFYVD------EALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKR-IGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXX-------------XXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            +S  P  E+   C+ ++I + E T+ S++T       + F +           +IN+ + E+      PS++ +L+ D  Y +N+   +K S  T  +   V+      F  FY +      EALKE E     E  +  +   K+  ++ E +      I+ KR +G + + T  L     P   + I  +N+ L + A    D+ I   + A   LD  P    E+V+ L F+++I   +  ++KE  ++++M+ +I  + VP   E +A+Y TL   I  ++N +     ++D  + KF   L++ I ++   + E+K +A N   LD +  +S I   LG ++  + +L ++   Y  YQ+ F   ++K                       + +EE+  ++ ++ LLW++  EWE     ++  K DE +   + + V+R    V  LEK LP N ++P +KA V   +  LPVI  LRNP L+ RHW  +E ++   L +    T+  L +  I ++   I E+S  A+ E +LE++L K++D +   EF ++ H + +D +I+ G DDI V L++S + ++T+  S+Y   I+ +V+ W+R+L    + LDEW+ CQ+ WLYLE IF   DIQRQLP E ++F +VD  W+ +M++    P  L+  T+ G+L + Q  N+ LE+IQK LE YLE KR+IFPR +FLSNDELLEIL++ ++P+ VQ HL K F  + +L+  + +  +                  +VS EGE   L + ++ RG  E WL  +E+ +F  ++R  K  + + + K  V+W +     Q +L  +Q+ + +++   L+G    E      +        + L  LA  V  ++ S  R  + A+I I VH RD    L++  V S  +FEW++Q+RY W+     C      S + YG EYLG  PRLVITPLTDRCY+ + GAL  +LGG   GPAGTGKTET KDL+K +  QCVVFNCSD LD   +    SG+ Q G+WCCFDEFNR+N+EVLSVIA Q+ +I+ AK ++  RF+FE +EIKL   C  FITMNP YAGR ELPDNL  LFRP+AMMVP+Y LI EVIL+SEGF ++K L+ K+T +Y+LC++QLS Q HYDFG+R++KSVL++ G L+ E   +SE V         +LI+A++ SN P+ + DD  LF  I+ DLF        +  +L+ +I  S  +   +  P  I K+  L   +  RHGVML+GP+ SGKT +  +L   L  L
Sbjct:  533 LSYQPSNEDFQECVAEIIGQFEKTVLSLDTLVQDTYFDAFTQ----------PIINQKVEEK-ICGDGPSVEEILEEDA-YLQNIILNIKQSIQTAFVTANVYARTFEPFRLFYKENEDLDLEALKEQEH----EVAFFENSLDKYHQEHKEAL-----AIQQKRPLGILLVDTTKLKHRLIPSPLRCIEAINDILPRLAKKKMDDIIAEAQDAQFKLDFVPTVTTEYVDSLNFLDEIQKRIEVLEKETVTVSEMYKLIECYSVPTPPEDIAVYATLPPCITAVRNTIDKAVGERDSYVDKFCQHLQQDIGQLNNTVQEVKAEAENHQLLDIDADRSHIRRLLGDIQISIDELQSQAFKYKTYQKNFKVEVTK----------------------YDTLEELTAEVKLKQLLWDSLEEWESLENGWLQDKFDELDPELLSKQVNRFVKYVSQLEKGLPPNNVVPFLKAKVESMREKLPVITDLRNPCLKARHWEMLEAIVDSKLLEEAQ-TLATLQNIDIFRFGLQIQEVSGQASGEASLENILRKIEDSWKTTEFIVLPHRDTKDVFILGGTDDIQVLLDDSIVNVATVASSRYAGPIKARVDKWQRQLLLFNQTLDEWLLCQRSWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRMPNALRAATQTGILDVFQNNNALLERIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAISQLEFATLTPTTPEGDDTVEKIQYTNDILSMVSPEGEKVVLGKGLKARGNVEDWLGKVEEAMFSSLRRLSKAAIADYQSKPRVEWVVAGHPSQVVLTISQLMWCRDMDNCLEG----EHDHFQALQEFEITNFERLNALAALVRGNLPSLHRNIITALITIDVHARDIVTDLVKEQVDSSDNFEWQRQLRYYWDVDLDDCVARMALSQYIYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGTFFSGLAQSGAWCCFDEFNRINIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSKTLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPNLSEDV---------VLIRALRDSNLPKFLKDDAALFSGILSDLFPGVTIPEHDYGVLQSTIHSSLCQRSLQPLPSIISKVIQLYETMLVRHGVMLVGPTGSGKTTVYRVLADTLDTL 1777          

HSP 2 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 421/1388 (30.33%), Postives = 701/1388 (50.50%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCN-------SFKL-------TPETWIKWNLSENPFDMSSYNFKEFSVK-----YLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQ--SEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSAL--DMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLP 13292
            ET+A+ +     + DL    P L+++ KAL++L+KA ISE+RV+  PP LV  VM AVC+LLS    WA+AK LLGD NFL+KL++Y+KD I  ++ + L +Y    DF PE V  VS AC+S+C WV A++ Y  V   + PKR+ +  A+  L+ +   L+ KQN+L++VE+ IK L +++++S+ E++ L + + LT  RL R+  L  A+  E+ RW  SI   ++   N+IG+   +AA   + G +T  YR++    WI    +  IPI DN+  +      Y I  W+  GLPRD+   EN  ++ + ++WPL+IDPQ Q  R++++   K+  +VI      ++  LE AIR+G  + LE+++  +DP L P+L K+ F  G  T+I+LG+++++Y  +F+ Y+ + ++NP  +  V   VTIINFTV   GLE+Q+LS +V  E+P++E +R++ +     D   L+ +ED+ L LL  S   I+++ EL Q L++SK+T+  IK RL E    E+ +  AR+ Y P+A RG+ +YFV+A L  ++ MYQ+SL +F+ LF   ++   K   +++S+    +LQ ++D     +Y   S GLF  H+ +++FML   IM    E     I Q++W  F++             A     ++ ++P+ + WL+   W  C  LE  L   F+G+         S KL        PE W  +     PF     + K+  V+      L +F+KLILI      K++ +   +V   LG++F      +L  L+ +    IP+VFIL   SDP+    +   E +G    +  +S+G+GQ   AE +I K  +  G WIFLQNC L +SWM ++++LI++          +F+L LS+ P + FP+ +LQNS+K+  E P G++  + ++F       ++ T +       + RK+IF +C F+A++ ER+ +G LG+++ Y+FNDSD E ++  +  +     + W+AL  + G I YGGR+TD  D+RCL  +L+++ S      G   + KS                +I   D  +     + G+ +NA +   + Q    +I+ I++            SN  +  ++   I  KIP  ++                        +D A++  FL+  K     +           VL QE+ ++N+LL  +   +  L   ++G   ++E +E + +    N VP              WS+     +  +G W         + L L  +   S      P +                               +W+ GFF PQ  +T  +QN AR  +  ID L     ++P
Sbjct: 2765 ETQAIAD---DAQRDLDEALPALDSANKALNALDKADISEMRVFTKPPDLVMTVMEAVCILLSNKTDWASAKQLLGDGNFLKKLMDYDKDNIKPQILQKLHKYISNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVLKEVGPKREKLAAAQVELDATMSTLKEKQNKLQEVENQIKVLQDQFESSMAEKETLAKTMALTEARLGRSGKLTSALGDEQVRWQESITLFEQEIHNVIGNVFIAAACVAYYGAFTSHYRQLLIDHWITRCQSLGIPISDNFSLIGILGDPYEIRQWNAEGLPRDNVSTENGILVMRGRRWPLMIDPQDQANRWIRSKETKNGLKVIKLTDAGFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRTLIRLGDSDIDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQILSDVVRLERPDLEEQRSQLIVRINADRNQLKAIEDRILKLLFTSEGNILDNEELVQTLQESKVTSQAIKSRLVEAETTEEMINRAREKYRPVATRGSIMYFVIASLSEIDPMYQFSLKYFKQLFNNTIESAEKH--KDLSL----RLQILLDQTLLSAYTNVSRGLFEQHKAIYSFMLCVEIMMQRGE-----ISQQEWLYFLR------------GAGGIRKELPEKPE-VPWLSDFAWETCCNLEDRLP-CFNGIKKEIISTPISVKLGQLEVTVNPEHWDGYVTDLPPFSEEIPSEKQPQVRGHWNQQLGAFQKLILIKSFMEEKVVSAVTEFVITGLGQQFVENPLVDLATLYADMSPSIPLVFILSTGSDPMGAFQRFANE-KGYQDRVKSISLGQGQGPIAERMI-KEALKNGIWIFLQNCHLAVSWMLAMEELIKSFNEPDTVIHEDFRLFLSSMPTNVFPVTVLQNSVKVTNEPPKGLRANVRRAFT-----EISSTFFEEHILGRKWRKIIFGVCFFHAIIQERKKFGPLGWNIRYEFNDSDRECALLNLNLYCQTGHIPWDALTYITGEITYGGRVTDAWDQRCLRTILKSFFSLATLEEGY-TYSKSGIYFAPDSDSLTEYKQYIE--DLPLIDDPEVFGMHENANLA-FQRQETMTVINTILEVQPRSSAAGGGKSNDEVVHELADSILAKIPDKLD------------------------MDAAVESLFLQDPKGRVNSLT---------TVLGQEVDRFNFLLRVLKTSLCTLQKAIAGLVVMSEEMEKIYNSFLNNQVP------------DHWSNAAYPSLKPLGSWV--------RDLNLRTAFIESWITRGQPKS-------------------------------FWISGFFFPQGFLTGALQNHARKYNLPIDELNFRFNMVP 4029          

HSP 3 Score: 501.13 bits (1289), Expect = 0.000e+0
Identity = 310/1053 (29.44%), Postives = 552/1053 (52.42%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPK-SFPESGKEFLYKLFEKSIKPGMKFLSK-CSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPN--DVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKS 9102
            +W++ DGP+++ W+EN+NTVLDD+++LCLAN ERI +  S+  +FEV DL  +SPATVSRC M+Y+  + + W   V++W+     K S P  G  +L +LFE+ ++ G++F SK C  +Q +      S++ TLCC+LEAL+    ++G                                  P ++ E+SK          LNN+L + +VF Y W+ G          IE++ DT                FD FV+  F++N++  +    D   ++S +++ D    +PW+ ++P          + S++S I          ++ + D++RY +L   L+  NH VL  G +G+GKS++                                 + LL+S+Q                EK+ YVP      +Y  I F++QTS  +  + + SK+ K+ ++I+G P NKK+++F+DDLN+P +D +GSQ  +E++RQ+ + +GF+D     W  + D ++  AC+P    ++P++ R  +HF +L LP PS ++ ++IF+  +G +    +FS  +K    SIVD  + +Y +       +P KSHY+FNLR L K + G+L  +   V ++  + +   HE  R  HDRLI++ D+  F  ++S+       +N          I+FG F  + G+  + +VY+ +TD++K+ +  +  ++ ++         +FF+ +I+H+ R  R++ Q  G+ L++GV G GK S  ++++ + G   F++ ++  YN  SF  D++K+   + ++ +  V   +D   +V + F++D+ N++NSG +P+L+E DEL+ +L+ + P+      +S+ N  +VY   I ++++ LH+ + +SP    +RSR R  PSL+NCCTIDW++ W  E+L+SV+          F   +E   E+     +E  + I+ +  ++  +F  ELRR Y+ +   ++E +N +  +L     +  + R R+  GL +L+ET  L+ KMK+DL  L P + +KS
Sbjct: 1837 KWVISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPSIHMMFEVQDLAVASPATVSRCGMVYIDPEELKWMPYVQTWLTGFAEKISDPVRG--YLMELFEQYVEKGLQFASKHC--VQAVAQVDI-SKVTTLCCLLEALLF---SDGA---------------------------------PSLKMESSK----------LNNVLCQTFVFCYLWAVGGNL-------IESHWDT----------------FDTFVRQQFEDNTDAKLSSVGD---LWSVYMNFDIKCLEPWERIIP----------VFSYNSEIPF-----FEMLVPTTDTVRYGYLMEKLLSVNHSVLFTGITGVGKSVVA--------------------------------RALLNSVQ----------------EKAGYVP------VY--INFSAQTSSARTQEIIESKLEKKRKNILGAPANKKIVVFVDDLNMPKLDSYGSQPPIELLRQFQDFHGFYDREKFFWKEIHDMTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSESSLKQIFKAILGGFL--TEFSTAVKQAADSIVDAAVEIYHRMSVDLLPTPAKSHYVFNLRDLSKCVQGMLQCEPTTVRDQTHIFRLFCHECQRVFHDRLINNEDKSYFNTMISEMASKYFSINIEPAYFVNQPIIFGDFIKV-GADKADRVYEDLTDMDKIRQVLQDYLDDYNTTFAKETKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHMCGYRCFQIELSRGYNYDSFHEDLRKLYRMAGVEGQDMVFLFTDT-QIVVEEFLEDINNMLNSGEVPNLFEKDELKQVLAAISPK-AKEAGISEGNRDEVYQFFITRVREKLHIVLCMSPVGDSFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSQ--------TFFQNVEFGSEEMKQCFSEMCVEIHVSVTDMAERFYSELRRHYYTTPTSYLELINLYLGMLGEKRQQLQAARDRIKNGLTKLLETNELVDKMKQDLSALEPVLAQKS 2728          

HSP 4 Score: 46.2098 bits (108), Expect = 0.000e+0
Identity = 27/82 (32.93%), Postives = 47/82 (57.32%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMIS-FSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +   V+NPK++S+  LYG VNP +LEW +G++ +  +  +  FS+ ++ V++D    D    EN N     N +  L N+E+
Sbjct: 1790 VKTYVLNPKSVSMGELYGEVNPLTLEWRDGLMALCVRAAVQDFSDDHKWVISDG-PVDALWIENMNTVLDDNKMLCLANSER 1870          

HSP 5 Score: 63.1586 bits (152), Expect = 1.087e-8
Identity = 50/232 (21.55%), Postives = 92/232 (39.66%), Query Frame = 2
Query:  575 SSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSF-----------MHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINY 1237
            S  D  P+ +W  E     +L  +  F  FR WKAFR W  N+   K+ K R  L  NL  L+   +  +  +  +   + D            + +  ++   T+ L EF + Q  Q+      L K    ++E     C+N   +   +    E+  + N + +S +F            +T++       K +  F++L D  +V   H ++  ++SK  +   E I +
Sbjct:  266 SEVDCLPLERWEQEYQFHRKLLRIPVFALFRKWKAFRVWCANVRYKKISKCRRSLQENLFVLNESLRPALIDIREMCYHISD------------MPLCRLEKDHTFTLKEFQRAQYTQLEEVSSRLEKFRELVMEVARNACRNALKEFGHTPDYGEVETDGNEELASPAFKLVFEDTPEKITYTQQANKSYHCKRLTCFIRLADYLIVNTTHMLVVNSVSKLLRVFQEHITH 485          

HSP 6 Score: 62.3882 bits (150), Expect = 2.195e-8
Identity = 36/119 (30.25%), Postives = 66/119 (55.46%), Query Frame = 2
Query: 13373 DNSKTMYNPDHGVLVFGLYLDNALWN-----LENS-SLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            D  + + N + GVLV G+++D   W+     +E++ S  +NP+      LP++H      ++N   +   +  PLY+T +R G LS++G S+NF+  + L S++   +WI + +A L Q
Sbjct: 4051 DMDQELPNMEDGVLVHGMFMDACRWDDTSMVVEDALSRVMNPM------LPVVHFEP---QQNYVPEPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVMLPSNQPSDYWISKASALLCQ 4160          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Zebrafish
Match: AL807739.1 (dynein, axonemal, heavy chain 6 [Source:NCBI gene;Acc:100148193])

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 461/1302 (35.41%), Postives = 718/1302 (55.15%), Query Frame = 2
Query: 1634 ISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMS--TNSLIDLVHYLPILNFCCFYVD------EALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKR-IGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXX-------------XXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            +S  P  E+   C+ ++I + E T+ S++T       + F +           +IN+ + E+      PS++ +L+ D  Y +++   +K S  T  +   V+      F  FY +      EALKE E     E  +  +   K+  ++ E +      I+ KR +G + + T  L     P   + I  +N+ L + A    D+ I  ++ A   LD  P    E+V+ L F+++I   +  ++KE  ++++M+ +I  + VP   E +A+Y TL   I  ++N +     ++D  + KF   L++ I ++   + E+K +A N   LD +  +S I   LG ++  + +L ++   Y  YQ+ F   ++K                       + +EE+  ++ ++ LLW++  EWE     ++  K DE +   + + V+R    V  LEK LP N ++P +KA V   +  LPVI  LRNP L+ RHW  +E ++   L +    T+  L +  I ++   I E+S  A+ E +LE++L K++D +   EF ++ H + +D +I+ G DDI V L++S + ++T+  S+Y   I+ +V+ W+R+L    + LDEW+ CQ+ WLYLE IF   DIQRQLP E ++F +VD  W+ +M++    P  L+  T+ G+L + Q  N+ LE+IQK LE YLE KR+IFPR +FLSNDELLEIL++ ++P+ VQ HL K F  + +L+  + +  +                  +VS EGE   L + ++ RG  E WL  +E+ +F  ++R  K  + + + K  V+W +     Q +L  +Q+ + +++   L+G    E      +        + L  LA  V  ++ S  R  + A+I I VH RD    L++  V S  +FEW++Q+RY W+     C      S + YG EYLG  PRLVITPLTDRCY+ + GAL  +LGG   GPAGTGKTET KDL+K +  QCVVFNCSD LD   +    SG+ Q G+WCCFDEFNR+N+EVLSVIA Q+ +I+ AK ++  RF+FE +EIKL   C  FITMNP YAGR ELPDNL  LFRP+AMMVP+Y LI EVIL+SEGF ++K L+ K+T +Y+LC++QLS Q HYDFG+R++KSVL++ G L+ E   +SE V         +LI+A++ SN P+ + DD  LF  I+ DLF        +  +L+ +I  S  +   +  P  I K+  L   +  RHGVML+GP+ SGKT +  +L   L  L
Sbjct:  533 LSYQPSNEDFQECVAEIIGQFEKTVLSLDTLVQDTYFDAFTQ----------PIINQKVEEKI-CGDGPSVEEILEEDA-YLQDIILNIKQSIQTAFVTANVYARTFEPFRLFYKENEDLDLEALKEQEH----EVVFFENSLDKYHQEHKEAL-----AIQQKRPLGILLVDTTELKHRLIPSPLRCIEAINDILPRLAKKKMDDIIAEVQDAQFKLDFVPTVTTEYVDSLNFLDEIQKRIEVLEKETVTVSEMYKLIECYSVPTPPEDIAVYATLPPCITAVRNTIDKAVGERDSYVDKFCQHLQQDIGQLNNTVQEVKAEAENHQLLDIDADRSHIRRLLGDIQISIDELQSQAFKYKTYQKNFKVEVTK----------------------YDTLEELTAEVKLKQLLWDSLEEWESLENGWLQDKFDELDPELLSKQVNRFVKYVSQLEKGLPPNNVVPFLKAKVESMREKLPVITDLRNPCLKARHWEMLEAIVDSKLLEEAQ-TLATLQNIDIFRFGLQIQEVSGQASGEASLENILRKIEDSWKTTEFIVLPHRDTKDVFILGGTDDIQVLLDDSIVNVATVASSRYAGPIKARVDKWQRQLLLFNQTLDEWLLCQRSWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRMPNALRAATQTGILDVFQNNNALLERIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAISQLEFATLTPTTPEGDDTVEKIQYTNDILSMVSPEGEKVVLGKGLKARGNVEDWLGKVEEAMFSSLRRLSKAAIADYQSKPRVEWVVAGHPSQVVLTISQLMWCRDMDNCLEG----EHDHFQALQEFEITNFERLNALAALVRGNLPSLHRNIITALITIDVHARDIVTDLVKEQVDSSDNFEWQRQLRYYWDVDLDDCVARMALSQYIYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGTFFSGLAQSGAWCCFDEFNRINIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSKTLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPNLSEDV---------VLIRALRDSNLPKFLKDDAALFSGILSDLFPGVTIPEHDYGVLQSTIHSSLCQRSLQPLPSIISKVIQLYETMLVRHGVMLVGPTGSGKTTVYRVLADTLDTL 1777          

HSP 2 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 421/1388 (30.33%), Postives = 702/1388 (50.58%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCN-------SFKL-------TPETWIKWNLSENPFDMSSYNFKEFSVK-----YLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQ--SEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSAL--DMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLP 13292
            ET+A+ +     + DL    P L+++ KAL++L+KA ISE+RV+  PP LV  VM AVC+LLS    WA+AK LLGD NFL+KL++Y+KD I  ++ + L +Y    DF PE V  VS AC+S+C WV A++ Y  V   + PKR+ +  A+  L+ +   L+ KQN+L++VE+ IK L  ++++S+ E++ L + + LT  RL R+  L  A+  E+ RW  SI   ++   N+IG+   +AA   + G +T  YR++    WI    +  IPI DN+  +      Y I  W+  GLPRD+   EN  ++ + ++WPL+IDPQ Q  R++++   K+  +VI      ++  LE AIR+G  + LE+++  +DP L P+L K+ F  G  T+I+LG+++++Y  +F+ Y+ + ++NP  +  V   VTIINFTV   GLE+Q+LS +V  E+P++E +R++ +     D   L+ +ED+ L LL  S   I+++ EL Q L++SK+T+  IK RL E    E+ +  AR+ Y P+A RG+ +YFV+A L  ++ MYQ+SL +F+ LF   ++   K   +++S+    +LQ ++D     +Y   S GLF  H+ +++FML   IM    E     I Q++W  F++             A     ++ ++P+ + WL+   W  C  LE  L   F+G+         S KL       +PE W  +     PF     + K+  V+      L +F+KLILI      K++ +   +V   LG++F      +L  L+ +    IP+VFIL   SDP+    +   E +G    +  +S+G+GQ   AE +I K  +  G WIFLQNC L +SWM ++++LI++          +F+L LS+ P + FP+ +LQNS+K+  E P G++  + ++F       ++ T +       + RK+IF +C F+A++ ER+ +G LG+++ Y+FNDSD E ++  +  +     + W+AL  + G I YGGR+TD  D+RCL  +L+++ S      G   + KS                +I   D  +     + G+ +NA +   + Q    +I+ I++            SN  +  +++  I  KIP  ++                        +D A++  FL+  K     +           VL QE+ ++N+LL  +   +  L   ++G   ++E +E + +    N VP              WS+     +  +G W         + L L  +   S      P +                               +W+ GFF PQ  +T  +QN AR  +  ID L     ++P
Sbjct: 2765 ETQAIAD---DAQRDLDEALPALDSANKALNALDKADISEMRVFTKPPDLVMTVMEAVCILLSNKTDWASAKQLLGDGNFLKKLMDYDKDNIKPQILQKLHKYISNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVLKEVGPKREKLAAAQVELDATMSTLKEKQNKLQEVENQIKVLQEQFESSMAEKETLAKTMALTEARLGRSGKLTSALGDEQVRWQESITLFEQEIHNVIGNVFIAAACVAYYGAFTSHYRQLLIDHWITRCQSLGIPISDNFSLIGILGDPYEIRQWNAEGLPRDNVSTENGILVMRGRRWPLMIDPQDQANRWIRSKETKNGLKVIKLTDAGFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRTLIRLGDSDIDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQILSDVVRLERPDLEEQRSQLIVRINADRNQLKAIEDRILKLLFTSEGNILDNEELVQTLQESKVTSQAIKSRLVEAETTEEMINRAREKYRPVATRGSIMYFVIASLSEIDPMYQFSLKYFKQLFNNTIESAEKH--KDLSL----RLQILLDQTLLSAYTNVSRGLFEQHKAIYSFMLCVEIMMQRGE-----ISQQEWLYFLR------------GAGGIRKELPEKPE-VPWLSDFAWETCCNLEDRLP-CFNGIKKEIISTPISVKLGQLEVTVSPEHWDGYVTDLPPFSEEIPSEKQPQVRGHWNQQLGAFQKLILIKSFMEEKVVSAVTEFVITGLGQQFVENPPVDLTTLYADMSPSIPLVFILSTGSDPMGAFQRFANE-KGYQDRVKSISLGQGQGPIAERMI-KEALKNGIWIFLQNCHLAVSWMLAMEELIKSFNEPDTVIHEDFRLFLSSMPTNVFPVTVLQNSVKVTNEPPKGLRANVRRAFT-----EISSTFFEEHILGRKWRKIIFGVCFFHAIIQERKKFGPLGWNIRYEFNDSDRECALLNLNLYCQTGHIPWDALTYITGEITYGGRVTDAWDQRCLRTILKSFFSLATLEEGY-TYSKSGIYFAPDSDSLTEYKQYIE--DLPLIDDPEVFGMHENANLA-FQRQETMTVINTILEVQPRSSAAGGGKSNDEVVHELVDSILAKIPDKLD------------------------MDAAVESLFLQDPKGRVNSLT---------TVLGQEVDRFNFLLRVLKTSLCTLQKAIAGLVVMSEEMEKIYNSFLNNQVP------------DHWSNAAYPSLKPLGSWV--------RDLNLRTAFIESWITRGQPKS-------------------------------FWISGFFFPQGFLTGALQNHARKYNLPIDELNFRFNMVP 4029          

HSP 3 Score: 499.59 bits (1285), Expect = 0.000e+0
Identity = 310/1053 (29.44%), Postives = 553/1053 (52.52%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPK-SFPESGKEFLYKLFEKSIKPGMKFLSK-CSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPN--DVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKS 9102
            +W++ DGP+++ W+EN+NTVLDD+++LCLAN ERI +  S+  +FEV DL  +SPATVSRC M+Y+  + + W   V++W+     K S P  G  +L +LFE+ ++ G++F SK C  +Q +      S++ TLCC+LEAL+    ++G                                  P ++ E+SK          LNN+L + +VF Y W+ G          IE++ DT                FD FV+  F++N++   +LP     ++S +++ D    +PW+ ++P          + S++S I          ++ + D++RY +L   L+  NH VL  G +G+GKS++                                 + LL+S+Q                EK+ YVP      +Y  I F++QTS  +  + + SK+ K+ ++I+G P NKK+++F+DDLN+P +D +GSQ  +E++RQ+ + +GF+D     W  + D ++  AC+P    ++P++ R  +HF +L LP PS ++ ++IF+  +G +    +FS  +K    SIVD  + +Y +       +P KSHY+FNLR L K + G+L  +   V ++  + +   HE  R  HDRLI++ D+  F  ++S+       +N          I+FG F  + G+  + +VY+ +TD++K+ +  +  ++ ++         +FF+ +I+H+ R  R++ Q  G+ L++GV G GK S  ++++ + G   F++ ++  YN  SF  D++K+   + ++ +  V   +D   +V + F++D+ N++NSG +P+L+E DEL+ +L+ + P+      +S+ N  +V+   I ++++ LH+ + +SP    +RSR R  PSL+NCCTIDW++ W  E+L+SV+          F   +E   E+     +E  + I+ +  ++  +F  ELRR Y+ +   ++E +N +  +L     +  + R R+  GL +L+ET  L+ KMK+DL  L P + +KS
Sbjct: 1837 KWVISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPSIYMMFEVQDLAVASPATVSRCGMVYIDPEELKWMPYVQTWLTGFAEKISDPVRG--YLMELFEQYVEKGLQFASKHC--LQAVAQVDI-SKVTTLCCLLEALLF---SDGA---------------------------------PSLKMESSK----------LNNVLCQTFVFCYLWAVGGNL-------IESHWDT----------------FDTFVRQQFEDNTDA--KLP-SVGDLWSVYMNFDIKCLEPWERIIP----------VFSYNSEIPF-----FEMLVPTTDTVRYGYLMEKLLSVNHSVLFTGITGVGKSVVA--------------------------------RALLNSVQ----------------EKAGYVP------VY--INFSAQTSSARTQEIIESKLEKKRKNILGAPANKKIVVFVDDLNMPKLDSYGSQPPIELLRQFQDFHGFYDREKFFWKEIHDMTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSESSLKQIFKAILGGFL--TEFSTAVKQAADSIVDAAVEIYHRMSVDLLPTPAKSHYVFNLRDLSKCVQGMLQCEPTTVRDQTHIFRLFCHECQRVFHDRLINNEDKSYFNTMISEMASKYFSINIEPAYFVNQPIIFGDFIKV-GADKADRVYEDLTDMDKIRQVLQDYLDDYNTTFAKETKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHMCGYRCFQIELSRGYNYDSFHEDLRKLYRMAGVEGQDMVFLFTDT-QIVVEEFLEDINNMLNSGEVPNLFEKDELKQVLAAISPK-AKEAGISEGNRDEVFQFFISRVREKLHIVLCMSPVGDSFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSQ--------TFFQNVEFGSEEMKQCFSEMCVEIHVSVTDMAERFYSELRRHYYTTPTSYLELINLYLGMLGEKRQQLQAARDRIKNGLTKLLETNELVDKMKQDLSALEPVLAQKS 2728          

HSP 4 Score: 46.2098 bits (108), Expect = 0.000e+0
Identity = 27/82 (32.93%), Postives = 47/82 (57.32%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMIS-FSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +   V+NPK++S+  LYG VNP +LEW +G++ +  +  +  FS+ ++ V++D    D    EN N     N +  L N+E+
Sbjct: 1790 VKTYVLNPKSVSMGELYGEVNPLTLEWRDGLMALCVRAAVQDFSDDHKWVISDG-PVDALWIENMNTVLDDNKMLCLANSER 1870          

HSP 5 Score: 67.0106 bits (162), Expect = 8.597e-10
Identity = 55/236 (23.31%), Postives = 92/236 (38.98%), Query Frame = 2
Query:  575 SSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNL----SRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSF-----------MHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINY 1237
            S  D  P+ +W  E     +L  +  F  FR WKAFR WR N+   K+ K R  L  NL      L P   D     + +S+  L R                ++   T+ L EF + Q  Q+      L K    ++E     C+N   +   +    E+  + N + +S +F            +T++       K +  F++L D  +V   H ++  ++SK  +   E I +
Sbjct:  266 SEVDCLPLERWEQEYQFHRKLLRIPVFALFRKWKAFRVWRANVRYKKISKCRRSLQENLFVLNESLRPALIDIREMCYHISDMPLCR----------------LEKDHTFTLKEFQRAQYTQLEEVSSRLEKFRELVMEVARNACRNALKEFGHTPDYGEVETDGNEELASPAFKLVFEDTPEKITYTQQANKSYHCKRLTCFIRLADYLIVNTTHMLVVNSVSKLLRVFQEHITH 485          

HSP 6 Score: 62.3882 bits (150), Expect = 2.195e-8
Identity = 36/119 (30.25%), Postives = 66/119 (55.46%), Query Frame = 2
Query: 13373 DNSKTMYNPDHGVLVFGLYLDNALWN-----LENS-SLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            D  + + N + GVLV G+++D   W+     +E++ S  +NP+      LP++H      ++N   +   +  PLY+T +R G LS++G S+NF+  + L S++   +WI + +A L Q
Sbjct: 4051 DMDQELPNMEDGVLVHGMFMDACRWDDTSMVVEDALSRVMNPM------LPVVHFEP---QQNYVPEPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVMLPSNQPSDYWISKASALLCQ 4160          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Zebrafish
Match: dnah6 (dynein, axonemal, heavy chain 6 [Source:ZFIN;Acc:ZDB-GENE-030616-623])

HSP 1 Score: 771.926 bits (1992), Expect = 0.000e+0
Identity = 462/1314 (35.16%), Postives = 717/1314 (54.57%), Query Frame = 2
Query: 1634 ISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMS--TNSLIDLVHYLPILNFCCFYVD------EALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKR-IGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXX-------------XXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLT------------DRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            +S  P  E+   C+ ++I + E T+ S++T       + F +           +IN+ + E+      PS++ +L+ D  Y +N+   +K S  T  +   V+      F  FY +      EALKE E     E  +  +   K+  ++ E +      I+ KR +G + + T  L     P   + I  +N+ L + A    D+ I   + A   LD  P    E+V+ L F+++I   +  ++KE  ++++M+ +I  + VP   E +A+Y TL   I  ++N +     ++D  + KF   L++ I ++   + E+K +A N   LD +  +S I   LG ++  + +L ++   Y  YQ+ F   ++K                       + +EE+  ++ ++ LLW++  EWE     ++  K DE +   + + V+R    V  LEK LP N ++P +KA V   +  LPVI  LRNP L+ RHW  +E ++   L +    T+  L +  I ++   I E+S  A+ E +LE++L K++D +   EF ++ H + +D +I+ G DDI V L++S + ++T+  S+Y   I+ +V+ W+R+L    + LDEW+ CQ+ WLYLE IF   DIQRQLP E ++F +VD  W+ +M++    P  L+  T+ G+L + Q  N+ LE+IQK LE YLE KR+IFPR +FLSNDELLEIL++ ++P+ VQ HL K F  + +L+  + +  +                  +VS EGE   L + ++ RG  E WL  +E+ +F  ++R  K  + + + K  V+W +     Q +L  +Q+ + +++   L+G    E      +        + L  LA  V  ++ S  R  + A+I I VH RD    L++  V S  +FEW++Q+RY W+     C      S + YG EYLG  PRLVITPLT            DRCY+ + GAL  +LGG   GPAGTGKTET KDL+K +  QCVVFNCSD LD   +    SG+ Q G+WCCFDEFNR+N+EVLSVIA Q+ +I+ AK ++  RF+FE +EIKL   C  FITMNP YAGR ELPDNL  LFRP+AMMVP+Y LI EVIL+SEGF ++K L+ K+T +Y+LC++QLS Q HYDFG+R++KSVL++ G L+ E   +SE V         +LI+A++ SN P+ + DD  LF  I+ DLF        +  +L+ +I  S  +   +  P  I K+  L   +  RHGVML+GP+ SGKT +  +L   L  L
Sbjct:  533 LSYQPSNEDFQECVAEIIGQFEKTVLSLDTLVQDTYFDAFTQ----------PIINQKVEEK-ICGDGPSVEEILEEDA-YLQNIILNIKQSIQTAFVTANVYARTFEPFRLFYKENEDLDLEALKEQEH----EVAFFENSLDKYHQEHKEAL-----AIQQKRPLGILLVDTTKLKHRLIPSPLRCIEAINDILPRLAKKKMDDIIAEAQDAQFKLDFVPTVTTEYVDSLNFLDEIQKRIEVLEKETVTVSEMYKLIECYSVPTPPEDIAVYATLPPCITAVRNTIDKAVGERDSYVDKFCQHLQQDIGQLNNTVQEVKAEAENHQLLDIDADRSHIRRLLGDIQISIDELQSQAFKYKTYQKNFKVEVTK----------------------YDTLEELTAEVKLKQLLWDSLEEWESLENGWLQDKFDELDPELLSKQVNRFVKYVSQLEKGLPPNNVVPFLKAKVESMREKLPVITDLRNPCLKARHWEMLEAIVDSKLLEEAQ-TLATLQNIDIFRFGLQIQEVSGQASGEASLENILRKIEDSWKTTEFIVLPHRDTKDVFILGGTDDIQVLLDDSIVNVATVASSRYAGPIKARVDKWQRQLLLFNQTLDEWLLCQRSWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRMPNALRAATQTGILDVFQNNNALLERIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAISQLEFATLTPTTPEGDDTVEKIQYTNDILSMVSPEGEKVVLGKGLKARGNVEDWLGKVEEAMFSSLRRLSKAAIADYQSKPRVEWVVAGHPSQVVLTISQLMWCRDMDNCLEG----EHDHFQALQEFEITNFERLNALAALVRGNLPSLHRNIITALITIDVHARDIVTDLVKEQVDSSDNFEWQRQLRYYWDVDLDDCVARMALSQYIYGYEYLGACPRLVITPLTVHIHLNFFFLMMDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGTFFSGLAQSGAWCCFDEFNRINIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSKTLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPNLSEDV---------VLIRALRDSNLPKFLKDDAALFSGILSDLFPGVTIPEHDYGVLQSTIHSSLCQRSLQPLPSIISKVIQLYETMLVRHGVMLVGPTGSGKTTVYRVLADTLDTL 1789          

HSP 2 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 362/1049 (34.51%), Postives = 594/1049 (56.63%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCN-------SFKL-------TPETWIKWNLSENPFDMSSYNFKEFSVK-----YLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQ--SEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYAS 12281
            ET+A+ +     + DL    P L+++ KAL++L+KA ISE+RV+  PP LV  VM AVC+LLS    WA+AK LLGD NFL+KL++Y+KD I  ++ + L +Y    DF PE V  VS AC+S+C WV A++ Y  V   + PKR+ +  A+  L+ +   L+ KQN+L++VE+ IK L +++++S+ E++ L + + LT  RL R+  L  A+  E+ RW  SI   ++   N+IG+   +AA   + G +T  YR++    WI    +  IPI DN+  +      Y I  W+  GLPRD+   EN  ++ + ++WPL+IDPQ Q  R++++   K+  +VI      ++  LE AIR+G  + LE+++  +DP L P+L K+ F  G  T+I+LG+++++Y  +F+ Y+ + ++NP  +  V   VTIINFTV   GLE+Q+LS +V  E+P++E +R++ +     D   L+ +ED+ L LL  S   I+++ EL Q L++SK+T+  IK RL E    E+ +  AR+ Y P+A RG+ +YFV+A L  ++ MYQ+SL +F+ LF   ++   K   +++S+    +LQ ++D     +Y   S GLF  H+ +++FML   IM    E     I Q++W  F++             A     ++ ++P+ + WL+   W  C  LE  L   F+G+         S KL        PE W  +     PF     + K+  V+      L +F+KLILI      K++ +   +V   LG++F      +L  L+ +    IP+VFIL   SDP+    +   E +G    +  +S+G+GQ   AE +I K  +  G WIFLQNC L +SWM ++++LI++          +F+L LS+ P + FP+ +LQNS+K+  E P G++  + ++F       ++ T +       + RK+IF +C F+A++ ER+ +G LG+++ Y+FNDSD E ++  +  +     + W+AL  + G I YGGR+TD  D+RCL  +L+++ S
Sbjct: 2769 ETQAIAD---DAQRDLDEALPALDSANKALNALDKADISEMRVFTKPPDLVMTVMEAVCILLSNKTDWASAKQLLGDGNFLKKLMDYDKDNIKPQILQKLHKYISNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVLKEVGPKREKLAAAQVELDATMSTLKEKQNKLQEVENQIKVLQDQFESSMAEKETLAKTMALTEARLGRSGKLTSALGDEQVRWQESITLFEQEIHNVIGNVFIAAACVAYYGAFTSHYRQLLIDHWITRCQSLGIPISDNFSLIGILGDPYEIRQWNAEGLPRDNVSTENGILVMRGRRWPLMIDPQDQANRWIRSKETKNGLKVIKLTDAGFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRTLIRLGDSDIDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQILSDVVRLERPDLEEQRSQLIVRINADRNQLKAIEDRILKLLFTSEGNILDNEELVQTLQESKVTSQAIKSRLVEAETTEEMINRAREKYRPVATRGSIMYFVIASLSEIDPMYQFSLKYFKQLFNNTIESAEKH--KDLSL----RLQILLDQTLLSAYTNVSRGLFEQHKAIYSFMLCVEIMMQRGE-----ISQQEWLYFLR------------GAGGIRKELPEKPE-VPWLSDFAWETCCNLEDRLP-CFNGIKKEIISTPISVKLGQLEVTVNPEHWDGYVTDLPPFSEEIPSEKQPQVRGHWNQQLGAFQKLILIKSFMEEKVVSAVTEFVITGLGQQFVENPLVDLATLYADMSPSIPLVFILSTGSDPMGAFQRFANE-KGYQDRVKSISLGQGQGPIAERMI-KEALKNGIWIFLQNCHLAVSWMLAMEELIKSFNEPDTVIHEDFRLFLSSMPTNVFPVTVLQNSVKVTNEPPKGLRANVRRAFT-----EISSTFFEEHILGRKWRKIIFGVCFFHAIIQERKKFGPLGWNIRYEFNDSDRECALLNLNLYCQTGHIPWDALTYITGEITYGGRVTDAWDQRCLRTILKSFFS 3782          

HSP 3 Score: 499.204 bits (1284), Expect = 0.000e+0
Identity = 310/1053 (29.44%), Postives = 553/1053 (52.52%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPK-SFPESGKEFLYKLFEKSIKPGMKFLSK-CSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPN--DVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKS 9102
            +W++ DGP+++ W+EN+NTVLDD+++LCLAN ERI +  S+  +FEV DL  +SPATVSRC M+Y+  + + W   V++W+     K S P  G  +L +LFE+ ++ G++F SK C  +Q +      S++ TLCC+LEAL+    ++G                                  P ++ E+SK          LNN+L + +VF Y W+ G          IE++ DT                FD FV+  F++N++  +    D   ++S +++ D    +PW+ ++P          + S++S I          ++ + D++RY +L   L+  NH VL  G +G+GKS++                                 + LL+S+Q                EK+ YVP      +Y  I F++QTS  +  + + SK+ K+ ++I+G P NKK+++F+DDLN+P +D +GSQ  +E++RQ+ + +GF+D     W  + D ++  AC+P    ++P++ R  +HF +L LP PS ++ ++IF+  +G +    +FS  +K    SIVD  + +Y +       +P KSHY+FNLR L K + G+L  +   V ++  + +   HE  R  HDRLI++ D+  F  ++S+    +  +N          I+FG F  + G+  + +VY+ +TD++K+ +  +  ++ ++         +FF+ +I+H+ R  R++ Q  G+ L++GV G GK S  ++++ + G   F++ ++  YN  SF  D++K+   + ++ +  V   +D   +V + F++D+ N++NSG +P+L+E DEL+ +L+ + P+      +S+ N  +VY   I ++++ LH+ + +SP    +RSR R  PSL+NCCTIDW++ W  E+L+SV+          F   +E   E+     +E  + I+ +  ++  +F  ELRR Y+ +   ++E +N +  +L     +  + R R+  GL +L+ET  L+ KMK+DL  L P + +KS
Sbjct: 1849 KWVISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPSIHMMFEVQDLAVASPATVSRCGMVYIDPEELKWMPYVQTWLTGFAEKISDPVRG--YLMELFEQYVEKGLQFASKHC--VQAVAQVDI-SKVTTLCCLLEALLF---SDGA---------------------------------PSLKMESSK----------LNNVLCQTFVFCYLWAVGGNL-------IESHWDT----------------FDTFVRQQFEDNTDAKLSSVGD---LWSVYMNFDIKCLEPWERIIP----------VFSYNSEIPF-----FEMLVPTTDTVRYGYLMEKLLSVNHSVLFTGITGVGKSVVA--------------------------------RALLNSVQ----------------EKAGYVP------VY--INFSAQTSSARTQEIIESKLEKKRKNILGAPANKKIVVFVDDLNMPKLDSYGSQPPIELLRQFQDFHGFYDREKFFWKEIHDMTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSESSLKQIFKAILGGFL--TEFSTAVKQAADSIVDAAVEIYHRMSVDLLPTPAKSHYVFNLRDLSKCVQGMLQCEPTTVRDQTHIFRLFCHECQRVFHDRLINNEDKSYFNTMISEMAKPAYFVNQP--------IIFGDFIKV-GADKADRVYEDLTDMDKIRQVLQDYLDDYNTTFAKETKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHMCGYRCFQIELSRGYNYDSFHEDLRKLYRMAGVEGQDMVFLFTDT-QIVVEEFLEDINNMLNSGEVPNLFEKDELKQVLAAISPK-AKEAGISEGNRDEVYQFFITRVREKLHIVLCMSPVGDSFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSQ--------TFFQNVEFGSEEMKQCFSEMCVEIHVSVTDMAERFYSELRRHYYTTPTSYLELINLYLGMLGEKRQQLQAARDRIKNGLTKLLETNELVDKMKQDLSALEPVLAQKS 2732          

HSP 4 Score: 46.2098 bits (108), Expect = 0.000e+0
Identity = 27/82 (32.93%), Postives = 47/82 (57.32%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMIS-FSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +   V+NPK++S+  LYG VNP +LEW +G++ +  +  +  FS+ ++ V++D    D    EN N     N +  L N+E+
Sbjct: 1802 VKTYVLNPKSVSMGELYGEVNPLTLEWRDGLMALCVRAAVQDFSDDHKWVISDG-PVDALWIENMNTVLDDNKMLCLANSER 1882          

HSP 5 Score: 63.5438 bits (153), Expect = 9.472e-9
Identity = 54/236 (22.88%), Postives = 91/236 (38.56%), Query Frame = 2
Query:  575 SSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNL----SRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSF-----------MHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINY 1237
            S  D  P+ +W  E     +L  +  F  FR WKAFR W  N+   K+ K R  L  NL      L P   D     + +S+  L R                ++   T+ L EF + Q  Q+      L K    ++E     C+N   +   +    E+  + N + +S +F            +T++       K +  F++L D  +V   H ++  ++SK  +   E I +
Sbjct:  266 SEVDCLPLERWEQEYQFHRKLLRIPVFALFRKWKAFRVWCANVRYKKISKCRRSLQENLFVLNESLRPALIDIREMCYHISDMPLCR----------------LEKDHTFTLKEFQRAQYTQLEEVSSRLEKFRELVMEVARNACRNALKEFGHTPDYGEVETDGNEELASPAFKLVFEDTPEKITYTQQANKSYHCKRLTCFIRLADYLIVNTTHMLVVNSVSKLLRVFQEHITH 485          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 408/1393 (29.29%), Postives = 681/1393 (48.89%), Query Frame = 3
Query: 9204 TEAVENYSLKC-------EEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYR-EMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPET-KLQKIIDSV----TYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQII----KQPDNI--EWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQI--RKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDF-----QSINSFIH--SNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSW--GLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEV 13286
            +E +E   +KC       + DL    P LE ++KAL+SLNK  ++E++ Y  PP LVE VM AV +L    P+WA AK  LG+ NF+++L+N++KD I+ ++ K + QY  Q DF PE +G VSLA +S+C WV A+E Y  +  ++ PKR  ++ A   L   +  L   Q +L++V + + +L  +Y   + ++++L+ +      +L RA  L+  +  E+ RW  ++   +K    ++G C+ +AA+ ++ GP+   +R E+    W+  +    +P    + F  F      +  W+  GLP D+   EN  I+ +  +WPL++DPQ Q  ++++   FK   +VI  +  D++ +LE A++ G  + L++++ ++DP L P+L K   R G   ++KLG+ E+EYSP F+ Y+ + LSNP     ++   TI+NF V   GLE QLL ++V KE+PE+E +++  +   A+    L+ LED+ L LL ++T  +++D +L   L+ SK+TA ++ ++LE +   E Q+  AR+ Y P A R + ++FVL DLG ++ MYQ+SL  + NLF   ++            SP + KL++ I+++    TY  Y     GLF  H+ LF+F +   I+     E+  ++   ++  F++                  G ++    KQ DN    WL+   W+     E++    F  L  SF+  P  W  W  +  P         E S    N  +K++++  L   ++      +V   LG +F      ++  +  +S  + P++F+L    DP   +++L  E  G       +S+G+GQA  A  LI K  +  G W+FL NC L +SWM  L KL++ LQ+  Q+   +F+L LS+ PH +FPI ILQ  +KI  E P G+K  + + +       V+ET +   S  +  RK++F+LC F++V+LERR +  LG+++ Y FNDSD E+S   +  +L    E+ W+AL  +I  INYGG +TD+ DRR L   +  Y             + +P   +  L  +      S +S++   S   A+E  E L G   NA+I     ++++    ++  Q +      T+   S  D +  +S  + + +   I          D+E    L       +KDD                  SP + VL QEI++YN LL  I   +  L   + G   ++ SLE   + I    VPP W     S+ K L+ W+ ++  R++    W                                           E  +   LF          WL GF  P   +TAV+Q+ AR  + S+D L+    V
Sbjct: 3024 SEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIES-----------SPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKIL-----EASGKLNMDEYNFFLR------------------GGLVLDTKKQMDNPCSHWLSDSNWD--NITELDKLTNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSC---NELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLA-ETSGMGQRFFALSLGQGQAPIATRLI-KEGVANGHWVFLANCHLSLSWMCELDKLVDELQV--QECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQ-----RVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYEEIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFC--------PAVIDTPFFKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPE-LFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPAEI----------DYEGTRKL-------LKDDL-----------------SPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYPSL-KPLASWTRDLCQRVEQFARWA------------------------------------------ETARPPVLF----------WLSGFTFPTGFLTAVLQSSARQNNVSVDTLSWEFSV 4272          

HSP 2 Score: 278.87 bits (712), Expect = 0.000e+0
Identity = 196/780 (25.13%), Postives = 378/780 (48.46%), Query Frame = 1
Query: 6790 TIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFD-HEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIF--IYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            TIY Y+VD     +  ++  +P                   A+N      ++ ++D++RY +L   L+   HPVLL G  G GK+ +                                 Q++L S+ N+                         T+   ++  +SQTS N   + + S++ KR + +  P   KKM++F+DDLN+P +D FGSQ  LE++R WI+   ++D       Y+ D  L+ +  P    ++ IS RL   F ++ +  P+ +  +RI+   I +    ++F  E+K     +    + +Y    +++  +P K HY+FNLR + K+  GLL A       K+ + +   HE  R   DRL+   D E F  +LS++L     + +      K   +FG F         +++Y+ + D + L    E+ +  ++    +   + + F+ +I H+ R +R+++Q  G+ML++G+ G G+ S  ++++ I    +F++ +T  Y    FR DIKK+   + ++N+P V   +D   +V++SF++D+ N+++SG +P+LY+ DEL+ I S L         +  P+ ++  LIE+++  LH+ + +SP    +R+R+R  P+L+NC TIDW+ +W  ++L+ VA              +    +D +     ASIF  ++++  +  ++ ++EL+R  +++  +++E ++ +  +L     +     S+L  GL ++ +TR+ +  M  +L E   K+ E  ++ E
Sbjct: 2310 TIYEYYVDTKNKTWASFEDKLPK--------------GWRYASNAPFYKIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVA--------------------------------QSVLQSLDNI-------------------------TWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDYGFWYDRQKQTLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIYGTMISQKL--QEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFL------RESQIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDT-QIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAE--------RCLDGLSLGSDDGIQTKV-ASIFVTVHQSVAQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCE 3000          

HSP 3 Score: 65.855 bits (159), Expect = 0.000e+0
Identity = 44/121 (36.36%), Postives = 64/121 (52.89%), Query Frame = 2
Query: 13358 VFNIRDNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIP-SFWILRGTAALLQCE 13717
            V  + DN+  ++ P  GVL+ GL+L+ A W+ + S L      +  C +P IH   V S K   ++ Y+  CP Y  P R G   SSG+ S F+  + LKS  +P   WI RGTA L+  +
Sbjct: 4272 VTTVEDNN-LLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKRLAKNMYS--CPCYYYPVRSG---SSGRQS-FVVAVDLKSGAVPYDHWIKRGTALLMSLD 4385          

HSP 4 Score: 563.148 bits (1450), Expect = 5.097e-163
Identity = 365/1097 (33.27%), Postives = 587/1097 (53.51%), Query Frame = 2
Query: 2258 LDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEA--KKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWE----RWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSL-TKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXX-XYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQ------KQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL-----PLINLSKE 5491
            L   P+T+ +  E L+ +  + A++  ++ +   I++ + I+T ++V V    L L + LN      +  V+  +   KK ++  K S  +    E  +     ++  + N  F   + T    L Q+  L+ ++  L  + +N  +    F  ++ + ASK                    D+  +E+D+     +WE   +WE     W    +     E   NT  QT+ +T H +    K     EI+ + K+ + + K  +P+I  LRN  L+ RHW++I + +  +    + +FT+ ++++  +  + + I +IS  A+ E+++E  L  +   +  +   +  H ++    + G D++   LE++ +T+S IK S++V     +V+ WER LS   +V++  +  Q+ W+YLE IF   DI++QL  E   F  V   W+ +M++  +    L+     G+L+ L   N+KLE+IQKSL+ YLE KR IFPR +FLSND+LLEIL ++++PE VQ HL K F N+  L+I+   + + S    + S +GE       + + G  E WL  +E+ +   +K  ++ C + +++      K   DW     GQ ++ ++Q++++ +V+RAL  +   E      + S+    +  L   +  +  ++    R  + A++ ++VH RD    L +        F+W  Q+R  W +    C + Q +++F YG EYLG S RLVITPLTDRCYMT+T AL+ + GG  KGPAGTGKTET+KDL K +G   +V NCS+ LD  ++ ++ SG+ Q G+W CFDEFNR+N+EVLSV+A QI SI +A  +    F FE ++I L   CGIFITMNP YAGR ELPDNL  +FRP++M+VPD  LI E+ LF+EGF   KVL+ K+  LY L   QLS Q HYDFGLR++ S+L   G  R  R  I       V+EE  IL+ ++K  N  +L + DLPLF  I+ DLF   +    +   L+ ++E   ++ G +V P  + K+  L     SRH  M++G + SGKTV    LQ  L+ L     P  NL +E
Sbjct: 1020 LSQPPQTLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAVD-PVLELLEALNAEWVWFQQVVIDSDIMLKKHKDTMK-SGLILSSEEFQKKTQTFLQSFSSNGPF-GSSVTPHSALQQVSELRAQLEALKEEEQNICSGLNIF--TIEQPASK--------------------DILALEKDVDYLQQVWEIARQWEDLWAEWKGGHLASLQTEVMDNTA-QTMFKTLHKLSRAFKD-KHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKDKGHHKLRGTDEVFQALEDNQVTLSVIKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWP----GQMLITASQIQWTTDVTRALMTSK--ERADKSALKSLKKKQVSMLNQYSEAIRGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSFEGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDI-------VDEE--ILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRE 2074          

HSP 5 Score: 35.8094 bits (81), Expect = 5.097e-163
Identity = 22/76 (28.95%), Postives = 41/76 (53.95%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQN--VLNDQLSTDNFEKENS--NQNDLQTLLNNEQ 5790
            +NPKA+S+  LYG  N ++ EW +G++  + +   +    ++   V +  + T   E  NS  + N + TL+N E+
Sbjct: 2077 LNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGER 2152          

HSP 6 Score: 111.694 bits (278), Expect = 2.527e-23
Identity = 54/145 (37.24%), Postives = 94/145 (64.83%), Query Frame = 1
Query: 5950 KKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKF-LSKCSKIQIIPNTSKQSQLFTLCCILEAL 6381
            K + +WIV DGP+++ W+E++N+V+DD+++L L NGERI++P  +  LFEV+DL  +SPATVSRC M+Y     + WK  V+SWM+ +      +   + L++LFE+ I   + F  + C ++  I   ++ + + +LC + ++L
Sbjct: 2115 KPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSWMEKR-----QKVETDLLWQLFERYIDKTLAFKKTHCKELVAI---TELNGVASLCRLYQSL 2251          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 408/1393 (29.29%), Postives = 681/1393 (48.89%), Query Frame = 3
Query: 9204 TEAVENYSLKC-------EEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYR-EMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPET-KLQKIIDSV----TYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQII----KQPDNI--EWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQI--RKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDF-----QSINSFIH--SNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSW--GLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEV 13286
            +E +E   +KC       + DL    P LE ++KAL+SLNK  ++E++ Y  PP LVE VM AV +L    P+WA AK  LG+ NF+++L+N++KD I+ ++ K + QY  Q DF PE +G VSLA +S+C WV A+E Y  +  ++ PKR  ++ A   L   +  L   Q +L++V + + +L  +Y   + ++++L+ +      +L RA  L+  +  E+ RW  ++   +K    ++G C+ +AA+ ++ GP+   +R E+    W+  +    +P    + F  F      +  W+  GLP D+   EN  I+ +  +WPL++DPQ Q  ++++   FK   +VI  +  D++ +LE A++ G  + L++++ ++DP L P+L K   R G   ++KLG+ E+EYSP F+ Y+ + LSNP     ++   TI+NF V   GLE QLL ++V KE+PE+E +++  +   A+    L+ LED+ L LL ++T  +++D +L   L+ SK+TA ++ ++LE +   E Q+  AR+ Y P A R + ++FVL DLG ++ MYQ+SL  + NLF   ++            SP + KL++ I+++    TY  Y     GLF  H+ LF+F +   I+     E+  ++   ++  F++                  G ++    KQ DN    WL+   W+     E++    F  L  SF+  P  W  W  +  P         E S    N  +K++++  L   ++      +V   LG +F      ++  +  +S  + P++F+L    DP   +++L  E  G       +S+G+GQA  A  LI K  +  G W+FL NC L +SWM  L KL++ LQ+  Q+   +F+L LS+ PH +FPI ILQ  +KI  E P G+K  + + +       V+ET +   S  +  RK++F+LC F++V+LERR +  LG+++ Y FNDSD E+S   +  +L    E+ W+AL  +I  INYGG +TD+ DRR L   +  Y             + +P   +  L  +      S +S++   S   A+E  E L G   NA+I     ++++    ++  Q +      T+   S  D +  +S  + + +   I          D+E    L       +KDD                  SP + VL QEI++YN LL  I   +  L   + G   ++ SLE   + I    VPP W     S+ K L+ W+ ++  R++    W                                           E  +   LF          WL GF  P   +TAV+Q+ AR  + S+D L+    V
Sbjct: 3144 SEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIES-----------SPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKIL-----EASGKLNMDEYNFFLR------------------GGLVLDTKKQMDNPCSHWLSDSNWD--NITELDKLTNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSC---NELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLA-ETSGMGQRFFALSLGQGQAPIATRLI-KEGVANGHWVFLANCHLSLSWMCELDKLVDELQV--QECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQ-----RVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYEEIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFC--------PAVIDTPFFKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPE-LFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPAEI----------DYEGTRKL-------LKDDL-----------------SPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYPSL-KPLASWTRDLCQRVEQFARWA------------------------------------------ETARPPVLF----------WLSGFTFPTGFLTAVLQSSARQNNVSVDTLSWEFSV 4392          

HSP 2 Score: 279.256 bits (713), Expect = 0.000e+0
Identity = 196/780 (25.13%), Postives = 378/780 (48.46%), Query Frame = 1
Query: 6790 TIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFD-HEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIF--IYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            TIY Y+VD     +  ++  +P                   A+N      ++ ++D++RY +L   L+   HPVLL G  G GK+ +                                 Q++L S+ N+                         T+   ++  +SQTS N   + + S++ KR + +  P   KKM++F+DDLN+P +D FGSQ  LE++R WI+   ++D       Y+ D  L+ +  P    ++ IS RL   F ++ +  P+ +  +RI+   I +    ++F  E+K     +    + +Y    +++  +P K HY+FNLR + K+  GLL A       K+ + +   HE  R   DRL+   D E F  +LS++L     + +      K   +FG F         +++Y+ + D + L    E+ +  ++    +   + + F+ +I H+ R +R+++Q  G+ML++G+ G G+ S  ++++ I    +F++ +T  Y    FR DIKK+   + ++N+P V   +D   +V++SF++D+ N+++SG +P+LY+ DEL+ I S L         +  P+ ++  LIE+++  LH+ + +SP    +R+R+R  P+L+NC TIDW+ +W  ++L+ VA              +    +D +     ASIF  ++++  +  ++ ++EL+R  +++  +++E ++ +  +L     +     S+L  GL ++ +TR+ +  M  +L E   K+ E  ++ E
Sbjct: 2430 TIYEYYVDTKNKTWASFEDKLPK--------------GWRYASNAPFYKIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVA--------------------------------QSVLQSLDNI-------------------------TWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDYGFWYDRQKQTLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIYGTMISQKL--QEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFL------RESQIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDT-QIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAE--------RCLDGLSLGSDDGIQTKV-ASIFVTVHQSVAQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCE 3120          

HSP 3 Score: 65.855 bits (159), Expect = 0.000e+0
Identity = 44/121 (36.36%), Postives = 64/121 (52.89%), Query Frame = 2
Query: 13358 VFNIRDNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIP-SFWILRGTAALLQCE 13717
            V  + DN+  ++ P  GVL+ GL+L+ A W+ + S L      +  C +P IH   V S K   ++ Y+  CP Y  P R G   SSG+ S F+  + LKS  +P   WI RGTA L+  +
Sbjct: 4392 VTTVEDNN-LLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKRLAKNMYS--CPCYYYPVRSG---SSGRQS-FVVAVDLKSGAVPYDHWIKRGTALLMSLD 4505          

HSP 4 Score: 567 bits (1460), Expect = 3.243e-164
Identity = 365/1096 (33.30%), Postives = 590/1096 (53.83%), Query Frame = 2
Query: 2258 LDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEA--KKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLD--ETEV-NTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSL-TKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXX-XYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQ------KQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL-----PLINLSKE 5491
            L   P+T+ +  E L+ +  + A++  ++ +   I++ + I+T ++V V    L L + LN      +  V+  +   KK ++  K S  +    E  +     ++  + N  F   + T    L Q+  L+ ++  L  + +N  +    F  ++ + ASK                    D+  +E+D+     +WE   +WE  +  +    L   +TEV +   QT+ +T H +    K     EI+ + K+ + + K  +P+I  LRN  L+ RHW++I + +  +    + +FT+ ++++  +  + + I +IS  A+ E+++E  L  +   +  +   +  H ++    + G D++   LE++ +T+S IK S++V     +V+ WER LS   +V++  +  Q+ W+YLE IF   DI++QL  E   F  V   W+ +M++  +    L+     G+L+ L   N+KLE+IQKSL+ YLE KR IFPR +FLSND+LLEIL ++++PE VQ HL K F N+  L+I+   + + S    + S +GE       + + G  E WL  +E+ +   +K  ++ C + +++      K   DW     GQ ++ ++Q++++ +V+RAL  +   E      + S+    +  L   +  +  ++    R  + A++ ++VH RD    L +        F+W  Q+R  W +    C + Q +++F YG EYLG S RLVITPLTDRCYMT+T AL+ + GG  KGPAGTGKTET+KDL K +G   +V NCS+ LD  ++ ++ SG+ Q G+W CFDEFNR+N+EVLSV+A QI SI +A  +    F FE ++I L   CGIFITMNP YAGR ELPDNL  +FRP++M+VPD  LI E+ LF+EGF   KVL+ K+  LY L   QLS Q HYDFGLR++ S+L   G  R  R  I       V+EE  IL+ ++K  N  +L + DLPLF  I+ DLF   +    +   L+ ++E   ++ G +V P  + K+  L     SRH  M++G + SGKTV    LQ  L+ L     P  NL +E
Sbjct: 1139 LSQPPQTLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAVDPAVLELLEALNAEWVWFQQVVIDSDIMLKKHKDTMK-SGLILSSEEFQKKTQTFLQSFSSNGPF-GSSVTPHSALQQVSELRAQLEALKEEEQNICSGLNIF--TIEQPASK--------------------DILALEKDVDYLQQVWEIARQWEDLWAEWKGGHLASLQTEVMDNTAQTMFKTLHKLSRAFKD-KHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKDKGHHKLRGTDEVFQALEDNQVTLSVIKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWP----GQMLITASQIQWTTDVTRALMTSK--ERADKSALKSLKKKQVSMLNQYSEAIRGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSFEGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDI-------VDEE--ILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRE 2194          

HSP 5 Score: 35.8094 bits (81), Expect = 3.243e-164
Identity = 22/76 (28.95%), Postives = 41/76 (53.95%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQN--VLNDQLSTDNFEKENS--NQNDLQTLLNNEQ 5790
            +NPKA+S+  LYG  N ++ EW +G++  + +   +    ++   V +  + T   E  NS  + N + TL+N E+
Sbjct: 2197 LNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGER 2272          

HSP 6 Score: 111.694 bits (278), Expect = 2.644e-23
Identity = 54/145 (37.24%), Postives = 94/145 (64.83%), Query Frame = 1
Query: 5950 KKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKF-LSKCSKIQIIPNTSKQSQLFTLCCILEAL 6381
            K + +WIV DGP+++ W+E++N+V+DD+++L L NGERI++P  +  LFEV+DL  +SPATVSRC M+Y     + WK  V+SWM+ +      +   + L++LFE+ I   + F  + C ++  I   ++ + + +LC + ++L
Sbjct: 2235 KPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSWMEKR-----QKVETDLLWQLFERYIDKTLAFKKTHCKELVAI---TELNGVASLCRLYQSL 2371          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000008466.1 (dynein axonemal heavy chain 14 [Source:NCBI gene;Acc:100036695])

HSP 1 Score: 890.952 bits (2301), Expect = 0.000e+0
Identity = 468/1100 (42.55%), Postives = 693/1100 (63.00%), Query Frame = 2
Query: 2246 ANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNR--DTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINLSK--EKMIVKKMKCLETFN 5533
            + + L+ D + VEEFVEHL F+ +I++E+ S+++E  +I Q+++I   + + ++ E+ A Y++L  + Q+LK+ V++ EAKKDENI +FS DL+  I ++   +ME K K RN   L  +      L+ +  L  E   L NK R YS+YQERFG  +                   T+  +  ++ E E ++++R LLWE+K EW +    +     +   V+ +++ V+R +HT+ +LEK LP N+++ +++  V + K +LP+++AL NP L+ RHW  I+   G S+ K KNFT+  L+  KI  +K  I+E S  A NE TLE ML KV  ++   E +L  H +   + WI+   +++   +EES + +ST+KGS+YV  I+  V++W+RKLS   + ++E + CQ++WLYLEQIF   DIQRQLP E  LF +VD  W+ +M+  KE+P  L+     G+L++LQ  N+ LEKI K LED+LE+KR +FPR +FLSN++LL ILS +++P+ VQ HL K F N+  L I         +  + S EGE   +P NIR+RG  EQWL  +E  +F+                                 +Q+ FS++  R+   + DPE    L    + ++L+++L  LA    +  + +++  LEA++ + VH RD    L++  V    DFEW +Q+RY WNE +  C   Q ++ F YG EYLGCS RLVITPLTDRC++T+TGAL+ +LGG   GPAGTGKTET+KDL+K +G+ CVVFNCS+ LD   + K  SG+ Q G+WCCFDEFNR+++EVLSVIA+QI++IK AKDS+  RF+FE +E++LN  CG+FITMNP Y GRVELPDNL  LFRPVAMMVPDY LI E++LFSEGF  AK LS K+ NLY+L + QLS Q HYDFG+R+IK+VL++ G  + +  L  + V+L+  +E  I+I+A+K +N P+ + +D+PLF++IM DLF        N K LE++I L+  ELG + W  Q+EK+   ++Q+ +RHGVML+GP+  GKT +R IL+KAL +L      +   K ++KK K +ETF 
Sbjct:  248 SQRKLNKDLRGVEEFVEHLTFLGQISSEVPSLEREYSTIVQLYSIAKEYNMAISPEETAHYQSLIPSFQQLKSAVLFCEAKKDENIVRFSGDLDTYISQLHSELMEFKVKVRNPLLLQGDIFPREALEMITNLLEEFEVLANKARCYSSYQERFGRVI-------------------TSETVNAELSEAESNLNLRKLLWESKEEWVKLSTEWKQTAFELLNVDVIQRDVNRFSHTLFILEKGLPVNKVVASLRESVMDFKQNLPIVVALSNPCLKPRHWDTIQFTTGRSIPKEKNFTLENLLELKIFHHKDKIIETSTTATNEATLEGMLNKVISLWNKTELKLTPHKSELSEIWIVACAEEVVGQIEESQVIVSTVKGSRYVAPIKNAVDEWDRKLSLFLRTMEELMICQRNWLYLEQIFLASDIQRQLPAEANLFFQVDSSWKEIMENIKERPSALRAAIAPGLLEVLQNNNAHLEKILKCLEDFLEIKRKVFPRFYFLSNEDLLAILSESKNPDVVQPHLVKCFENIRHLDITFPMKSPPVVAMIRSAEGETIHMPNNIRIRGPVEQWLGNVESSMFD--------------------------------ISQIMFSKDCVRSFH-SADPEKELRL----VHANLVEHLGQLADMALDIPLLHQKTTLEALLTLYVHCRDVLAELIKKRVSKSDDFEWTRQLRYQWNENNKTCYAVQGNATFHYGYEYLGCSSRLVITPLTDRCWLTLTGALHLHLGGSPAGPAGTGKTETVKDLAKALGKHCVVFNCSEGLDYKMMGKFFSGMAQSGAWCCFDEFNRIDIEVLSVIASQIHAIKTAKDSQVMRFVFEGREMRLNMSCGVFITMNPGYKGRVELPDNLKSLFRPVAMMVPDYQLIAEIMLFSEGFKAAKSLSGKLVNLYQLASKQLSQQNHYDFGMRAIKTVLVMAGQKKQDLELGGQHVRLSPADESLIIIRALKEANLPKFLAEDVPLFENIMADLFPGVVIEKANTKRLEKAISLASHELGLQPWETQVEKVIQFHNQIAARHGVMLVGPAGGGKTTVRRILEKALVYLTSSAFRQCYTKHLLKKGK-VETFT 1290          

HSP 2 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 453/1302 (34.79%), Postives = 705/1302 (54.15%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDE---------------------INKEIGENVSISPE-----TKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMR--YSLEESDNRIG---QKQWATFIKLHTTSSVYGENLKAFDSTGQI--IKQPDN----IEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDM----------------SSYNFKE-------FSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIY--NNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFL-TNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLI-GHLTDFQSINSFIHSNDCA--------VEKLEN-----LLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETV 12875
            ET+ V+ Y+ +  ++L  V P L+ ++ ALD+L+K  ISEV+VY +PP LV  VMNAVCVLL   P W  AKLLLGD  FL++L+  +KD+I +K +  L++Y+   +FNP+ VG VS ACRS+CQWVLA+EHYH V  M+ PK+K V EA+ AL +++++L  KQ  L  V D + +          E++ L +R +LT ERL RAA LI A+  EK RW  S+   D A + IIG  + SAA+  + G +T  YRE    +W++  G+  IP+  +Y  +    S   +  W N GLP D    EN  +++   +WPL IDP  Q  +++     +  R +     +Y+ ++E A+R+G+ + L+D+   +DP L P+L KE FRR     IK+G++E+EY+  F+LY+ +   +P  + +V  +VT+INFTV   GL +QLLS +V+ E+P +E +R   L + A D  +LR LE+K+L LLQ +   +++D +L  NL+KSK+ + D+ KR+E++ + E  ++ AR  YLP+A RGA +YFV+A+L  +NYMYQ+SL WF  +F E ++                       +++ G    IS +     +++  IID++T   Y + S  LF+ H+  F+FML+  IMR   S E S + +G     +W  F+     ++  G    +  + G++  I+  D      EWL+   W +C++L   L   F+ LC S   + + W  +   E  +                   S N +E       F  + L++F+KLILI +L    LI + R ++   +G K+      NL     ES+A  P++FIL +  DP+  + +L +E RG+T +LD+VS+GRGQ  KAE LI      KGRW+FLQNC L  S+MP L ++           D  F+L LS+ P   FP+ ILQ   K+A+E P G+K +LL++F   GTG +TE I+  +++    +K++F+LC FNA+V ERR YG+LG+++ Y+F  SDLE+S++ +   +  +NEV W A+H + G + YGGR+TD  DRRCL+ +L  +               +P VL  GH   F S   +    D A        +E L +     + G+  NAE   L++Q+               ED    ++ S L ++  I N +P++VE    +  G     D    + L   L +   +  +R  K  +        +S    VL QE  ++N+LL  IH  +  L   + G   +T+ LE V
Sbjct: 2265 ETKIVQVYAEQAVQELNEVLPALQEAVSALDALDKGDISEVKVYTHPPFLVLTVMNAVCVLLQQKPDWPTAKLLLGDPGFLKRLVGLDKDSIPEKAFLKLKKYSKTPEFNPQKVGMVSSACRSLCQWVLALEHYHDVKKMVTPKQKHVAEAQGALGLAQERLRHKQRSLAMVRDFLHSC-----CYASERQLLAQRKQLTTERLQRAAVLISALAEEKIRWKESVDRLDLAMEGIIGDTLVSAAFIAYCGVFTSEYREKLVAEWLEGCGSYRIPLSADYSIIRAMASESEVRQWQNEGLPLDPYSTENAILVKNGHRWPLFIDPHGQACKWICQMEGNELRQVRAADGNYLQVMENAMRLGEAVLLQDVAEDLDPSLKPILGKEIFRRAGQDFIKIGDSEIEYNQHFRLYMTTQAPDPYFLPAVCIMVTMINFTVTFKGLRDQLLSSVVTHEQPHLEQQRCHLLESIAADACTLRELEEKSLSLLQKTQGHLLDDEDLIDNLKKSKLKSKDVVKRIEDSAKTEATIEAARGTYLPVARRGAILYFVVANLIRLNYMYQFSLQWFHRVFVESMEAAQAPTSLVSPESIRALSRHKGTDRQTGPKEDISTDCDGRKSRINNIIDTLTGNVYKIVSSALFTEHQLCFSFMLTVGIMRNVGSGEPSGHSLGFLPSAEWEFFLHSRLLANTVGRKADS-QAAGKLDEIRDEDPGCHIPEWLSEPTWRQCQYLSRTLA-PFAQLCQSLTSSSQQWGSFRSREGLYGFLSESYVPSQQGKGWGQPSANTEELPSEPVIFKWEELSAFQKLILIKVLLPEGLIRAVREFIAEKMGMKYVQSGGVNLKETLEESNASCPLIFILSSGIDPVGQLERLALETRGSTLHLDMVSLGRGQGAKAEELIHNALRLKGRWVFLQNCHLAASFMPRLSEI-------SSTADPQFRLWLSSKPDPSFPVPILQRGFKMAVEPPQGLKGKLLQTFDSSGTGAITERIFERDDRGASWKKLLFSLCFFNAIVNERRKYGALGWNILYEFTPSDLEVSVQMLGALMEGHNEVPWQAVHYLTGEVVYGGRVTDLWDRRCLLSILDKF--------------YTPAVLQEGH--SFSSCKVYRSLPDGATLGECRAYLESLPDTDSPEIFGMHPNAERANLQSQAAG-------------ED----EAPSVLQIISNIRNALPQTVEGKPPEG-GAAQGTDTNMTLSLL--LSDPRWETLVRATKGFDP-----LINSALLTVLRQETDRFNHLLSVIHGSLHALQRAIKGEIILTKQLEEV 3511          

HSP 3 Score: 146.747 bits (369), Expect = 0.000e+0
Identity = 94/297 (31.65%), Postives = 170/297 (57.24%), Query Frame = 1
Query: 8242 IGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDL-VNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDV--YFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHN---LTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            +G++G GK ++  ++S I  C ++RL++T  Y++  FR ++KKV  ++ L  R  V+ L+  D + V DSF++DL  L+NSG +PDL+E +EL+ +L         +  +   N +   F   +++Q  LHV + LSP  S +R   R++PSL+NCCTIDWY +W  E+L++VA                T +E+ + N    +   + I+++  +   Q+  E RR Y+++  +++ F+N F  IL +      ++R+R   GL++L+     I  M+++L+ L P+I++K++E E
Sbjct: 1960 VGLDGTGKVTSASMASYIAECQLYRLSITQTYSHGDFREELKKVFKQTGLLGRSTVLLLTGADIVQVRDSFLEDLNCLLNSGEVPDLFEKEELDGLLH--------TAYIFCINALLCLFPCAQRVQYKLHVVLALSPVGSTFREHCRSHPSLVNCCTIDWYDEWPEEALLNVAR-------------SYTLQEELLQNSEVRSTMCVNIHKSVSQRAAQYLRETRRHYYVTPQNYLGFINTFSKILHSKKQNILTDRNRFFTGLSKLLGAADSIETMQQELVALGPQIEQKTQEIE 2235          

HSP 4 Score: 44.2838 bits (103), Expect = 0.000e+0
Identity = 16/49 (32.65%), Postives = 30/49 (61.22%), Query Frame = 1
Query: 5554 AKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQ 5700
             K++   +NPK +++  LYG VNPN++EW +G++    + +    +K Q
Sbjct: 1284 GKVETFTINPKCVTLGELYGEVNPNTMEWTDGLLASAVRTVSQQQSKVQ 1332          

HSP 5 Score: 340.117 bits (871), Expect = 3.216e-92
Identity = 226/686 (32.94%), Postives = 337/686 (49.13%), Query Frame = 1
Query: 5947 SKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPF----IQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSAD------IEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELH 7968
            S  +W WIVLDGP+++ WVENLNTVLDD++ LCLAN ERI +P  ++ +FEVD L  +SPATVSRCAM+Y+    + WK  VK+W+ NQ+    P +G ++L  LF  S+  G++F+ K  K+Q  P   +   + TLC ILEA          F  + L            K + S  P +   + P     I + +  + FL+K P++L  LLGKLYVFA+TW+FG  F R+++ E ++ I     K    ++    ++F  FV+ +F  +  +GI++PL   +++SYFVD+  G F PW  LVPS  +LI   G  S SS I  +             +  ++ L AL++L   P  +A        +L   I         S  +    I GKI            ++ N   FS   D        D  I       + T   I S+++  + T+  +    + +K++K+ +D +G PK+KK+ +FIDDLN+P  +++G+Q  LE +RQ+++L GF+D  +L W  V D +L+ AC+P    ++ IS RL KHFC+  LP PS  A Q IFQV                  L  ++    SV   T+ +   + L +H     RV H                                 DRL    DRE FF+ LSDELH
Sbjct: 1369 SIHDWNWIVLDGPVDTVWVENLNTVLDDTRTLCLANSERIQLPQGMRIIFEVDSLSQASPATVSRCAMVYMDPVDLGWKPFVKTWL-NQISAKVPHAGVQYLESLFTMSVPEGLQFIHKHWKLQPFP-VQELGVVMTLCKILEA----------FTFIRL------------KTHRSEMPLESPVERPLHHFVILRLHKSMWFLEKYPEKLVPLLGKLYVFAFTWAFGGVFKREDEHEGDSLIGL---KVRDEALVNLTNDFSSFVRDMFAGDQRSGIQMPLGEDSVFSYFVDLQTGNFVPWHYLVPSTDSLIQ-RGESSLSSPIIIHYTYTHT---YMYYTGAHTVLGALIILRRMPFFVA-------EVLCVPI---------SHHTYPHKIYGKI-----------QTLYNYIYFSFGLDGSLIGVGADGWISARDQGYLRTSRLIVSTVQLGANTTSARIQAQIQNKLMKKSRDTLGAPKHKKVAVFIDDLNMPVPEQYGAQPPLEFLRQFLDLGGFYDTQTLTWKNVQDLALLAACAPPGGGRNEISPRLLKHFCLFVLPHPSVPALQHIFQV------------------LQGLLQASESV---TVTRDSAALLLAHE--ATRVFH---------------------------------DRLTQAADREQFFQFLSDELH 1940          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Xenopus
Match: asxl2 (ASXL transcriptional regulator 2 [Source:Xenbase;Acc:XB-GENE-996283])

HSP 1 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 431/1158 (37.22%), Postives = 659/1158 (56.91%), Query Frame = 2
Query: 2027 IDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKN-FTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXX-------XXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLEND-KLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            +D F + L +  ++  D     + + IG + +  K L +   P  ++ +  +N+ L   A    D  I     A   L + P T  ++V  L F+++I   +  +++E   ++ M+ +I N+KVP   E  A+Y TL  +I  ++N +     ++D +I KF   L+K I E+   + E+++  ++   LD    Q  +   L  L   + +L      Y  YQ+ F   ++K                       E +EEV  ++ ++ LLW++ +EW+   + ++    +  +   V   V +       LEK LP N ++P +K  V   K  +PVI  LRNP L+ RHW  +E+ I  +L   ++  ++ +LI      Y Q I +IS  A+ E +LE ++ KV+D +   EF  + H + +D +I+ G DDI V L++S + ISTI  S+YV  I+++V++W+R+LS   + LDEW+ CQ++WLYLE IF   DIQRQLP E ++F +VD  W+ +M++    P  L+  T+ G+L+  Q  N+ L++IQK LE YLE KR +FPR +FLSNDELLEIL++ ++P+ VQ HL K F ++ KL+   S  +             ++S EGE   L + ++ RG  E WL  +E+ +F  ++R  K  + + + K  V+W +     Q +L  +Q+ + +++S  L+G  +     L     +     + L  LA  V   + +  R  + A+I I VH RD    L+++ V S   FEW++Q+RY W+     C      S + Y  EYLG  PRLVITPLTDRCY+ + GAL  +LGG   GPAGTGKTET KDL+K +  QCVVFNCSD LD   + +  SG+ Q G+WCCFDEFNR+++EVLSVIA Q+ +I+ AK S+  RF+FE +EIKL   C  FITMNP YAGR ELPDNL  LFRP +MMVP+Y LI EVIL+SEGF ++KVL+ K+T +Y+LC++QLS Q HYDFG+R++KSVL++ G L+ E          N+NE++ +LI+A++ SN P+ +TDD  LF  I+ DLF     + E+D   L+ +I  +    G +  P  ++K+  L   +  RHGVML+GP+  GKT +  IL  AL  L
Sbjct:  622 VDFFAEKLEKYNKEHNDALAITQNRNIGLLLIDAKKLKEKLIPSPKRCLEAINDMLPILAKKKTDAVIAEALDAQFKLQSLPTTTIDYVNSLIFLDEIQERIEVLEEECNIVSHMYQLIDNYKVPTPPEDFAVYATLQPSITAVRNAIDKSVGERDGSIEKFCHSLDKDIAELNKEVKEVRQ--KDPQILDLAADQVKVKQILADLHTVLNELQTCAFQYKTYQKNFKVEVTK----------------------YEALEEVCAEVKLKQLLWDSLAEWDVLQDEWMQSNFEALDPEQVNSLVLKYAKFATQLEKGLPPNNVVPLLKEKVENMKEKVPVITDLRNPFLKPRHWAALEQTINAALIDTEHPLSLQKLIEIHAFDYAQAIQDISGQASGEASLETIIKKVEDSWKATEFTAIPHRDSKDVFILGGTDDIQVLLDDSIINISTIASSRYVGPIKSRVDEWQRQLSLFNETLDEWLTCQRNWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLESFQNNNALLDQIQKCLEAYLESKRAVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSIAKLEFAVSPGEGEQEVVFTNDILAMLSPEGEKVNLGKGLKARGNVEDWLGKVEEAMFASLRRLSKAAIADYQNKTRVEWVVAGHPSQVVLTISQLMWCRDLSHCLEGECEDNLHSLAEFEKVN---FERLNALAGLVRGHLPTLHRNIITALITIDVHARDIVSDLVKDKVDSIESFEWQRQLRYYWDLDLDNCVARMALSQYTYAYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKASKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFSMMVPNYALIAEVILYSEGFESSKVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENP--------NLNEDV-VLIRALRDSNLPKFLTDDAELFSGIISDLFPGV-HIPEHDYGTLQSTIINAMINRGLQPVPSMVDKVIQLFETMIVRHGVMLVGPTGGGKTTVYQILADALGTL 1742          

HSP 2 Score: 461.07 bits (1185), Expect = 0.000e+0
Identity = 246/649 (37.90%), Postives = 383/649 (59.01%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTF-KDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIK 11144
            ET+A+ +     + DL    P LEA+ KALDSL+KA ISE+RV+  PP LV  VM A+C+LL+  P W+ AK LLGD+NFL++LL Y+K+ I  ++   LQ+Y    DF PE V  VS ACRS+C WV A++ Y  V   + PK++ +  A+  L+ +   L  KQ +LK VE+ IK L ++Y  S+ E++ L + + LT  RL RA  L  A+  E+ RW  SI + ++   N+IG+   +AA   + G +T VYR++    WI+      IPI  N+  +     AY I  W+ +GLPRD    EN  ++ + ++WPL+IDPQ Q  R+++    K+  +VI      ++  LE AIR+G  + LE+++  +DP L P+L K+ F  G  T+I+LG+++++Y  +F+ Y+ + + NP  +  V   VTIINFTV   GLE+QLLS +V  E+P++E +RN+ +    +D   L+ +ED+ L LL  S   I+++ +L   L++SKIT+  IK RL E    E+ +  AR+ Y P+A +G+ IYFV+A L  ++ MYQYSL +F+ LF   ++   K      S   + +L  ++    + +Y   S GLF  H+ +++FML   IMR+  E     I + +W  F++
Sbjct: 2710 ETQAIAD---DAQRDLDEAMPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAICILLNAKPDWSAAKQLLGDSNFLKRLLEYDKENIKPQILLKLQKYVNNPDFVPEKVEKVSKACRSMCMWVRAMDLYSRVLKDVEPKKQKLAAAQAELDATMSTLRDKQQKLKSVEEQIKALQDQYDKSLSEKESLAKTMALTQARLNRAGKLTSALGDEQVRWKESIANFEEEISNVIGNVFIAAACVAYFGAFTAVYRQLLVDCWINKCQELEIPISPNFSLINILGDAYEIRQWNTDGLPRDHISTENGILVTRGRRWPLMIDPQDQANRWIRNKENKNGLKVIKLTDAGFLRTLENAIRLGLPVLLEELKETLDPALEPILSKQTFTSGGRTLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTRSGLEDQLLSDVVRIERPDLEEQRNQLIIRINSDKNQLKAIEDRILKLLFTSEGNILDNEDLINTLQESKITSGAIKTRLLEAEATEENINTAREKYRPVATQGSVIYFVIASLSEIDPMYQYSLKYFKQLFNMTIEAAEK------SNDLDIRLATLLSQTLFSAYTNVSRGLFEQHKLIYSFMLCVEIMRHKGE-----ISETEWNFFLR 3344          

HSP 3 Score: 434.491 bits (1116), Expect = 0.000e+0
Identity = 294/1055 (27.87%), Postives = 513/1055 (48.63%), Query Frame = 1
Query: 5947 SKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLS-KCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKS 9102
            + K+ +WI+ DGP+++ W+EN+NTVLDD+++LCLAN ERI     +  +FEV DLK +SPATVSRC M+Y+  + + W   V++W+   L         E++  LF++ ++ G+KF++ KC  +Q I     Q  +  +  +   L   L   GG D                                           LQ +P  LN+++ + +VF Y WS G                               D FD FV+  F++N E   +LP ++  ++S ++D D     PW+ ++PS K                +NN      ++ + D++RY +L   L+   H VL  G +G+GKS++                                 + LL+ IQ                E++ YVP      +Y  I F++QTS ++  + + SK+ K+ + I+G P NK++++F+DDLN+P +D +GSQ  +E++RQ+ +  GF+D   + W  + D ++  AC+P    ++P++ R  +HF +L LP PS ++ ++IFQ  +  +    DF   +K   T+IVD  + +Y +       +P KSHY+FNLR L K + G+L  D   V +K  + +   HE  R  HDRLI++ D++ F ++LS+       +    +      I+FG F  + G   + KVY+ +TD+EK+    +  ++ ++  +      +FF+ +++H+ R  R++ Q  G+ L++GV G GK S  ++++ I G   F++ ++  YN  SF  D++K+   + ++++  V   +D    V+       C            E  +L  ++S+       S S      V+   I ++++ LH+ + +SP    +R+R R  PSL+NCCTIDW++ W  E+L+SV+          F I I+   E      +E  + I+ +   +  ++  ELRR Y+ +   ++E +N +  +L     +  S R R+  GL++L+ET  L+ KMK +L  L P +K+KS
Sbjct: 1797 TSKDHKWIICDGPVDALWIENMNTVLDDNKMLCLANSERIKFTPQIHMVFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWISG-LSAKVSVCIAEYVLALFDRYVEDGLKFVNKKC--VQAI----SQVDISKVTTLCCLLESLLLGKGGPD-------------------------------------------LQMDPSRLNSIVCQTFVFCYLWSVGGNLTEN-----------------------YWDAFDTFVRQQFEDNPEA--KLP-NSGDLWSVYMDYDTKRLDPWERIIPSFKY---------------SNNVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVVA--------------------------------RGLLNRIQ----------------EEAGYVP------VY--INFSAQTSSSRTQEIIESKLEKKRKTILGAPGNKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDVTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSEHSLKQIFQSILNGFL--ADFPEAVKQAATNIVDAAVEIYHRMSIDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGSVRDKTQIFRLFCHECQRIFHDRLINNEDKQYFHEMLSEMASKHFAVQIDPEYFVTKPIIFGDFTKV-GVDKADKVYEDLTDMEKIKSVLQDYLDDYNLTNAKDVKLVFFQDAVEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCFQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQ--VSLILQTSTC------------EQGKL--LVSSFSLLPCSSSSYY----VFQYFISRVRQKLHIVLCMSPVGEAFRARCRMFPSLVNCCTIDWFVQWPKEALLSVSQ--------KFFINIDLGSEGMKAKFSEMCVEIHMSVNTMAEKYYSELRRRYYTTPTSYLELINLYLSMLGEKRNQLVSARDRVKNGLSKLLETNVLVDKMKVELSALEPVLKQKS 2673          

HSP 4 Score: 38.5058 bits (88), Expect = 0.000e+0
Identity = 21/81 (25.93%), Postives = 43/81 (53.09%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +   ++NPK++++  LYG VN  +LEW +G++ +  +  ++ ++K+   +      D    EN N     N +  L N+E+
Sbjct: 1755 VKTYILNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSKDHKWIICDGPVDALWIENMNTVLDDNKMLCLANSER 1835          

HSP 5 Score: 205.682 bits (522), Expect = 1.366e-51
Identity = 173/691 (25.04%), Postives = 295/691 (42.69%), Query Frame = 3
Query: 11406 YLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQ--SEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYAS----ENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSAL--DMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLPRNLLGDLEEYFAQSELFDVTKTYSTSEIIPKPCIIQITEFLYLVFI*TMRCGIW 13454
            YL+ F   I++ +  S  ++ +   +V   LG+KF      +L  L+ +     P++FIL   SDP+    +   E RG +  +  +S+G+GQ   AE +I K  +  G WIFLQNC L +SWM  +++LI++        + NF+L LS+ P   FP+ +LQNS+K+  E P G++  + ++F       +T T +       + RK+IF +C F+A+V ER+ +G LG+++ Y+FNDSD E ++  +  +    ++ W+AL  + G I YGGR+TD  D+RCL  +L+ + S    E+N          SP          QS   +I   +  +     + G+ +NA +   + +  + +I+ I+        Q    SN  +  ++   I +K+P  ++  +                 LF      +KD   R N  +               VL QE+ ++N LL  +   ++ L   ++G   ++E +E +      + VP            + WS      +  +G W   ++              S I A    G  K                             +W+ G F PQ  +T  +QN AR  + +ID L     VLP        +Y  Q+ + +  KT    E +P   ++   E   LV    M    W
Sbjct: 3366 YLSIFYARIML-LGHSINVVFAVTEFVINTLGKKFIENPPIDLATLYQDMSPSTPLIFILSTGSDPMGAFQRFAKE-RGYSERVQSISLGQGQGPIAEKMI-KDAMKTGHWIFLQNCHLAVSWMLPMEELIKSFTEPNVSINENFRLFLSSMPSRTFPVTVLQNSVKVTNEPPKGLRANVRRAFT-----EITTTFFEEHLLGRKWRKVIFGICFFHAIVQERKKFGPLGWNICYEFNDSDRECALLNLNLYCQEGKIPWDALLYITGEITYGGRVTDAWDQRCLRTILRRFFSPETLEDNYCYSTSGIYFSPDA-----DSLQSFKDYIE--NLPLTDDPEIFGMHENANLA-FQRKETNTLINTILDVQPRSTTQGGGKSNDEIVRELATSILSKLPDKLDMEVASEM-------------LF------VKDAKGRVNSLTT--------------VLGQEVDRFNKLLKVLKNSLETLNKAIAGLVVMSEEMEKIYKSFLNSQVP------------TLWSDAAYPSLKPLGSWVKDLVMRI-----------SFIDAWIRIGQPK----------------------------SFWISGLFFPQGFLTGTLQNHARKYNLAIDELNFHYNVLP--------QYRDQATVTEAMKTLKFGEELPMDAVLPAPEDGVLVHGMYMDACRW 3948          

HSP 6 Score: 66.2402 bits (160), Expect = 1.827e-9
Identity = 38/111 (34.23%), Postives = 59/111 (53.15%), Query Frame = 2
Query: 13397 PDHGVLVFGLYLDNALWNLENSSL------AINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            P+ GVLV G+Y+D   W+ E   +       +NP+      LP+IH       +N       +  PLY+T +R G LS++G S+NF+  + L S+R   +WI +G+A L Q
Sbjct: 3932 PEDGVLVHGMYMDACRWDDEAMVIEDALPRQMNPM------LPVIHFEP---HQNYNPSGDLYQAPLYKTSARAGTLSTTGHSTNFVVTVLLPSNRQNDYWISKGSALLCQ 4033          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Xenopus
Match: asxl2 (ASXL transcriptional regulator 2 [Source:Xenbase;Acc:XB-GENE-996283])

HSP 1 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 431/1158 (37.22%), Postives = 659/1158 (56.91%), Query Frame = 2
Query: 2027 IDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKN-FTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXX-------XXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLEND-KLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            +D F + L +  ++  D     + + IG + +  K L +   P  ++ +  +N+ L   A    D  I     A   L + P T  ++V  L F+++I   +  +++E   ++ M+ +I N+KVP   E  A+Y TL  +I  ++N +     ++D +I KF   L+K I E+   + E+++  ++   LD    Q  +   L  L   + +L      Y  YQ+ F   ++K                       E +EEV  ++ ++ LLW++ +EW+   + ++    +  +   V   V +       LEK LP N ++P +K  V   K  +PVI  LRNP L+ RHW  +E+ I  +L   ++  ++ +LI      Y Q I +IS  A+ E +LE ++ KV+D +   EF  + H + +D +I+ G DDI V L++S + ISTI  S+YV  I+++V++W+R+LS   + LDEW+ CQ++WLYLE IF   DIQRQLP E ++F +VD  W+ +M++    P  L+  T+ G+L+  Q  N+ L++IQK LE YLE KR +FPR +FLSNDELLEIL++ ++P+ VQ HL K F ++ KL+   S  +             ++S EGE   L + ++ RG  E WL  +E+ +F  ++R  K  + + + K  V+W +     Q +L  +Q+ + +++S  L+G  +     L     +     + L  LA  V   + +  R  + A+I I VH RD    L+++ V S   FEW++Q+RY W+     C      S + Y  EYLG  PRLVITPLTDRCY+ + GAL  +LGG   GPAGTGKTET KDL+K +  QCVVFNCSD LD   + +  SG+ Q G+WCCFDEFNR+++EVLSVIA Q+ +I+ AK S+  RF+FE +EIKL   C  FITMNP YAGR ELPDNL  LFRP +MMVP+Y LI EVIL+SEGF ++KVL+ K+T +Y+LC++QLS Q HYDFG+R++KSVL++ G L+ E          N+NE++ +LI+A++ SN P+ +TDD  LF  I+ DLF     + E+D   L+ +I  +    G +  P  ++K+  L   +  RHGVML+GP+  GKT +  IL  AL  L
Sbjct:  629 VDFFAEKLEKYNKEHNDALAITQNRNIGLLLIDAKKLKEKLIPSPKRCLEAINDMLPILAKKKTDAVIAEALDAQFKLQSLPTTTIDYVNSLIFLDEIQERIEVLEEECNIVSHMYQLIDNYKVPTPPEDFAVYATLQPSITAVRNAIDKSVGERDGSIEKFCHSLDKDIAELNKEVKEVRQ--KDPQILDLAADQVKVKQILADLHTVLNELQTCAFQYKTYQKNFKVEVTK----------------------YEALEEVCAEVKLKQLLWDSLAEWDVLQDEWMQSNFEALDPEQVNSLVLKYAKFATQLEKGLPPNNVVPLLKEKVENMKEKVPVITDLRNPFLKPRHWAALEQTINAALIDTEHPLSLQKLIEIHAFDYAQAIQDISGQASGEASLETIIKKVEDSWKATEFTAIPHRDSKDVFILGGTDDIQVLLDDSIINISTIASSRYVGPIKSRVDEWQRQLSLFNETLDEWLTCQRNWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLESFQNNNALLDQIQKCLEAYLESKRAVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSIAKLEFAVSPGEGEQEVVFTNDILAMLSPEGEKVNLGKGLKARGNVEDWLGKVEEAMFASLRRLSKAAIADYQNKTRVEWVVAGHPSQVVLTISQLMWCRDLSHCLEGECEDNLHSLAEFEKVN---FERLNALAGLVRGHLPTLHRNIITALITIDVHARDIVSDLVKDKVDSIESFEWQRQLRYYWDLDLDNCVARMALSQYTYAYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKASKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFSMMVPNYALIAEVILYSEGFESSKVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENP--------NLNEDV-VLIRALRDSNLPKFLTDDAELFSGIISDLFPGV-HIPEHDYGTLQSTIINAMINRGLQPVPSMVDKVIQLFETMIVRHGVMLVGPTGGGKTTVYQILADALGTL 1749          

HSP 2 Score: 461.07 bits (1185), Expect = 0.000e+0
Identity = 246/649 (37.90%), Postives = 383/649 (59.01%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTF-KDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIK 11144
            ET+A+ +     + DL    P LEA+ KALDSL+KA ISE+RV+  PP LV  VM A+C+LL+  P W+ AK LLGD+NFL++LL Y+K+ I  ++   LQ+Y    DF PE V  VS ACRS+C WV A++ Y  V   + PK++ +  A+  L+ +   L  KQ +LK VE+ IK L ++Y  S+ E++ L + + LT  RL RA  L  A+  E+ RW  SI + ++   N+IG+   +AA   + G +T VYR++    WI+      IPI  N+  +     AY I  W+ +GLPRD    EN  ++ + ++WPL+IDPQ Q  R+++    K+  +VI      ++  LE AIR+G  + LE+++  +DP L P+L K+ F  G  T+I+LG+++++Y  +F+ Y+ + + NP  +  V   VTIINFTV   GLE+QLLS +V  E+P++E +RN+ +    +D   L+ +ED+ L LL  S   I+++ +L   L++SKIT+  IK RL E    E+ +  AR+ Y P+A +G+ IYFV+A L  ++ MYQYSL +F+ LF   ++   K      S   + +L  ++    + +Y   S GLF  H+ +++FML   IMR+  E     I + +W  F++
Sbjct: 2655 ETQAIAD---DAQRDLDEAMPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAICILLNAKPDWSAAKQLLGDSNFLKRLLEYDKENIKPQILLKLQKYVNNPDFVPEKVEKVSKACRSMCMWVRAMDLYSRVLKDVEPKKQKLAAAQAELDATMSTLRDKQQKLKSVEEQIKALQDQYDKSLSEKESLAKTMALTQARLNRAGKLTSALGDEQVRWKESIANFEEEISNVIGNVFIAAACVAYFGAFTAVYRQLLVDCWINKCQELEIPISPNFSLINILGDAYEIRQWNTDGLPRDHISTENGILVTRGRRWPLMIDPQDQANRWIRNKENKNGLKVIKLTDAGFLRTLENAIRLGLPVLLEELKETLDPALEPILSKQTFTSGGRTLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTRSGLEDQLLSDVVRIERPDLEEQRNQLIIRINSDKNQLKAIEDRILKLLFTSEGNILDNEDLINTLQESKITSGAIKTRLLEAEATEENINTAREKYRPVATQGSVIYFVIASLSEIDPMYQYSLKYFKQLFNMTIEAAEK------SNDLDIRLATLLSQTLFSAYTNVSRGLFEQHKLIYSFMLCVEIMRHKGE-----ISETEWNFFLR 3289          

HSP 3 Score: 340.117 bits (871), Expect = 0.000e+0
Identity = 232/849 (27.33%), Postives = 416/849 (49.00%), Query Frame = 1
Query: 6562 ELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKS 9102
            +LN+++ + +VF Y WS G                               D FD FV+  F++N E   +LP ++  ++S ++D D     PW+ ++PS K                +NN      ++ + D++RY +L   L+   H VL  G +G+GKS++                                 + LL+ IQ                E++ YVP      +Y  I F++QTS ++  + + SK+ K+ + I+G P NK++++F+DDLN+P +D +GSQ  +E++RQ+ +  GF+D   + W  + D ++  AC+P    ++P++ R  +HF +L LP PS ++ ++IFQ  +  +    DF   +K   T+IVD  + +Y +       +P KSHY+FNLR L K + G+L  D   V +K  + +   HE  R  HDRLI++ D++ F ++LS+       +    +      I+FG F  + G   + KVY+ +TD+EK+    +  ++ ++  +      +FF+ +++H+ R  R++ Q  G+ L++GV G GK S  ++++ I G   F++ ++  YN  SF  D++K+   + ++++  V   +D    V+       C            E  +L  ++S+       S S      V+   I ++++ LH+ + +SP    +R+R R  PSL+NCCTIDW++ W  E+L+SV+          F I I+   E      +E  + I+ +   +  ++  ELRR Y+ +   ++E +N +  +L     +  S R R+  GL++L+ET  L+ KMK +L  L P +K+KS
Sbjct: 1898 KLNSIVCQTFVFCYLWSVGGNLTEN-----------------------YWDAFDTFVRQQFEDNPEA--KLP-NSGDLWSVYMDYDTKRLDPWERIIPSFKY---------------SNNVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVVA--------------------------------RGLLNRIQ----------------EEAGYVP------VY--INFSAQTSSSRTQEIIESKLEKKRKTILGAPGNKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDVTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSEHSLKQIFQSILNGFL--ADFPEAVKQAATNIVDAAVEIYHRMSIDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGSVRDKTQIFRLFCHECQRIFHDRLINNEDKQYFHEMLSEMASKHFAVQIDPEYFVTKPIIFGDFTKV-GVDKADKVYEDLTDMEKIKSVLQDYLDDYNLTNAKDVKLVFFQDAVEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCFQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQ--VSLILQTSTC------------EQGKL--LVSSFSLLPCSSSSYY----VFQYFISRVRQKLHIVLCMSPVGEAFRARCRMFPSLVNCCTIDWFVQWPKEALLSVSQ--------KFFINIDLGSEGMKAKFSEMCVEIHMSVNTMAEKYYSELRRRYYTTPTSYLELINLYLSMLGEKRNQLVSARDRVKNGLSKLLETNVLVDKMKVELSALEPVLKQKS 2618          

HSP 4 Score: 38.5058 bits (88), Expect = 0.000e+0
Identity = 21/81 (25.93%), Postives = 43/81 (53.09%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +   ++NPK++++  LYG VN  +LEW +G++ +  +  ++ ++K+   +      D    EN N     N +  L N+E+
Sbjct: 1762 VKTYILNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSKDHKWIICDGPVDALWIENMNTVLDDNKMLCLANSER 1842          

HSP 5 Score: 205.682 bits (522), Expect = 1.569e-51
Identity = 173/691 (25.04%), Postives = 295/691 (42.69%), Query Frame = 3
Query: 11406 YLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQ--SEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYAS----ENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSAL--DMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLPRNLLGDLEEYFAQSELFDVTKTYSTSEIIPKPCIIQITEFLYLVFI*TMRCGIW 13454
            YL+ F   I++ +  S  ++ +   +V   LG+KF      +L  L+ +     P++FIL   SDP+    +   E RG +  +  +S+G+GQ   AE +I K  +  G WIFLQNC L +SWM  +++LI++        + NF+L LS+ P   FP+ +LQNS+K+  E P G++  + ++F       +T T +       + RK+IF +C F+A+V ER+ +G LG+++ Y+FNDSD E ++  +  +    ++ W+AL  + G I YGGR+TD  D+RCL  +L+ + S    E+N          SP          QS   +I   +  +     + G+ +NA +   + +  + +I+ I+        Q    SN  +  ++   I +K+P  ++  +                 LF      +KD   R N  +               VL QE+ ++N LL  +   ++ L   ++G   ++E +E +      + VP            + WS      +  +G W   ++              S I A    G  K                             +W+ G F PQ  +T  +QN AR  + +ID L     VLP        +Y  Q+ + +  KT    E +P   ++   E   LV    M    W
Sbjct: 3311 YLSIFYARIML-LGHSINVVFAVTEFVINTLGKKFIENPPIDLATLYQDMSPSTPLIFILSTGSDPMGAFQRFAKE-RGYSERVQSISLGQGQGPIAEKMI-KDAMKTGHWIFLQNCHLAVSWMLPMEELIKSFTEPNVSINENFRLFLSSMPSRTFPVTVLQNSVKVTNEPPKGLRANVRRAFT-----EITTTFFEEHLLGRKWRKVIFGICFFHAIVQERKKFGPLGWNICYEFNDSDRECALLNLNLYCQEGKIPWDALLYITGEITYGGRVTDAWDQRCLRTILRRFFSPETLEDNYCYSTSGIYFSPDA-----DSLQSFKDYIE--NLPLTDDPEIFGMHENANLA-FQRKETNTLINTILDVQPRSTTQGGGKSNDEIVRELATSILSKLPDKLDMEVASEM-------------LF------VKDAKGRVNSLTT--------------VLGQEVDRFNKLLKVLKNSLETLNKAIAGLVVMSEEMEKIYKSFLNSQVP------------TLWSDAAYPSLKPLGSWVKDLVMRI-----------SFIDAWIRIGQPK----------------------------SFWISGLFFPQGFLTGTLQNHARKYNLAIDELNFHYNVLP--------QYRDQATVTEAMKTLKFGEELPMDAVLPAPEDGVLVHGMYMDACRW 3893          

HSP 6 Score: 72.0182 bits (175), Expect = 4.009e-11
Identity = 29/57 (50.88%), Postives = 43/57 (75.44%), Query Frame = 1
Query: 5947 SKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKN 6117
            + K+ +WI+ DGP+++ W+EN+NTVLDD+++LCLAN ERI     +  +FEV  LKN
Sbjct: 1804 TSKDHKWIICDGPVDALWIENMNTVLDDNKMLCLANSERIKFTPQIHMVFEVKFLKN 1860          

HSP 7 Score: 66.2402 bits (160), Expect = 1.871e-9
Identity = 36/105 (34.29%), Postives = 56/105 (53.33%), Query Frame = 2
Query: 13397 PDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            P+ GVLV G+Y+D   W+ E   +      +    LP+IH       +N       +  PLY+T +R G LS++G S+NF+  + L S+R   +WI +G+A L Q
Sbjct: 3877 PEDGVLVHGMYMDACRWDDEAMVIEDALPRQMNPMLPVIHFEP---HQNYNPSGDLYQAPLYKTSARAGTLSTTGHSTNFVVTVLLPSNRQNDYWISKGSALLCQ 3978          

HSP 8 Score: 55.8398 bits (133), Expect = 2.446e-6
Identity = 54/236 (22.88%), Postives = 98/236 (41.53%), Query Frame = 2
Query:  545 NENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTC-------QNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESI 1231
            +EN ++ I+        + +W  E +    L  + TF  FR WKAF  WR N+   ++ + R  L  NL  ++   +  +  +    +++  RIS        ++ +  I+   TY+L EF  NQL Q+   + N   V  T+      TC        + T    +S  L           SS    +TE+   R   + +  F++L D  +V   H +   +++    ++VE +
Sbjct:  235 SENGVTHISDGEVLYLEIERWKQEYLYHKALKQIPTFALFRKWKAFTVWRKNVRAKRINECRKALQENLFIVNEYLRPAILNI----QEMCYRIS--------DMGLCRIEKEYTYSLHEFTGNQLKQLE--EVNYKSVLITLCVIKAVTCFMCSVRFLSMTAGPAVSDMLLPHLDGELFGESSDKMTYTEQANKRAHCRRLTCFIRLADYLIVNTMHILAVNSVNTLLMYLVEKL 456          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Xenopus
Match: asxl2 (ASXL transcriptional regulator 2 [Source:Xenbase;Acc:XB-GENE-996283])

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 406/1158 (35.06%), Postives = 629/1158 (54.32%), Query Frame = 2
Query: 2027 IDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKN-FTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXX-------XXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLEND-KLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            +D F + L +  ++  D     + + IG + +  K L +   P  ++ +  +N+ L   A    D  I     A   L + P T  ++V  L F+++I   +  +++E   ++ M+ +I N+KVP   E  A+Y TL  +I  ++N +     ++D +I KF   L+K I E+   + E+++  ++   LD    Q  +   L  L   + +L      Y  YQ+ F   ++K                       E +EEV  ++ ++ LLW++ +EW+   + ++    +  +   V   V +       LEK LP N ++P +K  V   K  +PVI  LRNP L+ RHW  +E+ I  +L   ++  ++ +LI      Y Q I +IS  A+ E +LE ++ KV+D +   EF  + H + +D +I+ G DDI V L++S + ISTI  S+YV  I+++V++W+R+LS   + LDEW+ CQ++WLYLE IF   DIQRQLP E ++F +VD  W+ +M++    P  L+  T+ G+L+  Q  N+ L++IQK LE YLE KR +FPR +FLSNDELLEIL++ ++P+ VQ HL K F ++ KL+   S  +             ++S EGE   L + ++ RG  E WL  +E+ +F  ++R  K  + + + K  V+W +     Q +L  +Q+ + +++S  L+G  +     L     +     + L  LA  V   + +  R  + A+I I VH RD    L+++                                                     DRCY+ + GAL  +LGG   GPAGTGKTET KDL+K +  QCVVFNCSD LD   + +  SG+ Q G+WCCFDEFNR+++EVLSVIA Q+ +I+ AK S+  RF+FE +EIKL   C  FITMNP YAGR ELPDNL  LFRP +MMVP+Y LI EVIL+SEGF ++KVL+ K+T +Y+LC++QLS Q HYDFG+R++KSVL++ G L+ E          N+NE++ +LI+A++ SN P+ +TDD  LF  I+ DLF     + E+D   L+ +I  +    G +  P  ++K+  L   +  RHGVML+GP+  GKT +  IL  AL  L
Sbjct:  629 VDFFAEKLEKYNKEHNDALAITQNRNIGLLLIDAKKLKEKLIPSPKRCLEAINDMLPILAKKKTDAVIAEALDAQFKLQSLPTTTIDYVNSLIFLDEIQERIEVLEEECNIVSHMYQLIDNYKVPTPPEDFAVYATLQPSITAVRNAIDKSVGERDGSIEKFCHSLDKDIAELNKEVKEVRQ--KDPQILDLAADQVKVKQILADLHTVLNELQTCAFQYKTYQKNFKVEVTK----------------------YEALEEVCAEVKLKQLLWDSLAEWDVLQDEWMQSNFEALDPEQVNSLVLKYAKFATQLEKGLPPNNVVPLLKEKVENMKEKVPVITDLRNPFLKPRHWAALEQTINAALIDTEHPLSLQKLIEIHAFDYAQAIQDISGQASGEASLETIIKKVEDSWKATEFTAIPHRDSKDVFILGGTDDIQVLLDDSIINISTIASSRYVGPIKSRVDEWQRQLSLFNETLDEWLTCQRNWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLESFQNNNALLDQIQKCLEAYLESKRAVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSIAKLEFAVSPGEGEQEVVFTNDILAMLSPEGEKVNLGKGLKARGNVEDWLGKVEEAMFASLRRLSKAAIADYQNKTRVEWVVAGHPSQVVLTISQLMWCRDLSHCLEGECEDNLHSLAEFEKVN---FERLNALAGLVRGHLPTLHRNIITALITIDVHARDIVSDLVKD----------------------------------------------------KDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKASKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFSMMVPNYALIAEVILYSEGFESSKVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENP--------NLNEDV-VLIRALRDSNLPKFLTDDAELFSGIISDLFPGV-HIPEHDYGTLQSTIINAMINRGLQPVPSMVDKVIQLFETMIVRHGVMLVGPTGGGKTTVYQILADALGTL 1697          

HSP 2 Score: 461.84 bits (1187), Expect = 0.000e+0
Identity = 246/649 (37.90%), Postives = 383/649 (59.01%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTF-KDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIK 11144
            ET+A+ +     + DL    P LEA+ KALDSL+KA ISE+RV+  PP LV  VM A+C+LL+  P W+ AK LLGD+NFL++LL Y+K+ I  ++   LQ+Y    DF PE V  VS ACRS+C WV A++ Y  V   + PK++ +  A+  L+ +   L  KQ +LK VE+ IK L ++Y  S+ E++ L + + LT  RL RA  L  A+  E+ RW  SI + ++   N+IG+   +AA   + G +T VYR++    WI+      IPI  N+  +     AY I  W+ +GLPRD    EN  ++ + ++WPL+IDPQ Q  R+++    K+  +VI      ++  LE AIR+G  + LE+++  +DP L P+L K+ F  G  T+I+LG+++++Y  +F+ Y+ + + NP  +  V   VTIINFTV   GLE+QLLS +V  E+P++E +RN+ +    +D   L+ +ED+ L LL  S   I+++ +L   L++SKIT+  IK RL E    E+ +  AR+ Y P+A +G+ IYFV+A L  ++ MYQYSL +F+ LF   ++   K      S   + +L  ++    + +Y   S GLF  H+ +++FML   IMR+  E     I + +W  F++
Sbjct: 2603 ETQAIAD---DAQRDLDEAMPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAICILLNAKPDWSAAKQLLGDSNFLKRLLEYDKENIKPQILLKLQKYVNNPDFVPEKVEKVSKACRSMCMWVRAMDLYSRVLKDVEPKKQKLAAAQAELDATMSTLRDKQQKLKSVEEQIKALQDQYDKSLSEKESLAKTMALTQARLNRAGKLTSALGDEQVRWKESIANFEEEISNVIGNVFIAAACVAYFGAFTAVYRQLLVDCWINKCQELEIPISPNFSLINILGDAYEIRQWNTDGLPRDHISTENGILVTRGRRWPLMIDPQDQANRWIRNKENKNGLKVIKLTDAGFLRTLENAIRLGLPVLLEELKETLDPALEPILSKQTFTSGGRTLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTRSGLEDQLLSDVVRIERPDLEEQRNQLIIRINSDKNQLKAIEDRILKLLFTSEGNILDNEDLINTLQESKITSGAIKTRLLEAEATEENINTAREKYRPVATQGSVIYFVIASLSEIDPMYQYSLKYFKQLFNMTIEAAEK------SNDLDIRLATLLSQTLFSAYTNVSRGLFEQHKLIYSFMLCVEIMRHKGE-----ISETEWNFFLR 3237          

HSP 3 Score: 340.117 bits (871), Expect = 0.000e+0
Identity = 232/849 (27.33%), Postives = 416/849 (49.00%), Query Frame = 1
Query: 6562 ELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKS 9102
            +LN+++ + +VF Y WS G                               D FD FV+  F++N E   +LP ++  ++S ++D D     PW+ ++PS K                +NN      ++ + D++RY +L   L+   H VL  G +G+GKS++                                 + LL+ IQ                E++ YVP      +Y  I F++QTS ++  + + SK+ K+ + I+G P NK++++F+DDLN+P +D +GSQ  +E++RQ+ +  GF+D   + W  + D ++  AC+P    ++P++ R  +HF +L LP PS ++ ++IFQ  +  +    DF   +K   T+IVD  + +Y +       +P KSHY+FNLR L K + G+L  D   V +K  + +   HE  R  HDRLI++ D++ F ++LS+       +    +      I+FG F  + G   + KVY+ +TD+EK+    +  ++ ++  +      +FF+ +++H+ R  R++ Q  G+ L++GV G GK S  ++++ I G   F++ ++  YN  SF  D++K+   + ++++  V   +D    V+       C            E  +L  ++S+       S S      V+   I ++++ LH+ + +SP    +R+R R  PSL+NCCTIDW++ W  E+L+SV+          F I I+   E      +E  + I+ +   +  ++  ELRR Y+ +   ++E +N +  +L     +  S R R+  GL++L+ET  L+ KMK +L  L P +K+KS
Sbjct: 1846 KLNSIVCQTFVFCYLWSVGGNLTEN-----------------------YWDAFDTFVRQQFEDNPEA--KLP-NSGDLWSVYMDYDTKRLDPWERIIPSFKY---------------SNNVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVVA--------------------------------RGLLNRIQ----------------EEAGYVP------VY--INFSAQTSSSRTQEIIESKLEKKRKTILGAPGNKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDVTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSEHSLKQIFQSILNGFL--ADFPEAVKQAATNIVDAAVEIYHRMSIDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGSVRDKTQIFRLFCHECQRIFHDRLINNEDKQYFHEMLSEMASKHFAVQIDPEYFVTKPIIFGDFTKV-GVDKADKVYEDLTDMEKIKSVLQDYLDDYNLTNAKDVKLVFFQDAVEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCFQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQ--VSLILQTSTC------------EQGKL--LVSSFSLLPCSSSSYY----VFQYFISRVRQKLHIVLCMSPVGEAFRARCRMFPSLVNCCTIDWFVQWPKEALLSVSQ--------KFFINIDLGSEGMKAKFSEMCVEIHMSVNTMAEKYYSELRRRYYTTPTSYLELINLYLSMLGEKRNQLVSARDRVKNGLSKLLETNVLVDKMKVELSALEPVLKQKS 2566          

HSP 4 Score: 38.1206 bits (87), Expect = 0.000e+0
Identity = 21/81 (25.93%), Postives = 43/81 (53.09%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +   ++NPK++++  LYG VN  +LEW +G++ +  +  ++ ++K+   +      D    EN N     N +  L N+E+
Sbjct: 1710 VKTYILNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSKDHKWIICDGPVDALWIENMNTVLDDNKMLCLANSER 1790          

HSP 5 Score: 205.682 bits (522), Expect = 1.343e-51
Identity = 173/691 (25.04%), Postives = 295/691 (42.69%), Query Frame = 3
Query: 11406 YLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQ--SEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYAS----ENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSAL--DMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLPRNLLGDLEEYFAQSELFDVTKTYSTSEIIPKPCIIQITEFLYLVFI*TMRCGIW 13454
            YL+ F   I++ +  S  ++ +   +V   LG+KF      +L  L+ +     P++FIL   SDP+    +   E RG +  +  +S+G+GQ   AE +I K  +  G WIFLQNC L +SWM  +++LI++        + NF+L LS+ P   FP+ +LQNS+K+  E P G++  + ++F       +T T +       + RK+IF +C F+A+V ER+ +G LG+++ Y+FNDSD E ++  +  +    ++ W+AL  + G I YGGR+TD  D+RCL  +L+ + S    E+N          SP          QS   +I   +  +     + G+ +NA +   + +  + +I+ I+        Q    SN  +  ++   I +K+P  ++  +                 LF      +KD   R N  +               VL QE+ ++N LL  +   ++ L   ++G   ++E +E +      + VP            + WS      +  +G W   ++              S I A    G  K                             +W+ G F PQ  +T  +QN AR  + +ID L     VLP        +Y  Q+ + +  KT    E +P   ++   E   LV    M    W
Sbjct: 3259 YLSIFYARIML-LGHSINVVFAVTEFVINTLGKKFIENPPIDLATLYQDMSPSTPLIFILSTGSDPMGAFQRFAKE-RGYSERVQSISLGQGQGPIAEKMI-KDAMKTGHWIFLQNCHLAVSWMLPMEELIKSFTEPNVSINENFRLFLSSMPSRTFPVTVLQNSVKVTNEPPKGLRANVRRAFT-----EITTTFFEEHLLGRKWRKVIFGICFFHAIVQERKKFGPLGWNICYEFNDSDRECALLNLNLYCQEGKIPWDALLYITGEITYGGRVTDAWDQRCLRTILRRFFSPETLEDNYCYSTSGIYFSPDA-----DSLQSFKDYIE--NLPLTDDPEIFGMHENANLA-FQRKETNTLINTILDVQPRSTTQGGGKSNDEIVRELATSILSKLPDKLDMEVASEM-------------LF------VKDAKGRVNSLTT--------------VLGQEVDRFNKLLKVLKNSLETLNKAIAGLVVMSEEMEKIYKSFLNSQVP------------TLWSDAAYPSLKPLGSWVKDLVMRI-----------SFIDAWIRIGQPK----------------------------SFWISGLFFPQGFLTGTLQNHARKYNLAIDELNFHYNVLP--------QYRDQATVTEAMKTLKFGEELPMDAVLPAPEDGVLVHGMYMDACRW 3841          

HSP 6 Score: 72.0182 bits (175), Expect = 4.072e-11
Identity = 29/57 (50.88%), Postives = 43/57 (75.44%), Query Frame = 1
Query: 5947 SKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKN 6117
            + K+ +WI+ DGP+++ W+EN+NTVLDD+++LCLAN ERI     +  +FEV  LKN
Sbjct: 1752 TSKDHKWIICDGPVDALWIENMNTVLDDNKMLCLANSERIKFTPQIHMVFEVKFLKN 1808          

HSP 7 Score: 66.2402 bits (160), Expect = 1.808e-9
Identity = 38/111 (34.23%), Postives = 59/111 (53.15%), Query Frame = 2
Query: 13397 PDHGVLVFGLYLDNALWNLENSSL------AINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            P+ GVLV G+Y+D   W+ E   +       +NP+      LP+IH       +N       +  PLY+T +R G LS++G S+NF+  + L S+R   +WI +G+A L Q
Sbjct: 3825 PEDGVLVHGMYMDACRWDDEAMVIEDALPRQMNPM------LPVIHFEP---HQNYNPSGDLYQAPLYKTSARAGTLSTTGHSTNFVVTVLLPSNRQNDYWISKGSALLCQ 3926          

HSP 8 Score: 56.225 bits (134), Expect = 2.156e-6
Identity = 54/236 (22.88%), Postives = 98/236 (41.53%), Query Frame = 2
Query:  545 NENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTC-------QNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESI 1231
            +EN ++ I+        + +W  E +    L  + TF  FR WKAF  WR N+   ++ + R  L  NL  ++   +  +  +    +++  RIS        ++ +  I+   TY+L EF  NQL Q+   + N   V  T+      TC        + T    +S  L           SS    +TE+   R   + +  F++L D  +V   H +   +++    ++VE +
Sbjct:  235 SENGVTHISDGEVLYLEIERWKQEYLYHKALKQIPTFALFRKWKAFTVWRKNVRAKRINECRKALQENLFIVNEYLRPAILNI----QEMCYRIS--------DMGLCRIEKEYTYSLHEFTGNQLKQLE--EVNYKSVLITLCVIKAVTCFMCSVRFLSMTAGPAVSDMLLPHLDGELFGESSDKMTYTEQANKRAHCRRLTCFIRLADYLIVNTMHILAVNSVNTLLMYLVEKL 456          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Xenopus
Match: DNAH2 (dynein, axonemal, heavy chain 2 [Source:NCBI gene;Acc:100170584])

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 392/1380 (28.41%), Postives = 673/1380 (48.77%), Query Frame = 3
Query: 9204 TEAVENYSLKC-------EEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIE-----WLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNN--QSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLI---GHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSF---IIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSW--GLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLT 13271
            +E +    +KC       ++DL    P LE +++AL+SLNK  ++E++ Y  PP LVE VM AV +L    P+WA AK  LG++NF+++L++++KD I+ ++ K + QY    DF P+ +G VSLA RS+C WV A+E Y  +  ++ PKR  +N A   L   +  L   QN+L++V + ++ L  +Y   + +++ L+    L   +L RA  L+  +  EK RW  ++K  D+    ++G C+ ++AY ++ GP+   YRE     WI  +    +P    +    F  S   +  W+  GLP DS  ++N  I+ +  +WPL++DPQ Q  +++++       +VI  +  D++  LE+A++ G  + L++++ ++DP L P+L K   + G    I+LG+ ++ Y+P F+ Y+ + LSNP     ++   TI+NF V   GLE QLL  +V KE+PE+E ++   +   A     L+ LED+ L LL ++T  +++D +L   L+ SK+TA ++ ++LE + + E+++  AR+ Y P A R + ++FVL DLG ++ MYQ+SL  + +LF   +D+  +      S + E ++  + D  TY  Y      LF  H+ LF+F +   I+     E   ++   ++  F++                  G ++ + + ++     WL+   W+     E++    F G+ NSF+  P  W +W  S  P         E S    +  ++++++  L   ++      ++   LG KF+     ++  +  +S  + P+VF+L    DP   +++L  E  G   N   +S+G+GQA  A  +I K  +  G W+FL NC L +SWMP L KL+E LQI  +D   NF+L LS+ PH DFPI ILQ S+K+  E P G++  + + + L     +TE  +++  +S   R+++F+LC F++V+LERR +  LG+++ Y FNDSD E+S   +  +L    E  W AL  +I  +NYGG +TD+ DRR L   + +Y SE    N            I   G L  ++   S + + D          G   NA+I     ++++    ++ +  Q +   +    T     LD+L  +  KIP  ++                                      Y     ++    +P + VL QEI++YN LL  I   +  L   + G   ++  LE +   I    VPP W     S+ K L+ W+ ++ +R++    W  +                      H P                               V +WL  F  P   +TAV+Q+ AR  + S+D L+
Sbjct: 2976 SEKIAAEEIKCKALAENAQKDLEEALPALEEAMRALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGNEPTWAEAKRQLGESNFIKQLIHFDKDNISDRVLKKIGQYCILPDFQPDIIGKVSLAARSLCMWVRAMEVYGRLFRVVEPKRARMNAAMNQLAEKQASLAEAQNKLREVAERLEQLKTQYDEKLAQKEALRAEAELMELKLQRAGTLVTGLAGEKSRWEETVKGLDEDLGFLVGDCLLASAYLSYMGPFLSSYREGILSIWIKEVREMLVPCSAVFSLTNFLSSPTMVREWNLQGLPSDSFSSDNGVIVTRGNRWPLMVDPQGQATKWIKSMESAKGLKVIDLQMTDFMRTLEQAVQFGFPVLLQNVQEELDPSLAPILNKSVTKVGGQLQIRLGDKDIVYNPEFRFYITTKLSNPHYTPEISSQATIVNFAVKEQGLEAQLLGSVVRKERPELEEQKQSLVLNIAAGKRKLQELEDEILRLLNEATGSLLDDVQLLNTLQTSKVTATEVSEQLESSEETEEKIDTAREAYRPCAQRASLLFFVLNDLGRIDPMYQFSLDSYTDLFHLSIDKSKR------SANVEERIANLNDWHTYAVYRYTCRALFERHKLLFSFQMCAKIL-----EVAGKLNMDEYNFFLR-----------------GGVVLDREEQMDNPCSAWLSDTNWD--NITELDKLANFHGIMNSFEQYPRDWHQWYTSPEPESACLPGEWENSC---SEIQRMLIVRSLRQDRVAFCVTSFIINNLGSKFTEPPVLDMRAVVEDSLPRSPLVFVLSPGVDPTGALLQLA-EQCGMAQNFHALSLGQGQAPIATRMI-KEGVKDGHWVFLANCHLSLSWMPQLDKLVEQLQI--EDPHPNFRLWLSSSPHPDFPISILQASIKMTTEPPKGLRANMTRLYQL-----ITEQQFSHCAKSSSYRRLLFSLCFFHSVLLERRKFLQLGWNIVYGFNDSDFEVSENLLSLYLDEYEETPWEALKYLIAGVNYGGHVTDDWDRRLLSTYINDYFSEPALTNQFYRLSSLDTYYIPRDGPLASYKEFISLLPAADHP-----EAFGQHPNADIASQITEARTLFDTLLSLQPQITPSAQGGGQTREEKVLDLLSDVREKIPPEID--------------------------------------YEGTCKVLSGDPNPLNVVLLQEIQRYNALLDTIRTSLNDLERGIQGLVVMSAELEEIFTCIYDARVPPLWEKAYPSL-KPLAAWTRDLVLRVELFSRWAKT---------------------AHPP-------------------------------VLFWLSAFTFPTGFLTAVLQSAARQNNVSVDSLS 4217          

HSP 2 Score: 285.034 bits (728), Expect = 0.000e+0
Identity = 180/638 (28.21%), Postives = 326/638 (51.10%), Query Frame = 1
Query: 7219 IEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQK--DFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHE-HLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSD-PNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            I +S+   +++  +   ++  ++QT+ N     + S++ KR + +  P   K+++ F+DDLN+P  D FGSQ  LE++R WI+   ++D  +    Y+ D  ++ A  P    ++ IS RL   F ++ +  PS +  +RIF    G    QK  DF  E+K     I    + +Y     ++  +P K HY+FNLR + K+  G+L A   L   K+ + +   HE  R   DRL+   D + F  ILS++L     L + +    K   +FG F           VY+ ITD + L  F    +            + + F  +IQH+ R +R++ Q  G+ML++G+ G G+ S  +++S I    +F+L +T  Y    FR DIK++   + + +RP V  L+D   + ++SF++D+ N+++SG +P+LY+ DE E I S L  E    +++ D P  ++  LIE+++  LH+ + +SP    +R+R+R  P+L+NC TIDW+ +W  E+L+ VA           +     + +     +    + ++R+  E  ++ ++ELRR  +++   ++E ++ +  +L     +     ++L  GL ++ ETR  + KM E L     K+ E  ++ E
Sbjct: 2334 IAQSVLQSLDSSKWAVLTVNMSAQTTTNNVQDIIESRVEKRTKGVYVPSGGKRLITFLDDLNMPAKDTFGSQPPLELLRLWIDYGFWYDRQNQSIKYIKDMFIMAAMGPPGGGRTAISSRLQSRFNLINMTFPSESQIRRIF----GTMMSQKLQDFDEEVKPVGDLITQATVELYNAITQRFLPTPAKIHYLFNLRDISKVFQGMLRAQRDLHDTKQSITRLWVHECFRVFSDRLVDSSDADAFVAILSEKLGSLFNLTYHNLCPSKQPPVFGDFL------REPPVYEDITDFQALKTFMNRQLQEQSQRPGAGAKSLVLFTDAIQHVTRIVRVIGQPRGNMLLVGIGGSGRQSLARLASYICDYKVFQLEVTRGYRKQEFREDIKRLYRLAGVDDRPSVFLLTDT-QITDESFLEDVNNILSSGEVPNLYKADEFEEIKSALS-EKAREQNIPDTPESLFNFLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPQEALLEVAE-------RYLEGVQLGAIDGIQGKVARIFVTMHRSVAEFSHRMKLELRRHNYITPTSYLEVVSRYKSLLAEKRKELGDKATKLRNGLFKIDETREKVEKMSEQLAVARSKVAEFQKQCE 2952          

HSP 3 Score: 65.0846 bits (157), Expect = 0.000e+0
Identity = 41/116 (35.34%), Postives = 60/116 (51.72%), Query Frame = 2
Query: 13373 DNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPS-FWILRGTAALLQCE 13717
            D++  +Y P  GV + GLYL+ A W+ +NS L      +  C LP +H     +E  KK     + CP Y  P R G   SSG++S F+  + L+    P+  WI RGTA L+  +
Sbjct: 4226 DDNNLVYPPKDGVWIRGLYLEGAGWDKKNSCLIEAEPMQLVCPLPTVHFRP--TESRKKSSKGLYSCPCYYYPVRAG---SSGRAS-FVIGVDLRCGAAPAEHWIKRGTALLMSLD 4335          

HSP 4 Score: 594.349 bits (1531), Expect = 9.090e-172
Identity = 363/1081 (33.58%), Postives = 581/1081 (53.75%), Query Frame = 2
Query: 2270 PKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLG-NKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQE----DVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQN--EILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMI-GLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXX-XYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQ------KQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            P+T+EE  + L+    + +E+  +  +   I++ F I+  ++V V  E L    +LN A    + +++  E+   ++  KF   L    EE +          +  S L++   +   L  LG      C+    +I            S+++   ++ + ++  +  G +   +++    D+  +E+D+    L+WE   EWE+ +E +        + + +  T       +  L + L +   EI+   +  +++ K ++P+I  LRNP L+ RHW ++++ + G      ++FT+ +++   + Q+ + I EIS  A  E+ +E  L  +   +      ++ + ++    + G DD+   LE++ + +ST+K S +V      V+ WER LSH  +V++  +  Q+ WLYLE IF   DI++QLP E   F +++  W+ +M +  +    L+     G+L+ L   N  LE IQKSL+ YLE KR IFPR +F+SND+LLEIL ++++P+ VQ HL K F N+  L+I  +   S      + S EGE       + + G  E WL  +E+ +   +K  ++ C + +++      K   +WA    GQ ++ S+Q++++ +V+++L      E      +  +    +  L   +  +  ++    R  L A++ ++VH RD    +L++       FEW  Q+R  W++    C + Q ++ F+YG EYLG S RLVITPLTDRCYMT+T AL+ + GG  KGPAGTGKTET+KDL K +G   +V NCS+ LD  ++ ++ SG+ Q G+W CFDEFNR+N+EVLSV+A QI SI  A  +   RF+FE +EI L   CGIFITMNP YAGR ELPDNL  +FRP++M+VPD  LI E+ILF EGF   KVL+ K+  LY L   QLS Q HYDFGLR++ S+L   G  R         ++ N+++E  +LI A+K  N  +L + DLPLF  IM DLF   +    +   L   IE   K  G +V P  + K+  L     SRH  ML+G + SGKT I   LQ AL+ L
Sbjct: 1029 PQTLEELAQSLQLYETLQSELAKVQSQIPPIHEQFAILEKYEV-VVDEVLQTLASLNGAWISFQQSLIDSESMLKKSKEKFKTSLIHTAEEFKK---------KTHSLLEEFTAKGPFLSSLG------CEPALEQI------------SMTREMMETLKAEENTIHLGLSMFKIEQPSSKDLRALEKDLDSLQLVWEATQEWEQRWEEWKSGSFLTLQTDLMESTAQGLYRRLSKLSRELKEKNWEIVETSRQRIDQFKRTMPLIADLRNPALRERHWSQVKQEVQGPFDETAEDFTLEKIVELGLDQHVEKISEISTSATKELFIEQGLENISKTWEATLLDIMPYKDKGHHRLRGTDDVFQALEDNQVALSTMKASPFVKAFEQDVDRWERCLSHILEVIEMILTVQRQWLYLENIFTGEDIRKQLPQESAEFDDINVSWKVIMGRLTKDNNALRGTHHPGLLEKLGEMNGVLEGIQKSLDMYLETKRHIFPRFYFISNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLKIQKAGIGSKYEAAGMFSAEGEYVDFTHPVLLEGPVEAWLCDIERTMRWTLKELLRNCRLALKKMSSKRDKWVKEWA----GQMLITSSQIQWTADVTKSLMAAK--ERGEKKILKIMKKKQVSMLNKYSDAIRGNLTKNLRLKLVALVTVEVHARDVIDKMLKSGCMDVASFEWLSQLRLYWDKDVDDCLIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGMYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILTALSANLTRFVFEGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEIILFGEGFNNCKVLAKKVYTLYSLAVQQLSKQDHYDFGLRALTSLLRYSGRKR--------RLQPNLSDE-EVLIMAMKDMNVAKLTSVDLPLFSGIMQDLFPGIETPTVDYGKLREQIEQELKLSGLQVTPFTVSKVIQLYETKTSRHSTMLVGRTCSGKTTIWRCLQGALSAL 2066          

HSP 5 Score: 34.2686 bits (77), Expect = 9.090e-172
Identity = 22/76 (28.95%), Postives = 39/76 (51.32%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQN--VLNDQLSTDNFEKENS--NQNDLQTLLNNEQ 5790
            +NPKALS+  LYG  +  + EW +GI+  + +   +     +   + +  + T   E  NS  + N + TL+N E+
Sbjct: 2082 LNPKALSLGELYGEYDLTTNEWTDGILSSLMRTACADDRPEEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGER 2157          

HSP 6 Score: 107.071 bits (266), Expect = 9.031e-22
Identity = 44/97 (45.36%), Postives = 68/97 (70.10%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFL 6252
            +WI+ DGP+++ W+E++N+V+DD+++L L NGERI +P  +  LFEV DL  +SPATVSRC M+Y    S+ W+  V+SW++   PK  P   + +L
Sbjct: 2124 KWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVSDLAVASPATVSRCGMVYTDHTSLGWRPYVQSWLEKH-PKVNPSDPESYL 2219          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Mouse
Match: Dnah14 (dynein, axonemal, heavy chain 14 [Source:MGI Symbol;Acc:MGI:2444525])

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 454/1233 (36.82%), Postives = 732/1233 (59.37%), Query Frame = 2
Query: 1838 PSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEA------LKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANK---TLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSH--SNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYK-RFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLIN--LSKEK 5494
            P   ++ DTD +Y   + T+L +  NS+  +  Y       C+ V++A      L     ++  EF+  I +F+ +L Q     ++I       RIG   + + +      PY++ +I +    L  + T+  ++  NL+ T +     LDT+P  +EEFVEHL F++ I + +  ++K+  +I+++++I+ ++++ V+ EQ+A+YK +      LK ++ +    ++ ++ KF   LE  I  +R+ +  +K+K R    L  +       + + +L+ E   L  K++ YSNYQ  +  +  +  +         + T   +  +  ++ E+E D+ +R LLWE + EW +++  +    L   +++ V+  VS+  H + VLEK LP+N+++P +K  V + +  LP+I AL N  L+ RHW  ++ + G S + NKN +I +L++ K+  Y++ I EIS  A NE  LE ML K+ D++      LV H    R   II+  DD+   LE+S   +++IKGS Y+  I+  V  W + L+  ++ +DEW+ CQ+ WL LE IF +++IQ+QL  E +LF +V   W+ +M +   K   L      G+L +L++CNS LE I+KSLE+YLE+KR+ FPR FFLSNDELL+IL+ +++PE+VQ HL K F N+ ++ +        S+  ++S EGE   +P+ IRVR   EQW+  +E+ +F+ +K+ I + + + +   F DW +++ GQ ++   Q+ F  +    LKG        +L   ++ + L+++LE +AV V+ +  + + +  L A ++I VH RD    +L   + S  DFEW + +RY WN     C V Q ++ F YG EYLGC+PRLVITPLT+RC+++++ AL FNLGGC  GPAGTGKTET+KDL+K  G+ CVVFNC + LD   + KL  G++Q G+WCCFDEFNR+++EVLSVIA+QI +IK AK S   RF+ + +EI++N  C + IT+NP   GRVE+PDNL +LFR V++MVP Y +I EVILFS GF +++ LS KI +LY L + QLS Q+HYDFGLR++K+VLI+     LE           ++E L ILI+AI+ ++  +L+ +D+  F+ I+ D+F        N   LE++I  + ++LG++ WP Q EKI     QL+   GV+L+GP+  GKT +R IL+KAL  LP+ +  L KE+
Sbjct:  608 PDFYILFDTDTDYQNKIVTLLTIIGNSVGLVSDYSCRFLKYCYIVEKAKVMTTKLPFMTNLTSIEFKRIIHKFRSYLKQIVTMTIEI-------RIGIFYVNSLDYQLACLPYVDGIIQMSYNLL--QCTIE-EKSANLLETLDSLLHQLDTEPVELEEFVEHLNFLDDIFSSLTEIEKDFCTISELYSIVRHYQINVSEEQIAIYKIIFMKFNHLKTSMKFVAMNRETSLTKFKNGLEAYIVSLRVDVSNLKDKIRTPLLLAASTPIPKAKEIVQSLEAEAESLTLKVKTYSNYQNYYDQAYFRMNA---------INTNEMSHIVLSEISEIECDLMLRKLLWEAQEEWGKYFWEWRNCTLQSIDIDLVKNNVSKWLHIIIVLEKGLPKNDMVPLLKQSVLDFRQELPIITALGNACLKARHWETLQGITGRSTSLNKNLSIEKLLALKLFPYERKINEISISATNEAALEKMLFKIIDLWNTTPLHLVPHLTEGRSILIISSTDDLITQLEDSQAILASIKGSSYLRPIKQLVIKWNQNLTLFSQTIDEWVTCQRTWLSLEPIFQSLEIQKQLAAEAKLFSQVLVMWKEIMSRVLNKLNALHITISTGILGVLKSCNSHLESIKKSLEEYLELKRMSFPRFFFLSNDELLDILANSKNPESVQPHLVKCFENIRRILLWKQDVGPPSVKMLISAEGEGLVMPKKIRVRASVEQWMVNVEKSMFDVLKKFIIQGIEDWKYHTFSDWVMSHPGQVVITVIQIMFYND---CLKGFMSYNPREILE--AVQARLLRHLEDIAVLVTLNTSNQRTKTMLAATLIICVHCRDIMSDVLVKKIFSIQDFEWTRHLRYKWNGKQKLCYVLQANTSFVYGYEYLGCAPRLVITPLTERCWLSLSEALYFNLGGCTAGPAGTGKTETVKDLAKSFGKHCVVFNCFEDLDYKIIGKLFFGLVQSGAWCCFDEFNRISIEVLSVIASQILAIKIAKSSYSVRFVLDGREIRINMSCAVLITINPGTTGRVEIPDNLKYLFRLVSIMVPHYKMITEVILFSYGFKSSRSLSGKIVHLYDLADKQLSKQEHYDFGLRTLKTVLIMTEKKILEHKCGRGEHLSELDESL-ILIEAIREASLSKLLPEDVLPFEKIIEDVFPRITVSKINHLTLEKAISTATEQLGFQHWPSQKEKIIQFYQQLQVCVGVILVGPTGGGKTTVRKILEKALVTLPVTSAMLMKER 1815          

HSP 2 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 457/1447 (31.58%), Postives = 757/1447 (52.32%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTEC-------------VDEINKEIGENVSISPETK-------------LQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEES--DNRIG---QKQWATFIKLHTTSSVYGENLKAFDSTGQI--IKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETW-------IKWNLSENPF-------DMSSYNFKE---------------FSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYN--NQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYAS-----ENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQ---KTTDSNSA--LDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNV----LEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSW--GLLSIGKSLSEWSSNVRIRIDFIGFW---CYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVL 13289
            + + VE Y+ K   +L +V P L+ +I AL++L+K+ ISE+RVY  PP LV  VMNAVC+LL   P+WA AKLLL D +FL++L+N +KD+I  K++  L++     DFNP  +  VS+AC S+CQWV+A+ +YH V  ++ PK+  V EA+  L+I+KQ+L  KQ  L+ +EDH++ L   Y++ V E+ QL  R +L  +RL  A+ L+  ++ EK RW  +I + D   K + G    S+A   + G  T  +RE+  +KW D      I +  N+  ++       I  WHN GLP    +AEN  +++++K+WPL+IDP KQ   +++       + IS +  +Y   L  A++ GD + L+++     P L  +L+K+  ++     IK+ + E+E++ +F+LYL + L NP    SV   VTIINFTV   GL+++LLS +VS E P +EN+R + L + + D  +L  LEDKTL LLQ +   +++D E+ + L K K+T+ +I KR++ET +AE ++Q  RK YLP+A RGA +YFV+A L  V  MYQ+SL W + +F                 DE ++E  + VS+S   +             ++  I+++T   + + S  LF+ H+  F+F L T+IMR +  ++   + IG   +++W  F  L+T+  +  +N+ +      I  I++  +++W+    W +C+++  ++ + FS LC S     + W         ++L   PF            + KE               F  + L  F++LILI IL   +L +S + ++   +G ++      NL   F+ES A+ P++       D  N +++   E +G T  + ++S+G  Q  KAE +I K      +W+FLQNC L  S+MP L  +I++        D +F+L LS+     FPI ILQ S+KIA+E P G+K+ LL+ F   G+G VTE ++   +     +K++F++CLF+AV++ER+ YG+LG+++PY F+ SDLE+S+K +   L+  +EV W  ++ +I  + +GGR+ D  D RCL  L   + +     ++ + +  EM+   P      L D  +I      +D        +LG+   A     E +++ +I ++I  Q K        K   SN +  +++L  I +++P +VE   +   G      F    P++ +L E I+                  +D   H+V    L++EI+++N LL  IHK +K L   + G   +T  LE   D      VP  W        K LS W SN+  R++F   W    Y+ +  +H+Y+  + +         +P + K  I +                        YWL  FFSPQ+ +TA++Q+  R    S+D LT + +V+
Sbjct: 2945 QVKIVEEYAQKTSNELKNVLPSLDKAIVALNALDKSDISELRVYTRPPYLVLTVMNAVCILLEKKPNWATAKLLLSDTSFLKRLINIDKDSIPDKVFLRLKKILNLPDFNPNKIAMVSVACCSMCQWVIALNNYHEVQKVVRPKQAQVAEAQNVLQIAKQRLLEKQRGLQLIEDHLQFLHTSYRDIVTEKHQLASRKKLATKRLQCASVLLTVLEDEKIRWQETINEIDCKLKGVCGDTFLSSACLAYIGVLTPEFRELVIQKWKDFCTRAEIILSPNFSLIDVMAEKNEIRRWHNQGLPLGQHLAENAILMKRTKQWPLVIDPHKQALHWIRQMEGPRLQEISAQDSNYTKKLVIAMQAGDPVLLQNVPETFPPNLRAMLKKDVCQKRGQYYIKIDDTEIEFNKNFRLYLSTELENPNFFPSVYNFVTIINFTVTFQGLQDELLSTVVSHEVPHLENQRAQLLESISLDAITLEELEDKTLTLLQKAEGSVLDDEEIVETLRKCKMTSNEISKRIKETEKAESKIQATRKNYLPIATRGALLYFVVAGLSHVEKMYQFSLEWLRGVFVSFTVSKTKEEKHDWKTDETSQEKADEVSLSSSEQENLESERIPLAENIKNAIETLTRNVFKVVSSALFNEHKLCFSFALCTTIMRGNSSDTLMADDIGFLPEEEWNIF--LYTSILINIKNILSKPRLNSIFEIRRNGHLQWVPDLRWRQCQYISNQM-EPFSLLCTSLLSNEQQWNAFKDAMAVYSLMSRPFFSDAPLPQKKPRSAKEAELLDESDEMLDPVTFPWEKLTQFQRLILIKILRPDRLENSIKKFITEKMGGEYIPDTTVNLKESFSESTAQTPLILTHSYGIDLNNLLLRFAEEFKGTTPKVTMISLGPDQENKAEEIIFKAVRKAHQWVFLQNCHLAESFMPRLTAIIDSFSSPDMVLDPDFRLWLSSKASGFFPITILQKSVKIAVEPPQGLKSNLLQMFGYGGSGEVTEEMFEKPDCGPWWKKILFSICLFSAVLIERKAYGTLGWNIPYRFSSSDLEVSLKVLGNVLSGRSEVPWKEVNYLISEVTFGGRVVDEWDMRCLKTLFDKFCNPEMLKDDYSFSSNEMYQPVPSS--ASLKDCINIIQSFPDDDSP-----EILGIHPEATHTGSEIKAQKYIENLIYMQPKDAPGYLMIKPMQSNDSVVMEVLSDIMSQLPLTVESEDVSEPGLQSTFSFIVSSPIWERLHENIQG-----------------YDPLIHSVLIPFLKKEIERFNKLLSVIHKSLKSLQLAIKGESILTPDLEETYDSFLRARVPMLWQKNAYKSCKPLSIWVSNLIQRVNFFNTWAKVAYTAI--HHRYMLFITTWRQLGQKSRHPTDFKTEITDGFPAR-------------------YWLSAFFSPQAFLTAMLQDYGRAQGISMDTLTFTHKVI 4343          

HSP 3 Score: 491.5 bits (1264), Expect = 0.000e+0
Identity = 344/1213 (28.36%), Postives = 612/1213 (50.45%), Query Frame = 1
Query: 5554 AKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSR---KVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSE--TGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEI------IVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYND-KNQNLLSSIQNL---------SKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHE-----HLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
             K+DV V+NPK ++++ LYG +N N++EW +G++    +  +  +  + + +++         E S   DL  +         +   S++ +M+       +  F  E    L+ S K     D          +WQWIVLDGPI+S W+ENLNTVLD+++ LCLAN ERI++   ++ +FE D L +++P+ ++RCAM+Y+    + W+  +KSW+     KS  + G + L  +  +S+  GMKFL K  K    P     + + TLC IL+A   ++    G    S + +D+     ++   K  E T+  +D   +           FL++NP++L  ++ K++VFA+TW+FG    R ED   E  +   S +    S+ E    FD+FV+ +F+++SE  TGI LP   ++++ YFVD+ +  F PW  LVP+   LI     L      ++ N  R+NE       + + D+I  SFL +L + N++PVLL GD G+GKS+ IN +L+++    G+      SILGK+ ++ND K  +L  +I  L         +    SA  E+     S  +       I S+I F S  +  K  + +  K+V+R +DI+G PKN ++++FIDDLN+P +D  G+Q  LE++RQ +++ G +D     W  + D SLI A + ++                                       K+ S  +  H +++V +P              P +S     L  + +++ GL+ AD  ++ +KE     + HE  R  HDRL    ++ +F++ILS EL   L++ W+H+ L    ++F  F  +       +VYQ   +  +L+    S +  F  +        +++ +FFK++I H+ R  R L QS  HML++G++GCGK +   I+  +    + ++ ++ +Y    F+   KKV  ++ L+  P VV ++++ +  + SF++DL  +IN+G I +++EN+EL++I+  +         + D   +  L   ++ K LH+C+ +S     +R   R  PS+I+ CTIDW+  W  E+L+ VA           +      KED +       + I+++  ++  ++  E  + Y+++   + +FL  F   L+    +  + R+R   GL++++E   L+T M+E+L+ + P+I++K++E E
Sbjct: 1826 GKVDVCVLNPKCITLSELYGQLNINTMEWNDGLLSAAIRNYVHMNTADYSKIDNDF-------EMSGITDLSNIF--------QVGFSTIADMD-------NNIFMGE----LEKSFKTPEIHDF---------DWQWIVLDGPIDSLWIENLNTVLDETRTLCLANSERISLTNKIRIVFEADSLFDATPSVITRCAMVYMDPVDLGWEPYMKSWLLKS-SKSISQQGIQCLEMMINRSVTKGMKFLKKHRKFLPYP-IQDVTVVITLCRILDAFFEFMHIKQGTPK-SHEAMDSESPTETKVKVKFKEETSHHKDEGSW-----------FLERNPEKLPMMIQKIFVFAFTWAFGGILKR-EDQHEEDILFRKSFEHD--SLAEVNYNFDIFVREVFEDDSERDTGISLPGSERSVFGYFVDVQQCEFMPWSDLVPTAHTLIQKETSLLTDFQGSSENVLRMNEYGECVNYMATRDTICLSFLMSLFLRNSYPVLLTGDCGVGKSVAINKMLEKL-EGRGTLNIKYGSILGKVLLHNDIKRSSLRQNINILIGDPTKIIGAGLEQSAKKEEAKANDSTVI--NDKGIIVSTINFTSTMTAAKTKELLLRKLVRRTKDILGAPKNNRIVVFIDDLNMPIVDACGTQPPLELIRQLLDMGGVYDTERNMWKSIQDLSLIAAYTSSVSG-------------------------------------KEISPRLLKHFSTLV-LP-------------HPPQS----ALCTVFQLLLGLMQADKNIINSKEMAALLLVHEASRVFHDRLTDQSEKSLFYQILSTELQNHLQIYWSHERLMNKPVLFVDFMDI-NKPHRKRVYQNTDNYNELL----SILTKFQQKLSSSSLEMSHSVVFFKEAIDHITRTTRALRQSGSHMLLLGIDGCGKETYATIACYLAEYKVCKVPISHNYAISEFKEMFKKVFIQTGLEETPTVVMVTNLQE-EHVSFLEDLNYIINAGKISNMFENEELDSIVMRVGTFAEQLTCIEDRKYLLSLFQRRVSKNLHICM-ISATGPNFRHNCRVYPSMISSCTIDWFQRWPDEALLVVA------SSYLKEKLKVEDKEDKIREFAPTCVEIHKSMKDLSAKYFEETGKHYYITPSCYFKFLETFTHSLRIRQEEMQTKRNRFYMGLSKILEATVLVTDMQEELLVIGPQIEQKAKEKE 2915          

HSP 4 Score: 50.0618 bits (118), Expect = 0.000e+0
Identity = 38/117 (32.48%), Postives = 56/117 (47.86%), Query Frame = 2
Query: 13400 DH---GVLVFGLYLDNALWNLENSSLAINPIHRRYCKLP-IIHLMAVISEKNKKEDS-------YTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCE 13717
            DH   GV +FGL+++ A W+ E   L  +   +  C+ P I+ L   I+E +  +DS        TF CP+Y TP R    +  G  +  L  + L + + PS WI    A L  CE
Sbjct: 4374 DHSPKGVYIFGLFMEGARWDPEQEVLEDSLPSQLCCEFPDILFLPTKITEPSASQDSDQTASDLQTFECPVYYTPERSR--NMIGLPTTVLTSVHLPTKKPPSHWITMQVALL--CE 4486          

HSP 5 Score: 67.3958 bits (163), Expect = 6.673e-10
Identity = 58/233 (24.89%), Postives = 102/233 (43.78%), Query Frame = 2
Query:  593 PVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDENSDENKKSKIKNIPIF 1291
            P   WL+E+  F+ L     F  FR  KAF TW+ N+   K    R++L  +L   D +FQ  +  V  L ED L     N + S   + +  +D S+T+ L +F + QL Q       L ++ S  +  + K+     +K N+  Y E    E N         H +  + R  ++    FLKL+D    +L  +++   +++       S     + ++  +S +++  IF
Sbjct:  172 PTMDWLYERHYFYLLQKFKIFYNFRLNKAFVTWKLNVKRRKTETSRSYLYNHLFCADELFQTSLLYVRGLCEDALTLKKKNKDNS-STICLIKVDTSRTHVLEKFCEEQLQQATQAVAQLEEIRSKAIVEIKKSALKVAEKKNVKEYFESKPSEINT-------THFKLPQYRNLLETNLRFLKLIDYLFQELIRQLMNSALTQLLDLFTGSARMPFSKEKKNESLMRDRKIF 396          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Mouse
Match: Dnah14 (dynein, axonemal, heavy chain 14 [Source:MGI Symbol;Acc:MGI:2444525])

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 454/1233 (36.82%), Postives = 732/1233 (59.37%), Query Frame = 2
Query: 1838 PSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEA------LKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANK---TLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSH--SNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYK-RFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLIN--LSKEK 5494
            P   ++ DTD +Y   + T+L +  NS+  +  Y       C+ V++A      L     ++  EF+  I +F+ +L Q     ++I       RIG   + + +      PY++ +I +    L  + T+  ++  NL+ T +     LDT+P  +EEFVEHL F++ I + +  ++K+  +I+++++I+ ++++ V+ EQ+A+YK +      LK ++ +    ++ ++ KF   LE  I  +R+ +  +K+K R    L  +       + + +L+ E   L  K++ YSNYQ  +  +  +  +         + T   +  +  ++ E+E D+ +R LLWE + EW +++  +    L   +++ V+  VS+  H + VLEK LP+N+++P +K  V + +  LP+I AL N  L+ RHW  ++ + G S + NKN +I +L++ K+  Y++ I EIS  A NE  LE ML K+ D++      LV H    R   II+  DD+   LE+S   +++IKGS Y+  I+  V  W + L+  ++ +DEW+ CQ+ WL LE IF +++IQ+QL  E +LF +V   W+ +M +   K   L      G+L +L++CNS LE I+KSLE+YLE+KR+ FPR FFLSNDELL+IL+ +++PE+VQ HL K F N+ ++ +        S+  ++S EGE   +P+ IRVR   EQW+  +E+ +F+ +K+ I + + + +   F DW +++ GQ ++   Q+ F  +    LKG        +L   ++ + L+++LE +AV V+ +  + + +  L A ++I VH RD    +L   + S  DFEW + +RY WN     C V Q ++ F YG EYLGC+PRLVITPLT+RC+++++ AL FNLGGC  GPAGTGKTET+KDL+K  G+ CVVFNC + LD   + KL  G++Q G+WCCFDEFNR+++EVLSVIA+QI +IK AK S   RF+ + +EI++N  C + IT+NP   GRVE+PDNL +LFR V++MVP Y +I EVILFS GF +++ LS KI +LY L + QLS Q+HYDFGLR++K+VLI+     LE           ++E L ILI+AI+ ++  +L+ +D+  F+ I+ D+F        N   LE++I  + ++LG++ WP Q EKI     QL+   GV+L+GP+  GKT +R IL+KAL  LP+ +  L KE+
Sbjct:  659 PDFYILFDTDTDYQNKIVTLLTIIGNSVGLVSDYSCRFLKYCYIVEKAKVMTTKLPFMTNLTSIEFKRIIHKFRSYLKQIVTMTIEI-------RIGIFYVNSLDYQLACLPYVDGIIQMSYNLL--QCTIE-EKSANLLETLDSLLHQLDTEPVELEEFVEHLNFLDDIFSSLTEIEKDFCTISELYSIVRHYQINVSEEQIAIYKIIFMKFNHLKTSMKFVAMNRETSLTKFKNGLEAYIVSLRVDVSNLKDKIRTPLLLAASTPIPKAKEIVQSLEAEAESLTLKVKTYSNYQNYYDQAYFRMNA---------INTNEMSHIVLSEISEIECDLMLRKLLWEAQEEWGKYFWEWRNCTLQSIDIDLVKNNVSKWLHIIIVLEKGLPKNDMVPLLKQSVLDFRQELPIITALGNACLKARHWETLQGITGRSTSLNKNLSIEKLLALKLFPYERKINEISISATNEAALEKMLFKIIDLWNTTPLHLVPHLTEGRSILIISSTDDLITQLEDSQAILASIKGSSYLRPIKQLVIKWNQNLTLFSQTIDEWVTCQRTWLSLEPIFQSLEIQKQLAAEAKLFSQVLVMWKEIMSRVLNKLNALHITISTGILGVLKSCNSHLESIKKSLEEYLELKRMSFPRFFFLSNDELLDILANSKNPESVQPHLVKCFENIRRILLWKQDVGPPSVKMLISAEGEGLVMPKKIRVRASVEQWMVNVEKSMFDVLKKFIIQGIEDWKYHTFSDWVMSHPGQVVITVIQIMFYND---CLKGFMSYNPREILE--AVQARLLRHLEDIAVLVTLNTSNQRTKTMLAATLIICVHCRDIMSDVLVKKIFSIQDFEWTRHLRYKWNGKQKLCYVLQANTSFVYGYEYLGCAPRLVITPLTERCWLSLSEALYFNLGGCTAGPAGTGKTETVKDLAKSFGKHCVVFNCFEDLDYKIIGKLFFGLVQSGAWCCFDEFNRISIEVLSVIASQILAIKIAKSSYSVRFVLDGREIRINMSCAVLITINPGTTGRVEIPDNLKYLFRLVSIMVPHYKMITEVILFSYGFKSSRSLSGKIVHLYDLADKQLSKQEHYDFGLRTLKTVLIMTEKKILEHKCGRGEHLSELDESL-ILIEAIREASLSKLLPEDVLPFEKIIEDVFPRITVSKINHLTLEKAISTATEQLGFQHWPSQKEKIIQFYQQLQVCVGVILVGPTGGGKTTVRKILEKALVTLPVTSAMLMKER 1866          

HSP 2 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 457/1447 (31.58%), Postives = 757/1447 (52.32%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTEC-------------VDEINKEIGENVSISPETK-------------LQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEES--DNRIG---QKQWATFIKLHTTSSVYGENLKAFDSTGQI--IKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETW-------IKWNLSENPF-------DMSSYNFKE---------------FSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYN--NQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYAS-----ENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQ---KTTDSNSA--LDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNV----LEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSW--GLLSIGKSLSEWSSNVRIRIDFIGFW---CYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVL 13289
            + + VE Y+ K   +L +V P L+ +I AL++L+K+ ISE+RVY  PP LV  VMNAVC+LL   P+WA AKLLL D +FL++L+N +KD+I  K++  L++     DFNP  +  VS+AC S+CQWV+A+ +YH V  ++ PK+  V EA+  L+I+KQ+L  KQ  L+ +EDH++ L   Y++ V E+ QL  R +L  +RL  A+ L+  ++ EK RW  +I + D   K + G    S+A   + G  T  +RE+  +KW D      I +  N+  ++       I  WHN GLP    +AEN  +++++K+WPL+IDP KQ   +++       + IS +  +Y   L  A++ GD + L+++     P L  +L+K+  ++     IK+ + E+E++ +F+LYL + L NP    SV   VTIINFTV   GL+++LLS +VS E P +EN+R + L + + D  +L  LEDKTL LLQ +   +++D E+ + L K K+T+ +I KR++ET +AE ++Q  RK YLP+A RGA +YFV+A L  V  MYQ+SL W + +F                 DE ++E  + VS+S   +             ++  I+++T   + + S  LF+ H+  F+F L T+IMR +  ++   + IG   +++W  F  L+T+  +  +N+ +      I  I++  +++W+    W +C+++  ++ + FS LC S     + W         ++L   PF            + KE               F  + L  F++LILI IL   +L +S + ++   +G ++      NL   F+ES A+ P++       D  N +++   E +G T  + ++S+G  Q  KAE +I K      +W+FLQNC L  S+MP L  +I++        D +F+L LS+     FPI ILQ S+KIA+E P G+K+ LL+ F   G+G VTE ++   +     +K++F++CLF+AV++ER+ YG+LG+++PY F+ SDLE+S+K +   L+  +EV W  ++ +I  + +GGR+ D  D RCL  L   + +     ++ + +  EM+   P      L D  +I      +D        +LG+   A     E +++ +I ++I  Q K        K   SN +  +++L  I +++P +VE   +   G      F    P++ +L E I+                  +D   H+V    L++EI+++N LL  IHK +K L   + G   +T  LE   D      VP  W        K LS W SN+  R++F   W    Y+ +  +H+Y+  + +         +P + K  I +                        YWL  FFSPQ+ +TA++Q+  R    S+D LT + +V+
Sbjct: 3052 QVKIVEEYAQKTSNELKNVLPSLDKAIVALNALDKSDISELRVYTRPPYLVLTVMNAVCILLEKKPNWATAKLLLSDTSFLKRLINIDKDSIPDKVFLRLKKILNLPDFNPNKIAMVSVACCSMCQWVIALNNYHEVQKVVRPKQAQVAEAQNVLQIAKQRLLEKQRGLQLIEDHLQFLHTSYRDIVTEKHQLASRKKLATKRLQCASVLLTVLEDEKIRWQETINEIDCKLKGVCGDTFLSSACLAYIGVLTPEFRELVIQKWKDFCTRAEIILSPNFSLIDVMAEKNEIRRWHNQGLPLGQHLAENAILMKRTKQWPLVIDPHKQALHWIRQMEGPRLQEISAQDSNYTKKLVIAMQAGDPVLLQNVPETFPPNLRAMLKKDVCQKRGQYYIKIDDTEIEFNKNFRLYLSTELENPNFFPSVYNFVTIINFTVTFQGLQDELLSTVVSHEVPHLENQRAQLLESISLDAITLEELEDKTLTLLQKAEGSVLDDEEIVETLRKCKMTSNEISKRIKETEKAESKIQATRKNYLPIATRGALLYFVVAGLSHVEKMYQFSLEWLRGVFVSFTVSKTKEEKHDWKTDETSQEKADEVSLSSSEQENLESERIPLAENIKNAIETLTRNVFKVVSSALFNEHKLCFSFALCTTIMRGNSSDTLMADDIGFLPEEEWNIF--LYTSILINIKNILSKPRLNSIFEIRRNGHLQWVPDLRWRQCQYISNQM-EPFSLLCTSLLSNEQQWNAFKDAMAVYSLMSRPFFSDAPLPQKKPRSAKEAELLDESDEMLDPVTFPWEKLTQFQRLILIKILRPDRLENSIKKFITEKMGGEYIPDTTVNLKESFSESTAQTPLILTHSYGIDLNNLLLRFAEEFKGTTPKVTMISLGPDQENKAEEIIFKAVRKAHQWVFLQNCHLAESFMPRLTAIIDSFSSPDMVLDPDFRLWLSSKASGFFPITILQKSVKIAVEPPQGLKSNLLQMFGYGGSGEVTEEMFEKPDCGPWWKKILFSICLFSAVLIERKAYGTLGWNIPYRFSSSDLEVSLKVLGNVLSGRSEVPWKEVNYLISEVTFGGRVVDEWDMRCLKTLFDKFCNPEMLKDDYSFSSNEMYQPVPSS--ASLKDCINIIQSFPDDDSP-----EILGIHPEATHTGSEIKAQKYIENLIYMQPKDAPGYLMIKPMQSNDSVVMEVLSDIMSQLPLTVESEDVSEPGLQSTFSFIVSSPIWERLHENIQG-----------------YDPLIHSVLIPFLKKEIERFNKLLSVIHKSLKSLQLAIKGESILTPDLEETYDSFLRARVPMLWQKNAYKSCKPLSIWVSNLIQRVNFFNTWAKVAYTAI--HHRYMLFITTWRQLGQKSRHPTDFKTEITDGFPAR-------------------YWLSAFFSPQAFLTAMLQDYGRAQGISMDTLTFTHKVI 4450          

HSP 3 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 367/1214 (30.23%), Postives = 640/1214 (52.72%), Query Frame = 1
Query: 5554 AKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSR---KVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSE--TGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEI------IVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYND-KNQNLLSSIQNL---------SKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQSP-ISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHE-----HLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
             K+DV V+NPK ++++ LYG +N N++EW +G++    +  +  +  + + +++         E S   DL  +         +   S++ +M+       +  F  E    L+ S K     D          +WQWIVLDGPI+S W+ENLNTVLD+++ LCLAN ERI++   ++ +FE D L +++P+ ++RCAM+Y+    + W+  +KSW+     KS  + G + L  +  +S+  GMKFL K  K    P     + + TLC IL+A   ++    G    S + +D+     ++   K  E T+  +D   +           FL++NP++L  ++ K++VFA+TW+FG    R ED   E  +   S +    S+ E    FD+FV+ +F+++SE  TGI LP   ++++ YFVD+ +  F PW  LVP+   LI     L      ++ N  R+NE       + + D+I  SFL +L + N++PVLL GD G+GKS+ IN +L+++    G+      SILGK+ ++ND K  +L  +I  L         +    SA  E+     S  +       I S+I F S  +  K  + +  K+V+R +DI+G PKN ++++FIDDLN+P +D  G+Q  LE++RQ +++ G +D     W  + D SLI A + ++    IS RL KHF  L LP P  +A   +FQ  +G YF   +F  E++     IV   +++Y++   +   +P K HYIFN R + K++ GL+ AD  ++ +KE     + HE  R  HDRL    ++ +F++ILS EL   L++ W+H+ L    ++F  F  +       +VYQ   +  +L+    S +  F  +        +++ +FFK++I H+ R  R L QS  HML++G++GCGK +   I+  +    + ++ ++ +Y    F+   KKV  ++ L+  P VV ++++ +  + SF++DL  +IN+G I +++EN+EL++I+  +         + D   +  L   ++ K LH+C+ +S     +R   R  PS+I+ CTIDW+  W  E+L+ VA           +      KED +       + I+++  ++  ++  E  + Y+++   + +FL  F   L+    +  + R+R   GL++++E   L+T M+E+L+ + P+I++K++E E
Sbjct: 1877 GKVDVCVLNPKCITLSELYGQLNINTMEWNDGLLSAAIRNYVHMNTADYSKIDNDF-------EMSGITDLSNIF--------QVGFSTIADMD-------NNIFMGE----LEKSFKTPEIHDF---------DWQWIVLDGPIDSLWIENLNTVLDETRTLCLANSERISLTNKIRIVFEADSLFDATPSVITRCAMVYMDPVDLGWEPYMKSWLLKS-SKSISQQGIQCLEMMINRSVTKGMKFLKKHRKFLPYP-IQDVTVVITLCRILDAFFEFMHIKQGTPK-SHEAMDSESPTETKVKVKFKEETSHHKDEGSW-----------FLERNPEKLPMMIQKIFVFAFTWAFGGILKR-EDQHEEDILFRKSFEHD--SLAEVNYNFDIFVREVFEDDSERDTGISLPGSERSVFGYFVDVQQCEFMPWSDLVPTAHTLIQKETSLLTDFQGSSENVLRMNEYGECVNYMATRDTICLSFLMSLFLRNSYPVLLTGDCGVGKSVAINKMLEKL-EGRGTLNIKYGSILGKVLLHNDIKRSSLRQNINILIGDPTKIIGAGLEQSAKKEEAKANDSTVI--NDKGIIVSTINFTSTMTAAKTKELLLRKLVRRTKDILGAPKNNRIVVFIDDLNMPIVDACGTQPPLELIRQLLDMGGVYDTERNMWKSIQDLSLIAAYTSSVSGKEISPRLLKHFSTLVLPHPPQSALCTVFQAHLGMYFSINNFVNEVQKCRDEIVHCSLAIYYEVCKKLLPTPTKCHYIFNPRDIFKLLLGLMQADKNIINSKEMAALLLVHEASRVFHDRLTDQSEKSLFYQILSTELQNHLQIYWSHERLMNKPVLFVDFMDI-NKPHRKRVYQNTDNYNELL----SILTKFQQKLSSSSLEMSHSVVFFKEAIDHITRTTRALRQSGSHMLLLGIDGCGKETYATIACYLAEYKVCKVPISHNYAISEFKEMFKKVFIQTGLEETPTVVMVTNLQE-EHVSFLEDLNYIINAGKISNMFENEELDSIVMRVGTFAEQLTCIEDRKYLLSLFQRRVSKNLHICM-ISATGPNFRHNCRVYPSMISSCTIDWFQRWPDEALLVVA------SSYLKEKLKVEDKEDKIREFAPTCVEIHKSMKDLSAKYFEETGKHYYITPSCYFKFLETFTHSLRIRQEEMQTKRNRFYMGLSKILEATVLVTDMQEELLVIGPQIEQKAKEKE 3022          

HSP 4 Score: 50.0618 bits (118), Expect = 0.000e+0
Identity = 38/117 (32.48%), Postives = 56/117 (47.86%), Query Frame = 2
Query: 13400 DH---GVLVFGLYLDNALWNLENSSLAINPIHRRYCKLP-IIHLMAVISEKNKKEDS-------YTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCE 13717
            DH   GV +FGL+++ A W+ E   L  +   +  C+ P I+ L   I+E +  +DS        TF CP+Y TP R    +  G  +  L  + L + + PS WI    A L  CE
Sbjct: 4481 DHSPKGVYIFGLFMEGARWDPEQEVLEDSLPSQLCCEFPDILFLPTKITEPSASQDSDQTASDLQTFECPVYYTPERSR--NMIGLPTTVLTSVHLPTKKPPSHWITMQVALL--CE 4593          

HSP 5 Score: 85.1149 bits (209), Expect = 3.102e-15
Identity = 74/282 (26.24%), Postives = 124/282 (43.97%), Query Frame = 2
Query:  446 FQVVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDENSDENKKSKIKNIPIF 1291
             Q V+A  AK  K FW V+AS V+ +   KT  N  D+        +  P   WL+E+  F+ L     F  FR  KAF TW+ N+   K    R++L  +L   D +FQ  +  V  L ED L     N + S   + +  +D S+T+ L +F + QL Q       L ++ S  +  + K+     +K N+  Y E    E N         H +  + R  ++    FLKL+D    +L  +++   +++       S     + ++  +S +++  IF
Sbjct:  184 LQAVSAHRAKSCKEFWMVTASFVSKI--TKTGLNMEDV--------ELMPTMDWLYERHYFYLLQKFKIFYNFRLNKAFVTWKLNVKRRKTETSRSYLYNHLFCADELFQTSLLYVRGLCEDALTLKKKNKDNS-STICLIKVDTSRTHVLEKFCEEQLQQATQAVAQLEEIRSKAIVEIKKSALKVAEKKNVKEYFESKPSEINT-------THFKLPQYRNLLETNLRFLKLIDYLFQELIRQLMNSALTQLLDLFTGSARMPFSKEKKNESLMRDRKIF 447          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Mouse
Match: Dnah6 (dynein, axonemal, heavy chain 6 [Source:MGI Symbol;Acc:MGI:107744])

HSP 1 Score: 767.689 bits (1981), Expect = 0.000e+0
Identity = 434/1188 (36.53%), Postives = 681/1188 (57.32%), Query Frame = 2
Query: 1976 EALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNK-NFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXX---------------XXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPD--QIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLIN 5479
            EALK+     EP+ Q+   + +K+  Q+ + +        T+ +G + + TK L +   P   + + ++N  L   +    D  I+  + A   L+  P T  E+V  L F+++I   + ++++EA  + QM+ +I  ++VP   E  A++ T+  +I  ++N +      ++ +I++F   L + +E++   + E+K  A++   LD +  Q  I   L  L++ + DL  +   Y +YQ+ F   +SK          FD             +EEV  ++ ++ LLW++ SEW+   + ++  K D  +   +   V++    V  LEK LP N ++P +K  V + K  LPVII LRNP L+ RHW  IE+ +   L   +   T+  L    +  + Q I +IS  A+ E  LE +L KV+D +   EF ++ H + +D +I+ G DDI V L++S + I+TI  S+YV  ++++V+DW+++LS   + L+EW+NCQ++WLYLE IF   DIQRQLP E ++F +VD  W+ +M++    P  L+  T+ G+L+  Q  N+ L++IQK LE YLE KR+IFPR +FLSNDELLEIL++ ++P+ VQ HL K F ++ KL+          I                 ++S EGE   L + ++ RG  E+WL  +E+ +F  ++R  K  + + + K   +W +     Q IL  +Q+ + ++++ +L+     E   +  +        + L  LA  V  ++    R  + A+I I VH RD    L++  V S   F+W++Q+RY W+     C      S + Y  EYLG  PRLVITPLTDRCY+ + GAL  +LGG   GPAGTGKTET KDL+K +  QCVVFNCSD LD   + +  SG+ Q G+WCCFDEFNR+++EVLSVIA Q+ +I+ AK ++  RF+FE +EIKL   C  FITMNP YAGR ELPDNL  LFRP+AMMVP+Y LI EVIL+SEGF ++K+L+ K+T +Y+LC++QLS Q HYDFG+R++KSVL++ G L+ E   +SE V         +LI+A++ SN P+ +TDD  LF  I+ DLF    ++ E+D  + +S  +    +   + P+   ++K+  L   +  RHGVML+GP+  GKT +  +L + L  L  +N
Sbjct:  630 EALKQ----EEPDVQFFSSQLEKYHKQHKDSV----ALRPTRNVGLLLIDTKQLKEKLIPSPLRCLEVLNSMLPCLSKKKVDAIISEAQDAEYKLEFMPTTTIEYVNSLVFLDEIQERIETLEEEANVVVQMYKLIEQYQVPTPPEDFAVFATMKPSITAVRNAIDKSVGDRETSIKQFCLHLGRDLEDLNNEVNEVKLLAQDPQILDISADQEKIKTMLSDLQSVLDDLQKRAFQYKSYQKNFKVEVSK----------FDA------------LEEVSAELRLKQLLWDSLSEWDNLQQEWLKSKFDCLDPEVLNSQVTKYAKFVTQLEKGLPPNSVVPQLKQKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDALLVDTEIPLTLERLSELHVFNFAQEIQDISGQASGEAALEIILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINIATIASSRYVGPLKSRVDDWQKQLSLFNQTLEEWLNCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPTEGKIPGMDTEPEKVFTNDILAMLSPEGERVGLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKPRTEWVIAGHPSQVILTISQIMWCRDLTESLEC----EGDNVDALEDFEQVNFERLNALAAIVRGNLPKLHRNIITALITIDVHARDIVSELVQAKVDSADSFDWQRQLRYYWDMDLDNCVARMALSQYTYAYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLSEDV---------VLIRALRDSNLPKFLTDDALLFSGIISDLFPGV-QIPEHDYGILQSTIVEVM-INQNLQPELCMVKKVIQLYETMLVRHGVMLVGPTGGGKTTVYQVLAETLGNLEKLN 1772          

HSP 2 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 430/1379 (31.18%), Postives = 690/1379 (50.04%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIE--WLTLEVWNKCKFLEIELKDKFSGLCNSFKLTP--------ETWIKWNLSENPFDMSSYNFKEFSVKYLN--SFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTD-FQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDII-VQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLP 13292
            ET+A+ +     + DL    P LEA+ KALDSL+KA ISE+RV+  PP LV  VM A+ +LL+  P W  AK LLGD+NFL++LL Y+K+ I  ++   LQ+Y    DF PE V  VS AC+S+C WV A++ Y  V   + PKR+ +  A+  L+ +   L+ KQ  LK+VED IK L +KY+  V E++ L + + LT  RL RA  L  A+  E+ RW  SI+   +   NI+G+   +AA   + G +T  YR++  + WI+      IPI+ ++  +      Y I  W+ +GLPRD    EN  ++ + ++WPL+IDPQ Q  R+++    K   +VI     +++ +LE +IR+G  + LE++   +DP L P+L K+ F  G   +I LG+++++Y  SF+ Y+ S + NP  +  V   VTIINFTV   GLE+QLLS +V  EKPE+E +R + +    +D   L+++EDK L LL  S   I+++ EL   L+ SKIT+  IK RL+E    E  + +AR+ Y P+A +G+ +YFV+A L  ++ MYQYSL +F+ LF   ++    E  +N+      +L+ ++      +Y   S GLF  H+ +++FML   IMR        ++ + +W  F++                S G   ++P   E  WL +++W  C  LE E    F GL     L P        ET+I   + E  +    +  ++  V  L+  SF KLIL+      K++ +   +V   LG++F      +L  L+ +     P+VFIL   SDP+    +   E  G    +  +S+G+GQ   AE +I K  +  G W+FLQNC L +SWM ++++LI+      Q     F+L LS+ P S FP+ +LQNS+K+  E P G++  + ++F         E I   +    RK+IF +C F+A++ ER+ +G LG+++ Y+FNDSD E ++  +  +    ++ W+AL  + G I YGGR+TD  D+RCL  +L+ + S     +  +       +    L D  Q    +I   D  +     + G+ +NA +V    ++ + I  I+ VQ       Q  ++     +++  I  ++P S++                    LF      +KD   R N  +               VL QE+ ++N LL  IH  ++ L   ++G   ++E +E V      N VP            S WS+     +  +G W                                       K+ + + +  +L+ K R     +W+ GFF PQ  +T  +QN AR  +  ID L+    ++P
Sbjct: 2756 ETQAIAD---DAQRDLEEALPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPTAKQLLGDSNFLRRLLEYDKENIKPQILLKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKEVEPKRQKLRAAQAELDATMATLKEKQALLKQVEDQIKTLQDKYEKGVNEKESLAKNMALTKARLIRAGKLTAALGDEQVRWEESIEKFQEELANIVGNVFIAAACVAYYGAFTAQYRQLLIEWWIESCLALEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKVIKLTDTNFLRILENSIRLGLPVLLEELREVLDPALEPILLKQTFMSGGRLLIHLGDSDIDYDKSFRFYMTSKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRIQLIVRINSDKNQLKSIEDKILKLLFTSEGNILDNEELIDTLQDSKITSGAIKTRLKEAESTELMINIARERYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIE--TSEKSDNL----HERLKILLQQTLLTAYTNVSRGLFEQHKLIYSFMLCVDIMR-----EHEQLTEAEWNFFLR---------------GSAGMEKERPPKPEAPWLPIQMWFSCCDLE-ESFPIFEGLTKHILLRPISIKLGSFETYINPPVWEG-YPKQRHEEEKDHVWGLDFSSFHKLILVKCCKEEKVVFALTDFVIENLGKQFIETPPVDLATLYQDMSNSTPLVFILSTGSDPMGAFQRFARE-SGYAERVQSISLGQGQGPIAEKMI-KDAMKTGNWVFLQNCHLAVSWMLAMEELIKTFTDPNQTIKDTFRLFLSSMPCSTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGMK---WRKLIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLNLYCHEGKIPWDALIYITGEITYGGRVTDTWDQRCLRTVLKRFFSPETLDD--DYTYSDSGIYFAPLADSLQDFKEYIE--DLPLIDDPEIFGMHENANLVFQYKETNTLITTILEVQPRSSSGGQGKSNDEIVQELVASIQTRVPESLQMEGASE-------------SLF------VKDPQGRLNSLTT--------------VLGQEVDRFNNLLKLIHISLETLNKAIAGLVVMSEEMEKVYQSFLNNQVP------------SLWSNTAYPSLKPLGSWV--------------------------------------KDLILRTEFVDLWLK-RGQPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYNMIP 4010          

HSP 3 Score: 464.922 bits (1195), Expect = 0.000e+0
Identity = 294/1056 (27.84%), Postives = 531/1056 (50.28%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLS-KCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKP--EDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            +WI+ DGP+++ W+EN+NTVLDD+++LCLAN ERI +   +  LFEV DL+ +SPATVSRC M++V  + + W   VK+WM+  + K   +  +E+L  LF + +  G+ F++ KC+  Q IP                                   +D SK  +   + ES    +D              + L     +LN +L + +VF Y WS G                               D FD F+++ FD+N +   RLP  +  ++S  +D D     PW+ ++P+ K   D                     ++ + D++RY +L   L+   H VL  G +G+GKS++   +L +I    G                                                YVP      +Y  + F++QTS ++  + + SK+ ++ ++I+G P NK++++F+DDLN+P +D +GSQ  +E++RQ+ +  GF+D   L W  + D +++ AC+P    ++P++ R  +HF +L LP PS ++ ++IFQ  +  +    DF   +K   ++IV+  + +Y +       +P KSHY+FNLR L K + G+L  D   +  +  + +   HE  R  HDRLI++ D+  F  IL++  +    +    +      I+FG F    G+  S ++Y  + D+EK+    +  ++ ++  +      +FF+ +I+H+ R  R++ Q  G+ L++GV G GK S  ++++ I G    ++ ++  YN  +F  D++K+   + ++++  V   +D   +V + F++D+ N++NSG +P+L+E DELE++L+  +P  +++G  S  + ++V+   I ++++ LH+ + +SP    +RSR R  PSL+NCCTIDW++ W  E+L+SV+         +F   ++T  +D    L+   + ++ +   +  ++  ELRR Y+ +   ++E +N +  +L     +  S R R+  GL +L+ET  L+ KMK DL  L P + +KS++ E
Sbjct: 1828 KWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMRT-MSKKLNDEVQEYLLNLFNRYVDDGLHFVNKKCT--QAIPQ----------------------------------VDISKVTTLCCLLESLLLSKDG-------------NILSMEQMKLNTVLCQTFVFCYLWSLGGNLTEN-----------------------YWDSFDTFIRTQFDDNPDA--RLP-SSGDLWSIHIDFDTKRLDPWERIIPTFKYSRDVPFF---------------EMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVIAKGLLNRIQESAG------------------------------------------------YVP------VY--LNFSAQTSSSRTQEIIESKLERKRKNILGAPGNKQVVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIVSACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFL--ADFPEAVKQTSSNIVEAAVEIYNRMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREELQIFRLFCHECQRVFHDRLINNEDKHYFHLILTEMANKHFGIAIDLEYFLSKPIIFGDFIKF-GAEKSDRIYDDLPDMEKIENVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCMQIELSRGYNYDNFHEDLRKLYKMAGVEDKDMVFLFTDT-QIVVEEFLEDINNILNSGEVPNLFEKDELEHVLAATRPKAKEVGI-SEGNRDEVFQYFISRVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSK--------SFFSSVDTGNDDLREKLSLMCVNVHLSVSHMAERYYNELRRRYYTTPTSYLELINLYLTMLTEKRKQLVSARDRVKNGLTKLLETNVLVDKMKLDLSALEPVLLQKSQDVE 2723          

HSP 4 Score: 38.5058 bits (88), Expect = 0.000e+0
Identity = 21/81 (25.93%), Postives = 43/81 (53.09%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +   V+NPK++++  LYG VN  +LEW +G++ +  +  ++ ++++   +      D    EN N     N +  L N+E+
Sbjct: 1781 VKTYVLNPKSITMGELYGEVNNVTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSER 1861          

HSP 5 Score: 67.781 bits (164), Expect = 5.428e-10
Identity = 39/117 (33.33%), Postives = 66/117 (56.41%), Query Frame = 2
Query: 13382 KTMYNPDHGVLVFGLYLDNALWNLENSSL------AINPIHRRYCKLPIIHLMAVISEKNKKEDSYT-FLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            K + +P+ GVLV G+++D + W+ ++  +       +NP+      LP++H       K   E  +T +  PLY+T +R G LS++G S+NF+  + L S RI  +WI +G+A L Q
Sbjct: 4035 KELPSPEDGVLVHGMFMDASRWDDKDMVIEDALPGQMNPM------LPVVHF----EPKQNYEPVHTLYHSPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRISDYWISKGSALLCQ 4141          

HSP 6 Score: 58.9214 bits (141), Expect = 2.575e-7
Identity = 43/171 (25.15%), Postives = 74/171 (43.27%), Query Frame = 2
Query:  488 FWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQ 1000
            ++T+S  +VT VY +       DI  I +         +W  E +   +LT +  F  FR WKAF  WR N+ + K+   R  L  NL  ++P  +  + K++ +   L              + + +I+   TY L EF   Q+ +++   E L        + V K+C+
Sbjct:  230 YYTISKDAVTHVYND-------DIEYIEIE--------RWEQEYLYHRELTKIPIFALFRKWKAFSVWRKNVRSKKITGCRKALRKNLFIVNPYLRPALLKINEMCYLL------------SFMGLCYIEKFHTYTLQEFKAAQIVRLQEVTERLEVFRCAAKDVVRKSCR 373          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Mouse
Match: Dnah6 (dynein, axonemal, heavy chain 6 [Source:MGI Symbol;Acc:MGI:107744])

HSP 1 Score: 767.689 bits (1981), Expect = 0.000e+0
Identity = 434/1188 (36.53%), Postives = 681/1188 (57.32%), Query Frame = 2
Query: 1976 EALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNK-NFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXX---------------XXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPD--QIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLIN 5479
            EALK+     EP+ Q+   + +K+  Q+ + +        T+ +G + + TK L +   P   + + ++N  L   +    D  I+  + A   L+  P T  E+V  L F+++I   + ++++EA  + QM+ +I  ++VP   E  A++ T+  +I  ++N +      ++ +I++F   L + +E++   + E+K  A++   LD +  Q  I   L  L++ + DL  +   Y +YQ+ F   +SK          FD             +EEV  ++ ++ LLW++ SEW+   + ++  K D  +   +   V++    V  LEK LP N ++P +K  V + K  LPVII LRNP L+ RHW  IE+ +   L   +   T+  L    +  + Q I +IS  A+ E  LE +L KV+D +   EF ++ H + +D +I+ G DDI V L++S + I+TI  S+YV  ++++V+DW+++LS   + L+EW+NCQ++WLYLE IF   DIQRQLP E ++F +VD  W+ +M++    P  L+  T+ G+L+  Q  N+ L++IQK LE YLE KR+IFPR +FLSNDELLEIL++ ++P+ VQ HL K F ++ KL+          I                 ++S EGE   L + ++ RG  E+WL  +E+ +F  ++R  K  + + + K   +W +     Q IL  +Q+ + ++++ +L+     E   +  +        + L  LA  V  ++    R  + A+I I VH RD    L++  V S   F+W++Q+RY W+     C      S + Y  EYLG  PRLVITPLTDRCY+ + GAL  +LGG   GPAGTGKTET KDL+K +  QCVVFNCSD LD   + +  SG+ Q G+WCCFDEFNR+++EVLSVIA Q+ +I+ AK ++  RF+FE +EIKL   C  FITMNP YAGR ELPDNL  LFRP+AMMVP+Y LI EVIL+SEGF ++K+L+ K+T +Y+LC++QLS Q HYDFG+R++KSVL++ G L+ E   +SE V         +LI+A++ SN P+ +TDD  LF  I+ DLF    ++ E+D  + +S  +    +   + P+   ++K+  L   +  RHGVML+GP+  GKT +  +L + L  L  +N
Sbjct:  630 EALKQ----EEPDVQFFSSQLEKYHKQHKDSV----ALRPTRNVGLLLIDTKQLKEKLIPSPLRCLEVLNSMLPCLSKKKVDAIISEAQDAEYKLEFMPTTTIEYVNSLVFLDEIQERIETLEEEANVVVQMYKLIEQYQVPTPPEDFAVFATMKPSITAVRNAIDKSVGDRETSIKQFCLHLGRDLEDLNNEVNEVKLLAQDPQILDISADQEKIKTMLSDLQSVLDDLQKRAFQYKSYQKNFKVEVSK----------FDA------------LEEVSAELRLKQLLWDSLSEWDNLQQEWLKSKFDCLDPEVLNSQVTKYAKFVTQLEKGLPPNSVVPQLKQKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDALLVDTEIPLTLERLSELHVFNFAQEIQDISGQASGEAALEIILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINIATIASSRYVGPLKSRVDDWQKQLSLFNQTLEEWLNCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPTEGKIPGMDTEPEKVFTNDILAMLSPEGERVGLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKPRTEWVIAGHPSQVILTISQIMWCRDLTESLEC----EGDNVDALEDFEQVNFERLNALAAIVRGNLPKLHRNIITALITIDVHARDIVSELVQAKVDSADSFDWQRQLRYYWDMDLDNCVARMALSQYTYAYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLSEDV---------VLIRALRDSNLPKFLTDDALLFSGIISDLFPGV-QIPEHDYGILQSTIVEVM-INQNLQPELCMVKKVIQLYETMLVRHGVMLVGPTGGGKTTVYQVLAETLGNLEKLN 1772          

HSP 2 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 430/1379 (31.18%), Postives = 690/1379 (50.04%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIE--WLTLEVWNKCKFLEIELKDKFSGLCNSFKLTP--------ETWIKWNLSENPFDMSSYNFKEFSVKYLN--SFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTD-FQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDII-VQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLP 13292
            ET+A+ +     + DL    P LEA+ KALDSL+KA ISE+RV+  PP LV  VM A+ +LL+  P W  AK LLGD+NFL++LL Y+K+ I  ++   LQ+Y    DF PE V  VS AC+S+C WV A++ Y  V   + PKR+ +  A+  L+ +   L+ KQ  LK+VED IK L +KY+  V E++ L + + LT  RL RA  L  A+  E+ RW  SI+   +   NI+G+   +AA   + G +T  YR++  + WI+      IPI+ ++  +      Y I  W+ +GLPRD    EN  ++ + ++WPL+IDPQ Q  R+++    K   +VI     +++ +LE +IR+G  + LE++   +DP L P+L K+ F  G   +I LG+++++Y  SF+ Y+ S + NP  +  V   VTIINFTV   GLE+QLLS +V  EKPE+E +R + +    +D   L+++EDK L LL  S   I+++ EL   L+ SKIT+  IK RL+E    E  + +AR+ Y P+A +G+ +YFV+A L  ++ MYQYSL +F+ LF   ++    E  +N+      +L+ ++      +Y   S GLF  H+ +++FML   IMR        ++ + +W  F++                S G   ++P   E  WL +++W  C  LE E    F GL     L P        ET+I   + E  +    +  ++  V  L+  SF KLIL+      K++ +   +V   LG++F      +L  L+ +     P+VFIL   SDP+    +   E  G    +  +S+G+GQ   AE +I K  +  G W+FLQNC L +SWM ++++LI+      Q     F+L LS+ P S FP+ +LQNS+K+  E P G++  + ++F         E I   +    RK+IF +C F+A++ ER+ +G LG+++ Y+FNDSD E ++  +  +    ++ W+AL  + G I YGGR+TD  D+RCL  +L+ + S     +  +       +    L D  Q    +I   D  +     + G+ +NA +V    ++ + I  I+ VQ       Q  ++     +++  I  ++P S++                    LF      +KD   R N  +               VL QE+ ++N LL  IH  ++ L   ++G   ++E +E V      N VP            S WS+     +  +G W                                       K+ + + +  +L+ K R     +W+ GFF PQ  +T  +QN AR  +  ID L+    ++P
Sbjct: 2756 ETQAIAD---DAQRDLEEALPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPTAKQLLGDSNFLRRLLEYDKENIKPQILLKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKEVEPKRQKLRAAQAELDATMATLKEKQALLKQVEDQIKTLQDKYEKGVNEKESLAKNMALTKARLIRAGKLTAALGDEQVRWEESIEKFQEELANIVGNVFIAAACVAYYGAFTAQYRQLLIEWWIESCLALEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKVIKLTDTNFLRILENSIRLGLPVLLEELREVLDPALEPILLKQTFMSGGRLLIHLGDSDIDYDKSFRFYMTSKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRIQLIVRINSDKNQLKSIEDKILKLLFTSEGNILDNEELIDTLQDSKITSGAIKTRLKEAESTELMINIARERYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIE--TSEKSDNL----HERLKILLQQTLLTAYTNVSRGLFEQHKLIYSFMLCVDIMR-----EHEQLTEAEWNFFLR---------------GSAGMEKERPPKPEAPWLPIQMWFSCCDLE-ESFPIFEGLTKHILLRPISIKLGSFETYINPPVWEG-YPKQRHEEEKDHVWGLDFSSFHKLILVKCCKEEKVVFALTDFVIENLGKQFIETPPVDLATLYQDMSNSTPLVFILSTGSDPMGAFQRFARE-SGYAERVQSISLGQGQGPIAEKMI-KDAMKTGNWVFLQNCHLAVSWMLAMEELIKTFTDPNQTIKDTFRLFLSSMPCSTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGMK---WRKLIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLNLYCHEGKIPWDALIYITGEITYGGRVTDTWDQRCLRTVLKRFFSPETLDD--DYTYSDSGIYFAPLADSLQDFKEYIE--DLPLIDDPEIFGMHENANLVFQYKETNTLITTILEVQPRSSSGGQGKSNDEIVQELVASIQTRVPESLQMEGASE-------------SLF------VKDPQGRLNSLTT--------------VLGQEVDRFNNLLKLIHISLETLNKAIAGLVVMSEEMEKVYQSFLNNQVP------------SLWSNTAYPSLKPLGSWV--------------------------------------KDLILRTEFVDLWLK-RGQPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYNMIP 4010          

HSP 3 Score: 464.922 bits (1195), Expect = 0.000e+0
Identity = 294/1056 (27.84%), Postives = 531/1056 (50.28%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLS-KCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKP--EDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            +WI+ DGP+++ W+EN+NTVLDD+++LCLAN ERI +   +  LFEV DL+ +SPATVSRC M++V  + + W   VK+WM+  + K   +  +E+L  LF + +  G+ F++ KC+  Q IP                                   +D SK  +   + ES    +D              + L     +LN +L + +VF Y WS G                               D FD F+++ FD+N +   RLP  +  ++S  +D D     PW+ ++P+ K   D                     ++ + D++RY +L   L+   H VL  G +G+GKS++   +L +I    G                                                YVP      +Y  + F++QTS ++  + + SK+ ++ ++I+G P NK++++F+DDLN+P +D +GSQ  +E++RQ+ +  GF+D   L W  + D +++ AC+P    ++P++ R  +HF +L LP PS ++ ++IFQ  +  +    DF   +K   ++IV+  + +Y +       +P KSHY+FNLR L K + G+L  D   +  +  + +   HE  R  HDRLI++ D+  F  IL++  +    +    +      I+FG F    G+  S ++Y  + D+EK+    +  ++ ++  +      +FF+ +I+H+ R  R++ Q  G+ L++GV G GK S  ++++ I G    ++ ++  YN  +F  D++K+   + ++++  V   +D   +V + F++D+ N++NSG +P+L+E DELE++L+  +P  +++G  S  + ++V+   I ++++ LH+ + +SP    +RSR R  PSL+NCCTIDW++ W  E+L+SV+         +F   ++T  +D    L+   + ++ +   +  ++  ELRR Y+ +   ++E +N +  +L     +  S R R+  GL +L+ET  L+ KMK DL  L P + +KS++ E
Sbjct: 1828 KWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMRT-MSKKLNDEVQEYLLNLFNRYVDDGLHFVNKKCT--QAIPQ----------------------------------VDISKVTTLCCLLESLLLSKDG-------------NILSMEQMKLNTVLCQTFVFCYLWSLGGNLTEN-----------------------YWDSFDTFIRTQFDDNPDA--RLP-SSGDLWSIHIDFDTKRLDPWERIIPTFKYSRDVPFF---------------EMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVIAKGLLNRIQESAG------------------------------------------------YVP------VY--LNFSAQTSSSRTQEIIESKLERKRKNILGAPGNKQVVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIVSACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFL--ADFPEAVKQTSSNIVEAAVEIYNRMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREELQIFRLFCHECQRVFHDRLINNEDKHYFHLILTEMANKHFGIAIDLEYFLSKPIIFGDFIKF-GAEKSDRIYDDLPDMEKIENVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCMQIELSRGYNYDNFHEDLRKLYKMAGVEDKDMVFLFTDT-QIVVEEFLEDINNILNSGEVPNLFEKDELEHVLAATRPKAKEVGI-SEGNRDEVFQYFISRVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSK--------SFFSSVDTGNDDLREKLSLMCVNVHLSVSHMAERYYNELRRRYYTTPTSYLELINLYLTMLTEKRKQLVSARDRVKNGLTKLLETNVLVDKMKLDLSALEPVLLQKSQDVE 2723          

HSP 4 Score: 38.5058 bits (88), Expect = 0.000e+0
Identity = 21/81 (25.93%), Postives = 43/81 (53.09%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +   V+NPK++++  LYG VN  +LEW +G++ +  +  ++ ++++   +      D    EN N     N +  L N+E+
Sbjct: 1781 VKTYVLNPKSITMGELYGEVNNVTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSER 1861          

HSP 5 Score: 67.781 bits (164), Expect = 5.428e-10
Identity = 39/117 (33.33%), Postives = 66/117 (56.41%), Query Frame = 2
Query: 13382 KTMYNPDHGVLVFGLYLDNALWNLENSSL------AINPIHRRYCKLPIIHLMAVISEKNKKEDSYT-FLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            K + +P+ GVLV G+++D + W+ ++  +       +NP+      LP++H       K   E  +T +  PLY+T +R G LS++G S+NF+  + L S RI  +WI +G+A L Q
Sbjct: 4035 KELPSPEDGVLVHGMFMDASRWDDKDMVIEDALPGQMNPM------LPVVHF----EPKQNYEPVHTLYHSPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRISDYWISKGSALLCQ 4141          

HSP 6 Score: 58.9214 bits (141), Expect = 2.575e-7
Identity = 43/171 (25.15%), Postives = 74/171 (43.27%), Query Frame = 2
Query:  488 FWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQ 1000
            ++T+S  +VT VY +       DI  I +         +W  E +   +LT +  F  FR WKAF  WR N+ + K+   R  L  NL  ++P  +  + K++ +   L              + + +I+   TY L EF   Q+ +++   E L        + V K+C+
Sbjct:  230 YYTISKDAVTHVYND-------DIEYIEIE--------RWEQEYLYHRELTKIPIFALFRKWKAFSVWRKNVRSKKITGCRKALRKNLFIVNPYLRPALLKINEMCYLL------------SFMGLCYIEKFHTYTLQEFKAAQIVRLQEVTERLEVFRCAAKDVVRKSCR 373          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Mouse
Match: Dnah6 (dynein, axonemal, heavy chain 6 [Source:MGI Symbol;Acc:MGI:107744])

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 411/1188 (34.60%), Postives = 651/1188 (54.80%), Query Frame = 2
Query: 1976 EALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNK-NFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXX---------------XXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPD--QIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLIN 5479
            EALK+     EP+ Q+   + +K+  Q+ + +        T+ +G + + TK L +   P   + + ++N  L   +    D  I+  + A   L+  P T  E+V  L F+++I   + ++++EA  + QM+ +I  ++VP   E  A++ T+  +I  ++N +      ++ +I++F   L + +E++   + E+K  A++   LD +  Q  I   L  L++ + DL  +   Y +YQ+ F   +SK          FD             +EEV  ++ ++ LLW++ SEW+   + ++  K D  +   +   V++    V  LEK LP N ++P +K  V + K  LPVII LRNP L+ RHW  IE+ +   L   +   T+  L    +  + Q I +IS  A+ E  LE +L KV+D +   EF ++ H + +D +I+ G DDI V L++S + I+TI  S+YV  ++++V+DW+++LS   + L+EW+NCQ++WLYLE IF   DIQRQLP E ++F +VD  W+ +M++    P  L+  T+ G+L+  Q  N+ L++IQK LE YLE KR+IFPR +FLSNDELLEIL++ ++P+ VQ HL K F ++ KL+          I                 ++S EGE   L + ++ RG  E+WL  +E+ +F  ++R  K  + + + K   +W +     Q IL  +Q+ + ++++ +L+     E   +  +        + L  LA  V  ++    R  + A+I I VH RD    L++                        +C              YL              C M   GAL  +LGG   GPAGTGKTET KDL+K +  QCVVFNCSD LD   + +  SG+ Q G+WCCFDEFNR+++EVLSVIA Q+ +I+ AK ++  RF+FE +EIKL   C  FITMNP YAGR ELPDNL  LFRP+AMMVP+Y LI EVIL+SEGF ++K+L+ K+T +Y+LC++QLS Q HYDFG+R++KSVL++ G L+ E   +SE V         +LI+A++ SN P+ +TDD  LF  I+ DLF    ++ E+D  + +S  +    +   + P+   ++K+  L   +  RHGVML+GP+  GKT +  +L + L  L  +N
Sbjct:  630 EALKQ----EEPDVQFFSSQLEKYHKQHKDSV----ALRPTRNVGLLLIDTKQLKEKLIPSPLRCLEVLNSMLPCLSKKKVDAIISEAQDAEYKLEFMPTTTIEYVNSLVFLDEIQERIETLEEEANVVVQMYKLIEQYQVPTPPEDFAVFATMKPSITAVRNAIDKSVGDRETSIKQFCLHLGRDLEDLNNEVNEVKLLAQDPQILDISADQEKIKTMLSDLQSVLDDLQKRAFQYKSYQKNFKVEVSK----------FDA------------LEEVSAELRLKQLLWDSLSEWDNLQQEWLKSKFDCLDPEVLNSQVTKYAKFVTQLEKGLPPNSVVPQLKQKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDALLVDTEIPLTLERLSELHVFNFAQEIQDISGQASGEAALEIILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINIATIASSRYVGPLKSRVDDWQKQLSLFNQTLEEWLNCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPTEGKIPGMDTEPEKVFTNDILAMLSPEGERVGLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKPRTEWVIAGHPSQVILTISQIMWCRDLTESLEC----EGDNVDALEDFEQVNFERLNALAAIVRGNLPKLHRNIITALITIDVHARDIVSELVQA---------------------KDRC--------------YL--------------CLM---GALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLSEDV---------VLIRALRDSNLPKFLTDDALLFSGIISDLFPGV-QIPEHDYGILQSTIVEVM-INQNLQPELCMVKKVIQLYETMLVRHGVMLVGPTGGGKTTVYQVLAETLGNLEKLN 1720          

HSP 2 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 430/1379 (31.18%), Postives = 690/1379 (50.04%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIE--WLTLEVWNKCKFLEIELKDKFSGLCNSFKLTP--------ETWIKWNLSENPFDMSSYNFKEFSVKYLN--SFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTD-FQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDII-VQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLP 13292
            ET+A+ +     + DL    P LEA+ KALDSL+KA ISE+RV+  PP LV  VM A+ +LL+  P W  AK LLGD+NFL++LL Y+K+ I  ++   LQ+Y    DF PE V  VS AC+S+C WV A++ Y  V   + PKR+ +  A+  L+ +   L+ KQ  LK+VED IK L +KY+  V E++ L + + LT  RL RA  L  A+  E+ RW  SI+   +   NI+G+   +AA   + G +T  YR++  + WI+      IPI+ ++  +      Y I  W+ +GLPRD    EN  ++ + ++WPL+IDPQ Q  R+++    K   +VI     +++ +LE +IR+G  + LE++   +DP L P+L K+ F  G   +I LG+++++Y  SF+ Y+ S + NP  +  V   VTIINFTV   GLE+QLLS +V  EKPE+E +R + +    +D   L+++EDK L LL  S   I+++ EL   L+ SKIT+  IK RL+E    E  + +AR+ Y P+A +G+ +YFV+A L  ++ MYQYSL +F+ LF   ++    E  +N+      +L+ ++      +Y   S GLF  H+ +++FML   IMR        ++ + +W  F++                S G   ++P   E  WL +++W  C  LE E    F GL     L P        ET+I   + E  +    +  ++  V  L+  SF KLIL+      K++ +   +V   LG++F      +L  L+ +     P+VFIL   SDP+    +   E  G    +  +S+G+GQ   AE +I K  +  G W+FLQNC L +SWM ++++LI+      Q     F+L LS+ P S FP+ +LQNS+K+  E P G++  + ++F         E I   +    RK+IF +C F+A++ ER+ +G LG+++ Y+FNDSD E ++  +  +    ++ W+AL  + G I YGGR+TD  D+RCL  +L+ + S     +  +       +    L D  Q    +I   D  +     + G+ +NA +V    ++ + I  I+ VQ       Q  ++     +++  I  ++P S++                    LF      +KD   R N  +               VL QE+ ++N LL  IH  ++ L   ++G   ++E +E V      N VP            S WS+     +  +G W                                       K+ + + +  +L+ K R     +W+ GFF PQ  +T  +QN AR  +  ID L+    ++P
Sbjct: 2704 ETQAIAD---DAQRDLEEALPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPTAKQLLGDSNFLRRLLEYDKENIKPQILLKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKEVEPKRQKLRAAQAELDATMATLKEKQALLKQVEDQIKTLQDKYEKGVNEKESLAKNMALTKARLIRAGKLTAALGDEQVRWEESIEKFQEELANIVGNVFIAAACVAYYGAFTAQYRQLLIEWWIESCLALEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKVIKLTDTNFLRILENSIRLGLPVLLEELREVLDPALEPILLKQTFMSGGRLLIHLGDSDIDYDKSFRFYMTSKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRIQLIVRINSDKNQLKSIEDKILKLLFTSEGNILDNEELIDTLQDSKITSGAIKTRLKEAESTELMINIARERYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIE--TSEKSDNL----HERLKILLQQTLLTAYTNVSRGLFEQHKLIYSFMLCVDIMR-----EHEQLTEAEWNFFLR---------------GSAGMEKERPPKPEAPWLPIQMWFSCCDLE-ESFPIFEGLTKHILLRPISIKLGSFETYINPPVWEG-YPKQRHEEEKDHVWGLDFSSFHKLILVKCCKEEKVVFALTDFVIENLGKQFIETPPVDLATLYQDMSNSTPLVFILSTGSDPMGAFQRFARE-SGYAERVQSISLGQGQGPIAEKMI-KDAMKTGNWVFLQNCHLAVSWMLAMEELIKTFTDPNQTIKDTFRLFLSSMPCSTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGMK---WRKLIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLNLYCHEGKIPWDALIYITGEITYGGRVTDTWDQRCLRTVLKRFFSPETLDD--DYTYSDSGIYFAPLADSLQDFKEYIE--DLPLIDDPEIFGMHENANLVFQYKETNTLITTILEVQPRSSSGGQGKSNDEIVQELVASIQTRVPESLQMEGASE-------------SLF------VKDPQGRLNSLTT--------------VLGQEVDRFNNLLKLIHISLETLNKAIAGLVVMSEEMEKVYQSFLNNQVP------------SLWSNTAYPSLKPLGSWV--------------------------------------KDLILRTEFVDLWLK-RGQPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYNMIP 3958          

HSP 3 Score: 463.766 bits (1192), Expect = 0.000e+0
Identity = 296/1061 (27.90%), Postives = 537/1061 (50.61%), Query Frame = 1
Query: 5947 SKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSK-CSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKP--EDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            + ++ +WI+ DGP+++ W+EN+NTVLDD+++LCLAN ERI +   +  LFEV DL+ +SPATVSRC M++V  + + W   VK+WM+  + K   +  +E+L  LF + +  G+ F++K C+  Q IP                                   +D SK  +   + ES    +D              + L     +LN +L + +VF Y WS G                               D FD F+++ FD+N +   RLP  +  ++S  +D D     PW+ ++P+ K   D                     ++ + D++RY +L   L+   H VL  G +G+GKS++                                 + LL+ IQ                E + YVP      +Y  + F++QTS ++  + + SK+ ++ ++I+G P NK++++F+DDLN+P +D +GSQ  +E++RQ+ +  GF+D   L W  + D +++ AC+P    ++P++ R  +HF +L LP PS ++ ++IFQ  +  +    DF   +K   ++IV+  + +Y +       +P KSHY+FNLR L K + G+L  D   +  +  + +   HE  R  HDRLI++ D+  F  IL++  +    +    +      I+FG F    G+  S ++Y  + D+EK+    +  ++ ++  +      +FF+ +I+H+ R  R++ Q  G+ L++GV G GK S  ++++ I G    ++ ++  YN  +F  D++K+   + ++++  V   +D   +V + F++D+ N++NSG +P+L+E DELE++L+  +P  +++G  S  + ++V+   I ++++ LH+ + +SP    +RSR R  PSL+NCCTIDW++ W  E+L+SV+         +F   ++T  +D    L+   + ++ +   +  ++  ELRR Y+ +   ++E +N +  +L     +  S R R+  GL +L+ET  L+ KMK DL  L P + +KS++ E
Sbjct: 1771 TSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMRT-MSKKLNDEVQEYLLNLFNRYVDDGLHFVNKKCT--QAIPQ----------------------------------VDISKVTTLCCLLESLLLSKDG-------------NILSMEQMKLNTVLCQTFVFCYLWSLGGNLTEN-----------------------YWDSFDTFIRTQFDDNPDA--RLP-SSGDLWSIHIDFDTKRLDPWERIIPTFKYSRDVPFF---------------EMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVIA--------------------------------KGLLNRIQ----------------ESAGYVP------VY--LNFSAQTSSSRTQEIIESKLERKRKNILGAPGNKQVVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIVSACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFL--ADFPEAVKQTSSNIVEAAVEIYNRMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREELQIFRLFCHECQRVFHDRLINNEDKHYFHLILTEMANKHFGIAIDLEYFLSKPIIFGDFIKF-GAEKSDRIYDDLPDMEKIENVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCMQIELSRGYNYDNFHEDLRKLYKMAGVEDKDMVFLFTDT-QIVVEEFLEDINNILNSGEVPNLFEKDELEHVLAATRPKAKEVGI-SEGNRDEVFQYFISRVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSK--------SFFSSVDTGNDDLREKLSLMCVNVHLSVSHMAERYYNELRRRYYTTPTSYLELINLYLTMLTEKRKQLVSARDRVKNGLTKLLETNVLVDKMKLDLSALEPVLLQKSQDVE 2671          

HSP 4 Score: 38.5058 bits (88), Expect = 0.000e+0
Identity = 21/81 (25.93%), Postives = 43/81 (53.09%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +   V+NPK++++  LYG VN  +LEW +G++ +  +  ++ ++++   +      D    EN N     N +  L N+E+
Sbjct: 1729 VKTYVLNPKSITMGELYGEVNNVTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSER 1809          

HSP 5 Score: 67.781 bits (164), Expect = 5.200e-10
Identity = 39/117 (33.33%), Postives = 66/117 (56.41%), Query Frame = 2
Query: 13382 KTMYNPDHGVLVFGLYLDNALWNLENSSL------AINPIHRRYCKLPIIHLMAVISEKNKKEDSYT-FLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            K + +P+ GVLV G+++D + W+ ++  +       +NP+      LP++H       K   E  +T +  PLY+T +R G LS++G S+NF+  + L S RI  +WI +G+A L Q
Sbjct: 3983 KELPSPEDGVLVHGMFMDASRWDDKDMVIEDALPGQMNPM------LPVVHF----EPKQNYEPVHTLYHSPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRISDYWISKGSALLCQ 4089          

HSP 6 Score: 58.9214 bits (141), Expect = 2.346e-7
Identity = 43/171 (25.15%), Postives = 74/171 (43.27%), Query Frame = 2
Query:  488 FWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQ 1000
            ++T+S  +VT VY +       DI  I +         +W  E +   +LT +  F  FR WKAF  WR N+ + K+   R  L  NL  ++P  +  + K++ +   L              + + +I+   TY L EF   Q+ +++   E L        + V K+C+
Sbjct:  230 YYTISKDAVTHVYND-------DIEYIEIE--------RWEQEYLYHRELTKIPIFALFRKWKAFSVWRKNVRSKKITGCRKALRKNLFIVNPYLRPALLKINEMCYLL------------SFMGLCYIEKFHTYTLQEFKAAQIVRLQEVTERLEVFRCAAKDVVRKSCR 373          
BLAST of dynein heavy chain 6, axonemal vs. UniProt/SwissProt
Match: sp|Q9C0G6|DYH6_HUMAN (Dynein heavy chain 6, axonemal OS=Homo sapiens OX=9606 GN=DNAH6 PE=2 SV=3)

HSP 1 Score: 762.681 bits (1968), Expect = 0.000e+0
Identity = 427/1175 (36.34%), Postives = 675/1175 (57.45%), Query Frame = 2
Query: 1997 RISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNK-NFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXX---------------XXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLEND-KLLERSI--ELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKAL 5458
            ++ EP    DI+ F + L +  ++  D      T+ +G + + T+ L +   P   + + ++N  L +++    D  I   + A   L+  P T  E+V  L F+++I   + S++ E   + QM+ ++  ++VP   E  A++ T+  +I  ++N +      ++ +I++F   L   +EE+   + E+K +A++   LD +  Q  I   L  L++ + DL  +   Y +YQ+ F   +SK                       E +EEV  ++ ++ LLW++ SEW++  + ++  K D  +   +   VS+    V  LEK LP N ++P +K  V + K  LPVII LRNP L+ RHW  IE+ +  +L   +   T+  L    +  + Q I +IS  A+ E  LE +L KV+D +   EF ++ H + +D +I+ G DDI V L++S + ++T+  S+Y+  ++T+V++W+++L+   + L+EW+ CQ++WLYLE IF   DIQRQLP E ++F +VD  W+ +M++    P  L+  T+ G+L+  Q  N+ L++IQK LE YLE KR+IFPR +FLSNDELLEIL++ ++P+ VQ HL K F ++ KL+          I                 ++S EGE   L + ++ RG  E+WL  +E+ +F  ++R  K  + + + K   DW +     Q IL  +Q+ + ++++  L+      S  +  + +      + L  LA  V   +    R  L A+I I VH RD    L+++ V++   F+W++Q+RY W+     C      S + YG EYLG  PRLVITPLTDRCY+ + GAL  +LGG   GPAGTGKTET KDL+K +  QCVVFNCSD LD   + +  SG+ Q G+WCCFDEFNR+++EVLSVIA Q+ +I+ AK ++  RF+FE +EIKL   C  FITMNP YAGR ELPDNL  LFRP AMMVP+Y LI EVIL+SEGF ++K+L+ K+T +Y+LC++QLS Q HYDFG+R++KSVL++ G L+ E   ++E V         +LI+A++ SN P+ +TDD  LF  I+ DLF    ++ E+D  +L+ +I   ++ + L  E+    + K+      +  RHGVML+GP+  GKT +  IL + L
Sbjct:  637 KLQEP----DINFFSEQLEKYHKQHKDAVALRPTRNVGLLLIDTRLLREKLIPSPLRCLEVLNFMLPRQSKKKVDAIIFEAQDAEYKLEFVPTTTTEYVHSLLFLDEIQERIESLEDEGNIVTQMYKLMEQYQVPTPPEDFAVFATMKPSIVAVRNAIDKSVGDRESSIKQFCVHLGSDLEELNNEVNEVKLQAQDPQILDISADQDKIRLILNNLQSVLADLQKRAFQYKSYQKNFKVEVSKF----------------------EALEEVSAELKLKQLLWDSFSEWDKLQQEWLKSKFDCLDPEVLNGQVSKYAKFVTQLEKGLPPNSVVPQLKYKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDATLVDAEIPLTLERLSQLHVFDFGQEIQDISGQASGEAALEAILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINVATLASSRYLGPLKTRVDEWQKQLALFNQTLEEWLTCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPAEGKIPGIDGEPEKVYTNDILAMLSPEGERVSLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKLRTDWVVAGHPSQVILTVSQIMWCRDLTECLETE---HSNHIQALKNFEKVNFERLNALAAIVQGSLPKLHRNILTALITIDVHARDIVTELVQSKVETVESFDWQRQLRYYWDIDLDNCVARMALSQYTYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLNEDV---------VLIRALQDSNLPKFLTDDALLFSGIISDLFPGV-QIPEHDYGILQSTIVDVMNRQNLQPEMC--MVRKVIQFYETMLVRHGVMLVGPTGGGKTTVYRILAETL 1770          

HSP 2 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 428/1423 (30.08%), Postives = 696/1423 (48.91%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIE--WLTLEVWNKCKFLEIELKDKFSGLCNSFKLTP--------ETWIKWNLSENPFDMSSYNFKEFSVKY----------------LNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDII-VQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYS-ILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLPRNLLGDLEEYFAQSELFDVTKTYSTSEIIP 13382
            ET+A+ +     + DL    P L+A+ KALDSL+KA ISE+RV+  PP LV  VM A+ +LL+  P W +AK LLGD+NFL++LL Y+K+ I  ++   LQ+Y    DF PE V  VS AC+S+C WV A++ Y  V  ++ PKR+ +  A+  L+I+   L  KQ  L++VED I+ L ++Y   V E++ L + + LT  RL RA  L  A++ E+ RW  SI+  ++   NI G+   +AA   + G +T  YR+   + WI    +  IPI+ ++  +      Y I  W+ +GLPRD    EN  ++ + ++WPL+IDPQ Q  R+++    K   ++I     +++ +LE +IR+G  + LE+++  +DP L P+L K+ F  G   +I+LG+++++Y  +F+ Y+ + + NP  +  V   VTIINFTV   GLE+QLLS +V  EKP +E +R + +     D   L+ +E+K L +L  S   I+++ EL   L+ SKIT+  IK RLEE    E+ + +AR+ Y P+A +G+ +YFV+A L  ++ MYQYSL +F+ LF   ++   K   EN+    + +L  +++     +Y   S GLF  H+ +++FML   +MR     SD      +W  F++                S G   ++P   E  WL    W  C  LE E    F GL  +    P        ET+I      NP     Y+  +   K+                L+SF KLILI      K++ +   +V   LG++F      +L  L+ +     P+VFIL   SDP+    +   E  G +  +  +S+G+GQ   AE ++ K  +  G W+FLQNC L +SWM ++++LI+            F+L LS+ P + FP+ +LQNS+K+  E P G++  + ++F         E I   +  QI   IF +C F+A++ ER+ +G LG+++ Y+FNDSD E ++  +  +    ++ W+AL  + G I YGGR+TD+ D+RCL  +L+ + S        + + +S           Q    +I  N   ++  E + G+ +NA +V    ++ + I  I+ VQ       +  ++     +++  +  ++P  +E          F+KD +      G+L+                             VL QE+ ++N LL  IH  ++ L   ++G   ++E +E V +    N VP            + WS+     +  +G W    ILR     L L      S                                        YW+ GFF PQ  +T  +QN AR  +  ID L+    V+P         Y  Q+ + +  KT    + +P
Sbjct: 2761 ETQAIAD---DAQRDLDEALPALDAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPSAKQLLGDSNFLKRLLEYDKENIKPQILAKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKVVEPKRQKLRAAQAELDITMATLREKQALLRQVEDQIQALQDEYDKGVNEKESLAKTMALTKARLVRAGKLTAALEDEQVRWEESIQKFEEEISNITGNVFIAAACVAYYGAFTAQYRQSLIECWIQDCQSLEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKIIKLTDSNFLRILENSIRLGLPVLLEELKETLDPALEPILLKQIFISGGRLLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPRLEEQRIKLIVRINTDKNQLKTIEEKILRMLFTSEGNILDNEELIDTLQDSKITSGAIKTRLEEAESTEQMINVAREKYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSVKT--ENL----QQRLDVLLEQTLLTAYVNVSRGLFEQHKLIYSFMLCVEMMRQQGTLSD-----AEWNFFLR---------------GSAGLEKERPPKPEAPWLPTATWFACCDLE-ESFPVFHGLTQNILSHPISIRLGSFETYI------NPQKWEGYSKMKHEDKHMRQEKEAAHQDPWSAGLSSFHKLILIKCCKEEKVVFALTDFVIENLGKQFIETPPVDLPTLYQDMSCNTPLVFILSTGSDPMGAFQRFARE-SGYSERVQSISLGQGQGPIAEKMV-KDAMKSGNWVFLQNCHLAVSWMLAMEELIKTFTDPDSAIKDTFRLFLSSMPSNTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGKKWRQI---IFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLKLYCKEGKIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPETLEEDYK-YSESGIYFAPMADSLQEFKDYIE-NLPLIDDPE-IFGMHENANLVFQYKETSTLINTILEVQPRSSTGGEGKSNDEIVQELVASVQTRVPEKLEME--GASESLFVKDLQ------GRLNS-------------------------LTTVLGQEVDRFNNLLKLIHTSLETLNKAIAGFVVMSEEMEKVYNSFLNNQVP------------ALWSNTAYPSLKPLGSWVKDLILRTSFVDLWLKRGQPKS----------------------------------------YWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYSVIP--------TYRDQAAVIEAAKTVQFGQELP 4046          

HSP 3 Score: 493.812 bits (1270), Expect = 0.000e+0
Identity = 310/1057 (29.33%), Postives = 539/1057 (50.99%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLS-KCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIV-SLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKP--EDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            +WI+ DGP+++ W+EN+NTVLDD+++LCLAN ERI +   +  LFEV DL+ +SPATVSRC M++V  + + W   VK+WMK  + K   E  +E++  LF++ +  G+ F++ KCS  Q IP     S++ TLCC+LE+LIL      G D ++L +                              E +K          LN +L + +VF Y WS G                               D FD F+++ FD+N +   RLP ++  ++S  +D D     PW+ ++P+ K                 N      E++V + D++RY +L   L+   H VL  G +G+GKS++   +L +I    G                                                YVP      +Y  + F++QTS  +  + + SK+ ++ ++I+G P NK++++F+DDLN+P +D +GSQ  +E++RQ+ +  GF+D   L W  + D ++I AC+P    ++P++ R  +HF +L LP PS ++ ++IFQ  +  +    DF   +K   +SIV+  + +Y K       +P KSHY+FNLR L K + G+L  D   +  +  + +   HE  R  HDRLI++ D+  F  IL++  +    +    +      I+FG F    G+  + ++Y  + D+EK     +  ++ ++  +      +FF+ +I+H+ R  R++ Q  G+ L++GV G GK S  ++++ I G    ++ ++  YN  SF  D++K+   + ++++  V   +D   +V + F++D+ N++NSG +P+L+E DELE +L+  +P  +++G  S  + ++V+   I K+++ LH+ + +SP    +RSR R  PSL+NCCTIDW++ W  E+L+SV+          F  +++   E+    L    + ++ +   +  ++  ELRR Y+ +   ++E +N +  +L     +  S R R+  GL +L+ET  L+ KMK DL  L P +  KSE+ E
Sbjct: 1833 KWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMKG-ISKKLTEETQEYILNLFQRYVDEGLHFINKKCS--QAIPQVDI-SKVTTLCCLLESLIL------GKDGVNLAM------------------------------EQTK----------LNTILCQTFVFCYLWSLGGNLTEN-----------------------YYDSFDTFIRTQFDDNPDA--RLP-NSGDLWSIHMDFDTKRLDPWERIIPTFK----------------YNRDVPFFEMLVPTTDTVRYGYLMEKLLAVKHSVLFTGITGVGKSVIAKGLLNKIQESAG------------------------------------------------YVP------VY--LNFSAQTSSARTQEIIESKLERKRKNILGAPGNKRIVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIISACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFL--SDFPPAVKQTASSIVEASVEIYNKMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREEIQIFRLFCHECQRVFHDRLINNEDKHYFHVILTEMANKHFGIAIDLEYFLNKPIIFGDFIKF-GADKADRIYDDMPDIEKTANVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDT-QIVVEEFLEDINNILNSGEVPNLFEKDELEQVLAATRPRAKEVGI-SEGNRDEVFQYFISKVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSK--------TFFSQVDAGNEELKEKLPLMCVNVHLSVSSMAERYYNELRRRYYTTPTSYLELINLYLSMLSEKRKQIISARDRVKNGLTKLLETNILVDKMKLDLSALEPVLLAKSEDVE 2728          

HSP 4 Score: 38.5058 bits (88), Expect = 0.000e+0
Identity = 21/81 (25.93%), Postives = 43/81 (53.09%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +   V+NPK++++  LYG VN  +LEW +G++ +  +  ++ ++++   +      D    EN N     N +  L N+E+
Sbjct: 1786 VKTYVLNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSER 1866          

HSP 5 Score: 70.8626 bits (172), Expect = 3.960e-10
Identity = 37/112 (33.04%), Postives = 63/112 (56.25%), Query Frame = 2
Query: 13394 NPDHGVLVFGLYLDNALWNLENSSL------AINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            +P+ GVLV G+++D + W+ +   +       +NP+      LP++H      ++N K     + CPLY+T +R G LS++G S+NF+  + L S R   +WI +G+A L Q
Sbjct: 4053 SPEDGVLVHGMFMDASRWDDKEMVIEDALPGQMNPV------LPVVHFEP---QQNYKPSPTLYHCPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRSKDYWIAKGSALLCQ 4155          
BLAST of dynein heavy chain 6, axonemal vs. UniProt/SwissProt
Match: sp|P0C6F1|DYH2_MOUSE (Dynein heavy chain 2, axonemal OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1)

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 369/1265 (29.17%), Postives = 643/1265 (50.83%), Query Frame = 3
Query: 9234 CEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYR-EMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKD-SFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDN--IEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLI---GHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNS--ALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWG-LLSIGKSLSEWSSNVRIRIDFIGFWC 12995
             ++DL    P LE +++AL+SLNK  I E++ Y  PP  VEIVM AV +L    P+WA AK  LG+ NF++ L+N++KD I+ K+ K +  Y  Q DF P+ +G VSLA +S+C WV A+E Y  +  ++ PKR  +N A   L+  +  L   Q +L++V + ++ L  +Y   + ++++L+++      +L RA  L+  +  EK RW  +++  ++    ++G C+ +AA+ ++ GP+   YR E+  + WI  +    +P    +    F  +   + +W+  GLP D+   EN  I+ +  +W L+IDPQ Q  ++++    +   ++I  +  DY+ +LE AI+ G  + L++++  +DP L P+L K   R G   +I++G+ E+EY+P+F+ YL + LSNP      +   TI+NF V   GLE QLL ++V KE+PE+E +++  +   A     L+ LED+ L LL ++T  +++D +L   L+ SKITA ++ ++LE +   E  + LAR+ Y P A R + ++FVL D+G ++ MYQ+SL  +  LF   +D+ ++      S   E +++ + D  TY  Y      LF  H+ LF+F +   I+     E+  ++   ++  F++               D  GQ+    DN    WL    W+     E++    F GL NSF+  P  W  W  + +P         E +    N  ++++++  L   ++      ++   LG +F      N+ ++  +S  + P+VFIL    DP + +++L  E  G       +S+G+GQA  A  L+++  +++G W+FL NC L +SWMP+L KL+E LQ+  +D   +F+L LS+ PH DFPI ILQ S+K+  E P G+K  + + + L      T   + ++  + +K++F LC F++++LER+ +  LG+++ Y FNDSD E+S   +  +L    E  W+AL  +I  +NYGG +TD+ DRR L   + +Y  + +               I   G L  ++   S + S D          G   NA++     ++++    ++  Q +    +    S     L++   +  KIP  ++                                      Y     ++    SP + VL QEI++YN L+  I   +  L   + G   ++ SLE + + I    VPP WG +    K L+ W+ ++ +R++    W 
Sbjct: 3113 AQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHR------SNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKIL-----ETSGKLNMDEYNFFLRGGV----------VLDREGQM----DNPCTSWLADAYWD--NITELDKLTNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENAC---NEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLA-EHTGMAHRFHALSLGQGQAPIAARLLREG-VNQGHWVFLANCHLSLSWMPNLDKLVEQLQV--EDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFT---HCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYRLSVLDTYYIPKDGSLASYKEYISMLPSMDPP-----EAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIPEMID--------------------------------------YEGTRKLLALDPSPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYPSQKPLASWTRDLAVRVEQFETWA 4297          

HSP 2 Score: 270.781 bits (691), Expect = 0.000e+0
Identity = 187/728 (25.69%), Postives = 358/728 (49.18%), Query Frame = 1
Query: 6940 IIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFD-HEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            ++ ++D++RY++L + L+ N +PVLL G  G GK                  TS + S+L          Q+L SS                  + S+ V           +  ++QT+ N     + S++ KR + +  P   K M+ F+DDLN+P  D FGSQ  LE++R WI+   ++D       ++ D  L+ A  P    ++ IS RL   F ++ +  P+ +   RIF   I +    +DF  E+K     + +  + VY   + ++  +P K HY+FNLR + K+  G+L A+      K  + +   HE  R   DRL+   D E F  ILSD+L     L + H    K   +FG F          KVY+ + D+  L    E+++N ++    +     + F+++I+H+ R +R++ Q  G+ML++G+ G G+ S  +++S+I   + F++ +T  Y    FR DIK++  ++ ++ +       D   + ++SF++D+ N+++SG +P+LY++DE E I +++  +    +     + ++  LIE+++  LH+ + LSP    +R+ +R  P+L+NC TI+W+ +W  E+L+ VA                 ++E+    + +  + ++ +  +   +  +ELRR  +++  +++E ++ +  +L     +     ++L  GL ++ ETR  +  M  +L +   K+ E  ++ E
Sbjct: 2418 MVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGK------------------TSIAQSVL----------QSLPSS------------------QWSVLV-----------VNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQSIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKL--QDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDFL------KEPKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDT-QIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAE-------KYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCE 3072          

HSP 3 Score: 572.007 bits (1473), Expect = 2.429e-165
Identity = 345/1078 (32.00%), Postives = 578/1078 (53.62%), Query Frame = 2
Query: 2270 PKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQN--EILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTK-NKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXY--EGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQ------KQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMG-HLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            P+T+EE    L+ ++ +  ++ +++ +   I++ FTI+  ++VPV    L + ++LN      +  ++  E    ++  KF   L    ++ + +   + E              +  LDQ+  ++  +  + ++  N                     R    +F       + +D++ +E+++     +WE   +WE  +  + +      +   +          +  L K       EI+   ++ + + K ++P+I  LRNP L+ RHW ++++ +     + +++FT+ +++   + Q+ + I EIS  A  E+ +E  L  +   +   +  +V + ++    + G +++   LE++ + +ST+K S++V      V+ WER LS   +V++  +  Q+ W+YLE IF   DI++QLPNE  LF +V+  W+++M +  +    L+     G+L+ L   N+ LE IQKSL+ YLE KR IFPR +FLSND+LLEIL ++++PE VQ HL K F N+  L+I      S     V  +  +GE       + + G  E WL  +E+ +   ++  ++ C + +++      K   DWA    GQ ++ ++Q++++ +V++ L    +     +L + SI++   +        +  ++    R  + A++ I++H RD  + L ++ +     F+W  Q+R+ W +    C + Q ++ F+YG EYLG S RLVITPLTDRCYMT+T AL+ + GG  KGPAGTGKTET+KDL K +G   +V NCS+ LD  ++ ++ SG+ Q G+W CFDEFNR+N+EVLSV+A QI SI +A  +   RF FE  EI L   CGIFITMNP YAGR ELP+NL  +FRP+AM+VPD  LI E+ILF EGF   K+L+ K+  LY L   QLS Q HYDFGLR++ S+L   G   RL+  L  E V L    ++NI           +L + D+PLF +I+ DLF + +  + +   L  +IE   +E+G ++ P  + K+  L     SRH  M++G + S KT    ILQ +LT L
Sbjct: 1100 PQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQMLKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKGPFTSTVGHTAALDQIAQMRAMLMAMRDEENNL--------------------RSNLGIF--KIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKDKGHHRLRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWA----GQVVITASQIQWTADVTKCLMTAKERSDKKILKV-SILNKYSE-------AIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYFEGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNI----------AKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSL 2133          

HSP 4 Score: 36.965 bits (84), Expect = 2.429e-165
Identity = 24/76 (31.58%), Postives = 41/76 (53.95%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQN--VLNDQLSTDNFEKENS--NQNDLQTLLNNEQ 5790
            +NPKALS+  LYG  + N+ EW +GI+  V +   +    ++   + +  + T   E  NS  + N + TL+N E+
Sbjct: 2149 LNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGER 2224          

HSP 5 Score: 111.694 bits (278), Expect = 2.204e-22
Identity = 54/152 (35.53%), Postives = 94/152 (61.84%), Query Frame = 1
Query: 5929 KIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLS-KCSKIQIIPNTSKQSQLFTLCCILEAL 6381
            ++     K + +WI+ DGP+++ W+E++N+V+DD+++L L NGERI +P  +  LFEV++L  +SPATVSRC M+Y     + WK  V+SW++ +     P++  E L ++FEK I   + F    C+++  +P   + S + +LC +   L
Sbjct: 2180 RVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKR-----PKTEVEPLQRMFEKFINKILSFKKDNCNELVPVP---EYSGIISLCKLYTVL 2323          

HSP 6 Score: 64.6994 bits (156), Expect = 1.436e-12
Identity = 41/116 (35.34%), Postives = 59/116 (50.86%), Query Frame = 2
Query: 13373 DNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPS-FWILRGTAALLQCE 13717
            D+S  +Y P  GV V GLYL+ A W+ +NS L      +  C +P IH     S K   +  Y+  CP Y  P+R G    S   ++F+  + L+S  + S  WI RGTA L+  +
Sbjct: 4346 DDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYS--CPCYYYPNRAG----STDRASFVIGIDLRSGSMTSDHWIKRGTALLMSLD 4455          

HSP 7 Score: 33.8834 bits (76), Expect = 1.436e-12
Identity = 15/34 (44.12%), Postives = 22/34 (64.71%), Query Frame = 3
Query: 13170 VCYWLPGFFSPQSLITAVMQNEARIIHESIDMLT 13271
            V +WL GF  P   +TAV+Q+ AR  + S+D L+
Sbjct: 4304 VLFWLSGFTFPTGFLTAVLQSAARQNNISVDSLS 4337          
BLAST of dynein heavy chain 6, axonemal vs. UniProt/SwissProt
Match: sp|Q9P225|DYH2_HUMAN (Dynein heavy chain 2, axonemal OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3)

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 385/1355 (28.41%), Postives = 664/1355 (49.00%), Query Frame = 3
Query: 9234 CEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYR-EMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNI--EWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLI---GHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWG-LLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLT 13271
             ++DL    P LE +++AL+SLNK  I E++ Y  PP  VEIVM AV +L    P+WA AK  LG+ NF++ L+N++KD I+ K+ K +  Y  Q DF P+ +G VSLA +S+C WV A+E Y  +  ++ PKR  +N A   L   +  L   Q +L++V + ++ L  +Y   + ++++L+++      +L RA  L+  +  EK RW  +++  ++    ++G C+ +AA+ ++ GP+   YR E+  + WI  +    +P   ++    F  +   + +W+  GLP D+   EN  I+ +  +W L+IDPQ Q  ++++        ++I  +  DY+ +LE AI  G  + L++++  +DP L P+L K   R G   ++++G+ E+EY+ +F+ Y+ + LSNP      +   TI+NF V   GLE QLL ++V KE+PE+E +++  +   A     L+ LED+ L LL ++T  +++D +L   L  SKITA ++ ++LE +   E    LAR+ Y P A R + ++FVL D+G ++ MYQ+SL  + +LF   +D+ ++      S   E ++  + D  TY  Y      LF  H+ LF+F +   I+     E+  ++   ++  F++               D  GQ+    DN    WL    W+     E++    F GL NSF+  P  W  W  +  P         E +    N  ++++++  L   ++      ++   LG +F      N+ ++  +S  + P+VFIL    DP + +++L  E  G       +S+G+GQA  A  L+++  + +G W+FL NC L +SWMP+L KL+E LQ+  +D   +F+L LS+ PH DFPI ILQ S+K+  E P G+K  + + + L      +     ++  + +K++F+LC F++V+LER+ +  LG+++ Y FNDSD E+S   +  +L    E  W+AL  +I  INYGG +TD+ DRR L   + +Y  + +               I   G L  ++   S +   D          G   NA++                         + T++ +  D L         S++  I  T      ++ E+V+ L   + + I +       Y   + ++    SP + VL QEI++YN L+  I   +  L   + G   ++ SLE + + I    VPP WG      K L+ W+ ++ +R++    W                                                     + R  ++ +WL GF  P   +TAV+Q+ AR  + S+D L+
Sbjct: 3084 AQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHR------SNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKIL-----ETSGKLNMDEYNFFLRGGVV----------LDREGQM----DNPCSSWLADAYWD--NITELDKLTNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENAC---NEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLA-EHMGMAQRFHALSLGQGQAPIAARLLREG-VTQGHWVFLANCHLSLSWMPNLDKLVEQLQV--EDPHPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRC---SKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPP-----EAFGQHPNADVA-----------------------SQITEAQTLFDTL--------LSLQPQITPTRAGGQTRE-EKVLELAADVKQKIPE----MIDYEGTQKLLALDPSPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYPSQKPLAAWTRDLAMRVEQFELWA---------------------------------------------------SRARPPVI-FWLSGFTFPTGFLTAVLQSSARQNNVSVDSLS 4308          

HSP 2 Score: 275.404 bits (703), Expect = 0.000e+0
Identity = 200/778 (25.71%), Postives = 372/778 (47.81%), Query Frame = 1
Query: 6790 TIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFD-HEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            T+Y YFVD             P I++       L   S     N      ++ ++D++RY++L + L+ N +P+LL G  G GK                  TS + S+L          Q+L SS                  + S+ V           +  ++QT+ N     + S++ KR + +  P   K M+ F+DDLN+P  D FGSQ  LE++R WI+   ++D T     Y+ +  L+ A  P    ++ IS RL   F ++ +  P+ +   RIF   I +    +DF  E+K     + +  + +Y   + ++  +P K HY+FNLR + K+  G+L A+      K  + +   HE  R   DRL+   D E F  I+SD+L     L + H    K   +FG F          KVY+ +TD+  L    E+++N ++    +     + F+++I+H+ R +R++ Q  G+ML++G+ G G+ S  +++S+I     F++ +T  Y    FR DIK++  ++ ++ +       D   + ++SF++D+ N+++SG +P+LY+ DE E I S++  +    +     + ++  LIE++Q  LH+ + LSP    +R+ +R  P+L+NC TI+W+ +W  E+L+ VA                 ++E+    + +  + ++ +  +   +  +ELRR  +++   ++E L+ +  +L     +  +  ++L  GL ++ ETR  +  M  +L +   K+ E  ++ E
Sbjct: 2353 TVYEYFVD-------------PKIRSWTSFEDKLP-KSWRYPPNAPFYKIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGK------------------TSIAQSVL----------QSLPSS------------------QWSVLV-----------VNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKL--QDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDFL------KEPKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDT-QIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAE-------KCLIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCE 3043          

HSP 3 Score: 67.0106 bits (162), Expect = 0.000e+0
Identity = 41/116 (35.34%), Postives = 59/116 (50.86%), Query Frame = 2
Query: 13373 DNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRI-PSFWILRGTAALLQCE 13717
            D+S  +Y P  GV V GLYL+ A W+ +NS L      +  C +P IH     S K   +  Y+  CP Y  P+R G    S   ++F+  + L+S  + P  WI RGTA L+  +
Sbjct: 4317 DDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYS--CPCYYYPNRAG----SSDRASFVIGIDLRSGAMTPDHWIKRGTALLMSLD 4426          

HSP 4 Score: 560.836 bits (1444), Expect = 7.049e-162
Identity = 345/1090 (31.65%), Postives = 581/1090 (53.30%), Query Frame = 2
Query: 2270 PKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQN--EILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTK-NKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXY--EGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVD----WALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMG-HLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFD-EVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL-----PLINLSKE 5491
            P+T+EE    L+ ++ +  ++ +++ +   I++ F I+  ++VPV    L +  +LN      +  ++  +    ++  KF   L    ++ + +   + E          N      LDQ+  ++  +                    ++    ++  R    +F      +  +D++ +E+++     +WE   +WE  +  +   +    +  T+  T       +  L K       EI+   ++ + + K ++P+I  LRNP L+ RHW ++   I     + +++FT+ +++   + Q+ + I EIS  A  E+ +E  L  +   + V +  +V + ++    + G +++   LE++ + +ST+K S++V      V+ WER LS   +V++  +  Q+ W+YLE IF   DI++QLPNE  LF +V+  W+++M +  +    L+     G+L  L   N+ LE IQKSL+ YLE KR IFPR +FLSND+LLEIL ++++PE VQ HL K F N+  L+I      S     V  +  +GE      ++ + G  E WL  +EQ +   ++  ++ C + +  ++F++    W     GQ ++ ++Q++++ +V++ L    +     +L +  +  + +  L   +  +  ++    R  + A++ I++H RD  + L ++ +     F+W  Q+R+ W +    C + Q ++ F+Y  EYLG S RLVITPLTDRCYMT+T AL+ + GG  KGPAGTGKTET+KDL K +G   +V NCS+ LD  ++ ++ SG+ Q G+W CFDEFNR+N+EVLSV+A QI  I +A  +    F F+  EI L   CGIFITMNP YAGR ELP+NL  +FRP+AM+VPD  LI E+ILF EGF   K+L+ K+  LY L   QLS Q HYDFGLR++ S+L   G   RL+  L  E V L    ++NI           +L + D PLF +I+ DLF + +  V++  KL E ++E   +++G +  P  + K+  L     SRH  M++G + SGKT    ILQ +L+ L     P  N+ +E
Sbjct: 1065 PQTLEELGVSLQLVDALKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKKHKEKFKTGLIHSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAML--------------------MAMREEENSLRANLGIFKIEQPPS--KDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKDKGHHRLRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKWEAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLAL--RKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKV--MKKNQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHFDGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNI----------AKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRE-TVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAGDPNFNIVRE 2117          

HSP 5 Score: 36.965 bits (84), Expect = 7.049e-162
Identity = 23/76 (30.26%), Postives = 38/76 (50.00%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +NPKALS+  LYG  + ++ EW +GI+  V +   +    ++  +      D    EN N     N + TL+N E+
Sbjct: 2120 LNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGER 2195          

HSP 6 Score: 116.701 bits (291), Expect = 5.393e-24
Identity = 57/145 (39.31%), Postives = 92/145 (63.45%), Query Frame = 1
Query: 5950 KKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLS-KCSKIQIIPNTSKQSQLFTLCCILEAL 6381
            K + +WI+ DGP+++ W+EN+N+V+DD+++L L NGERI +P  +  LFEV+DL  +SPATVSRC M+Y     + WK  V+SW++ +     P++  E L ++FEK I   + F    C ++  +P   + S + +LC +  AL
Sbjct: 2158 KPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEKR-----PKAEVEPLQRMFEKLINKMLAFKKDNCKELVPLP---EYSGITSLCKLYSAL 2294          
BLAST of dynein heavy chain 6, axonemal vs. UniProt/SwissProt
Match: sp|Q8WXX0|DYH7_HUMAN (Dynein heavy chain 7, axonemal OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 345/1193 (28.92%), Postives = 613/1193 (51.38%), Query Frame = 3
Query: 9198 METEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPS---------------WANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQ-YTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFK-DSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNK-CKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVE-----QHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNK 12704
            M ++A+++   +C+ DL    P+LE+++ ALD+L    I+ V+  ++PP  V++VM A+C+L  +                  W  AK LLGD  FLQ L  Y+KD I       +++ Y    DF PE +   S A   +C+WV+A++ Y  V  ++ PK+  +  A+  L+I+   L  KQ  LK+V+D +  L +  + + +++  L+ +V L +++L RA  LI  +  EK RW  +  +  +   N+ G  + S+    + G +T  YR+   K+W  +   + IP  D+   +     A TI  W+  GLP DS   +N  II  +++WPL+IDPQ Q  ++++   K +S  VI   + DY+  LE  I+ G  + LE++  ++DP+L PLL K+ F++G  T I+LG++ +EY+P F+ Y+ + L NP  +   +  VT++NF +   G+++QLL ++V++E+P++E E+   +   A +   L+ +EDK L +L  S   I+ D    + L  SK  A +I ++ E   + EK++   R  Y P+AI  + ++F LADL  +  MYQYSL WF NLF   ++  N E  E ++     +LQ + D  TY  Y      LF   + LF+F L+ +++ +     +  I + +W   +    T  +  +N  A   T           WL  + W++ C+  ++     F  +   F    + W K   S  P       F E      N F+++++I  L   K+I   + ++   LG  F      +L   F +S+   P++F+L   +DP+  ++K   +     S L  +S+G+GQ   A  +++K  + +G W+ LQNC L  SWMP+L+K+ E L  S +    +F++ L+++P  +FP+ +LQN +K+  E+P G++  +++S+ +D   +        + E+ +K+++ LC F+A+V ERR +G LG+++PY+FN++DL IS++Q+  FL    E+ + AL  + G  NYGGR+TD+ DRR L  +L  + +     N    F  S    +    D +S   +  +    +     + G+  NA+I + +++++    +I++ QS+       +      ++   I  K+P + +     +    TY +       Q +  F KL + I+D  +   K
Sbjct: 2656 MASKAIKD---ECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDMRFLQSLHEYDKDNIPPAYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELKIAMDGLRKKQAALKEVQDKLARLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSHTALELGQLYINLTGDILISSGVVAYLGAFTSTYRQNQTKEWTTLCKGRDIPCSDDCSLMGTLGEAVTIRTWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKWIKNMEKANSLYVIKLSEPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVAQERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDTTRMGYRPIAIHSSILFFSLADLANIEPMYQYSLTWFINLFILSIE--NSEKSEILA----KRLQILKDHFTYSLYVNVCRSLFEKDKLLFSFCLTINLLLH-----ERAINKAEWRFLL----TGGIGLDNPYANLCT-----------WLPQKSWDEICRLDDLP---AFKTIRREFMRLKDGWKKVYDSLEPHHEV---FPEEWEDKANEFQRMLIIRCLRPDKVIPMLQEFIINRLGRAFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMAALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKA-VKEGTWVVLQNCHLATSWMPTLEKVCEEL--SPESTHPDFRMWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILNKFFNPELVENSDYKFDSSGIYFVPPSGDHKSYIEYTKT--LPLTPAPEIFGMNANADITKDQSETQLLFDNILLTQSRSAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLKTIRDSCVNIQK 3808          

HSP 2 Score: 352.443 bits (903), Expect = 0.000e+0
Identity = 283/1101 (25.70%), Postives = 521/1101 (47.32%), Query Frame = 1
Query: 5896 DSVKNQFTKDAKIVSHRS-----KKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNK-TIYSY-FVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIV-SLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFH-QKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDR--------EIFFKILSDELH-MSLKLNWAHDELGKCD----IMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNL----KPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            DSV ++++     VS R+       + +W++ DGP+++ W+EN+NTVLDD++ LCL +GE I +   +  +FE  DL+ +SPATVSRC MIY+    + W+  + SW+ N LP S     KEF+  LF++ +   ++F+ K +K ++ P TS  + + +L                     ++++D                        F+     +V   ++N +E  +LL  +++F+  WS GA+    +D  ++ N       +S  S     + F L  +S  +  S   + +P   K TIY Y FV    G ++PW      IK L +A  I               NEIIV +LD+IRYS L  LL  +  P +  G +G GKS+ I +                       F+ N  N                         K +Y P+         I F++QT+  +    + SK+ KR + + GPP  K+M++F+DD+N+P  + +G+Q  +E++RQW++   ++D        + D  ++ A  P    ++P++ R  +HF ++T+ + S  +   IF   +  +      F  E     T IV+  +++Y + +     +P KSHY+FNLR   ++I G+  +  +     E + +   HE++R  +DRL+ + DR        EI    + ++ H +  +L++ +D + + D    +MF  F   K   ++   Y++I DV+ L    E  +  +++      N + F+ +I+H+ R  RIL Q   H L++GV G G+ S  ++++ +    +F++ ++  Y+   +  D+K ++ K        V   +D   +  +SF++D+ NL+N+G IP+L+  DE + I   +    +  D   ++   P  ++ + I+  +  LHV + +SP    +R+RLR  P+L+NCCTIDW+  W  ++L +VA         +  +E     E+      +     + + I++   F +EL+R  +++   ++E ++ F  +L+    +    + R   GL +L    S +  M+ +L  L P++K  S+E +
Sbjct: 1660 DSVSHEWSDGVLAVSFRAFASSVTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMLSWV-NLLPASVSVIQKEFIMGLFDRMVPVSVEFIRKHTK-ELSP-TSDTNLVRSL---------------------MNLIDC-----------------------FMDDFADEVKLKERNDRETYSLLEGIFLFSLIWSVGASCT--DDDRLKFNKILRELMESPISD-RTRNTFKL--QSGTEQTSSKALTVPFPEKGTIYDYQFVTEGIGKWEPW------IKKLKEAPPI---------PKDVMFNEIIVPTLDTIRYSALMELLTTHQKPSIFVGPTGTGKSVYITN-----------------------FLLNQLN-------------------------KEIYKPL--------LINFSAQTTAAQTQNIVMSKLDKRRKGVFGPPLGKRMVVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPVTPRYMRHFNIITINEFSDKSMYTIFSRILTWHLEICYKFPDEFLDLTTQIVNGTMTLYKEAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETTETTEVIKRLWVHEVLRVYYDRLLDNTDRSWLINYIQEILRNYMYEDFHELFQRLDFDNDGMVEADDLRSLMFCDFHDPKREDTN---YREIADVDNLRMIVEIHLEEYNNISKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSVFQVEISKGYDTTEWHEDLKVILRKCAEGEMQGVFLFTDT-QIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMRQLDRQRDKTKQTDGSPIALFNMFIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPEDALQAVA---------SRFLEEIEMSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTFKLLLEKKRSEVMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVD 2624          

HSP 3 Score: 568.155 bits (1463), Expect = 3.297e-163
Identity = 319/822 (38.81%), Postives = 475/822 (57.79%), Query Frame = 2
Query: 3002 VKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNI---RVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKAL 5458
            V++ V + K  +P+I  + NP L+ RHW  +  ++G  L  + + T+   +   +  Y      ISE A+ E +LE  + K+   +  +EF + S+    T+I+  VD+I + L++  +   T++GS ++     Q+ +WE KL    ++LDEW+  Q  WLYLE IF + DI  Q+P EGR F  VD  WR +M+   +   VL   T   +L+ L+  N  LE I K L +YLE KR+ FPR FFLSNDELLEILS  +DP  VQ HL K F  + K++   +   +H  +     EGE   L   I   + RG  E+WL  LE+ +   + +          + + ++W  +  GQ++L  +Q+ +++ V  A+         G+  +   +    + ++ +   V   +    R  L A++V+ VH RD   SL++ ++  + DFEW  Q+RY W E  +  +   +++   YG EYLG SPRLVITPLTDRCY T+ GAL+ +LGG  +GPAGTGKTET KDL+K + +QCVVFNCSD LD   + K   G++  G+W CFDEFNR++LEVLSV+A QI +I+   ++  +  +FE  E+KL+P C +FITMNP YAGR ELPDNL  LFR VAMMVPDY +I E++L+S GF+TA+ LS KI   YRLC++QLS Q HYD+G+R++KSVL   G+L+L+          N NEE+ +L+++I   N P+ ++ DLPLF+ I  DLF        +   L  +I+ +   +  ++     EKI  +   +  RHG M++G    GKT    +L  AL
Sbjct:  827 VRSKVEDFKQHIPLIQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKEYSLEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDIMRSVMQDKHVLTVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSS----EGEVVELIEIISTAKARGQVEKWLVELERVMINSIHKVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAI-------PMGIKALEQYLKTCNRQIDDIVTLVRGKLSMQNRVTLGALVVLDVHARDVLSSLVKKNISDDSDFEWLSQLRYYWQE--NHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGADILMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYP--------NENEEI-LLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIKDNCASMNLQMTAFFSEKILQVYEMMIVRHGFMIVGEPFGGKTSAYRVLAGAL 1626          

HSP 4 Score: 34.2686 bits (77), Expect = 3.297e-163
Identity = 12/33 (36.36%), Postives = 23/33 (69.70%), Query Frame = 1
Query: 5557 KIDVQVVNPKALSINHLYGYVNPNSLEWIEGII 5655
            K+ + V+NPK++++  LYG  +  S EW +G++
Sbjct: 1639 KVQITVLNPKSVTMGQLYGQFDSVSHEWSDGVL 1671          

HSP 5 Score: 74.3294 bits (181), Expect = 8.123e-16
Identity = 41/117 (35.04%), Postives = 64/117 (54.70%), Query Frame = 2
Query: 13361 FNIRDNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            + + ++ +  + P+ GV + GL+LD A WN +   LA +     Y  +P++ L         K  SY  + PLY+T  R G+LS++G S+NF+  +TL SD+    WI RG A L Q
Sbjct: 3907 YEVMEDKEYKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLKPCKRADIPKRPSY--VAPLYKTSERRGVLSTTGHSTNFVIAMTLPSDQPKEHWIGRGVALLCQ 4021          

HSP 6 Score: 35.4242 bits (80), Expect = 8.123e-16
Identity = 16/38 (42.11%), Postives = 21/38 (55.26%), Query Frame = 3
Query: 13176 YWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVL 13289
            +WL GFF  Q+ +T   QN AR     ID+L    EV+
Sbjct: 3873 FWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDYEVM 3910          
BLAST of dynein heavy chain 6, axonemal vs. UniProt/SwissProt
Match: sp|Q63170|DYH7_RAT (Dynein heavy chain 7, axonemal OS=Rattus norvegicus OX=10116 GN=Dnah7 PE=2 SV=2)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 381/1383 (27.55%), Postives = 668/1383 (48.30%), Query Frame = 3
Query: 9198 METEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPS---------------WANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQ-YTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFK-DSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNK-CKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVL 13289
            M  +A+++   +C+ DL    P+LE+++ ALD+L    I+ V+  ++PP  V++VM A+C+L  +                  W  AK LLGD  FLQ L  Y+KD I       +++ Y    DF PE +   S A   +C+WV+A++ Y  V  ++ PK+  +  A+  L I+ + L  KQ  L++V+D +  L +  + + +++  L+ +V L +++L RA  LI  +  EK RW +S  +      N+ G  + S+    + G +T  YR+   K+W      + IP  D+Y  +     A TI  W+  GLP D    +N  II  +++WPL+IDPQ Q  ++++   K +S ++I     DY+  LE  I+ G  + LE++  ++DP+L PLL K+ F++G  T I+LG++ +EY+P F+ Y+ + L NP  +   +  VT++NF +   G+++QLL ++V++E+P++E E+   +   A +   L+ +EDK L +L  S   I+ D    + L  SK  A +I ++ E   + EK++   R  Y P+A+  + ++F +ADL  +  MYQYSL WF NLF   ++  N E  + +S     +L  + D  TY  Y      LF   + LF+F L+ +++ +     +N I + +W   +    T  +  +N      T           WL  + W++ C+  E+     F  +   F    E W K   S  P       F E      N F+++++I  L   K+I   + ++   LG  F      +L   F +S+   P++F+L   +DP+N ++K   +     S L  +S+G+GQ   A  +++K  +  G W+ LQNC L  SWMP+L+K+ E L  S +    +F++ L+++P  +FP+ +LQN +K+  E+P G++  +++S+ +D   +        + E+ +K+++ LC F+A+V ERR +G LG+++PY+FN++DL IS++Q+  FL    E+ ++AL  + G  NYGGR+TD+ DRR L  +L  +       N    F  S    +    D +S   +  +     +    + G+  NA+I + +++++    +I++ QS+       +      ++   I  K+P + +                            I+    R+     + M         + VL QE+ ++N LLI I +    +   + G   ++  LE V+  I    +P  W    +GKS                   Y  L+    Y+                 ND +  L + ++  E +    +F          WL GFF  Q+ +T   QN AR     ID+L    EV+
Sbjct: 2689 MAAKAIKD---ECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELRIAMEGLRKKQAALREVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYVNLTGDILISSGVVAYLGAFTSNYRQHQTKEWSHSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDLFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDNTRMGYRPIAVHSSILFFSIADLANIEPMYQYSLTWFINLFILSIE--NSEKSDILS----QRLHILRDHFTYSLYVNICRSLFEKDKMLFSFCLTVNLLIH-----ENAINKAEWRFLL----TGGIGLDNPYTNPCT-----------WLPQKSWDEICRLDELH---AFKTIRREFMRLKEGWKKVYDSMEP---HHEIFPEEWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRSFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKA-VKDGTWVVLQNCHLATSWMPTLEKVCEEL--SPESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCRKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYIEYTKTLPLIPDP--EIFGMNANADITKDQSETQLLFDNILLTQSRSSGSGAKSSDEVVNEVAGDILGKLPNNFD----------------------------IESAMRRYPTTYTQSM---------NTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPGMW----MGKS-------------------YPSLKPLGSYV-----------------NDFLARLKFLQQWYE-VGPPPVF----------WLSGFFFTQAFLTGAQQNYARKFTIPIDLLGFDYEVM 3943          

HSP 2 Score: 342.813 bits (878), Expect = 0.000e+0
Identity = 281/1106 (25.41%), Postives = 524/1106 (47.38%), Query Frame = 1
Query: 5896 DSVKNQFTKDAKIVSHR-----SKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNI-DTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNK-TIYSY-FVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIV-SLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSI-LINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNA----FQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDR--------EIFFKILSDELHMSLK-LNWAHDELGKCD----IMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNL----KPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            D V ++++     VS R     S  + +W++ DGP+++ W+EN+NTVLDD++ LCL +GE I +   +  +FE  DL+ +SPATVSRC MIY+  Q + W+  + SW+ N LP+S     KEF+  LF++ +   ++F+ + +K ++ P TS  + + +L  +++  +              D  D +K                       QKE        +N +E  +LL  +++F+  WS GA+    + ++    + +   G  S  +     ++F L   S  +  S   + +P   K TIY Y F+    G +  W      IK L D   I             + NEIIV +LD++RYS L +LL  +  P +  G +G GKS+ +IN +L Q+                                                  K +Y P+         + F++QT+  +    + SK+ KR + + GPP  K+M++F+DD+N+P  + +G+Q  +E++RQW++   ++D        + D  ++ A  P    ++PI+ R  +HF ++T+ + S  +    F RI    +   +   D  +++    T IV+  +++Y   +     +P KSHY+FNLR   ++I G+  +  +   NKE + +   HE++R  +DRL+ + DR        EI    + ++ H   K L++ +D + + D    +MF  F   K        Y++I +V+ L    E  ++ +++      N + F+ +I+H+ R  RIL Q   H L++GV G G+ S  ++++ +    +F++ ++  Y +  +  D+K ++ K    +   V   +D   +  +SF++D+ NL+N+G +P+L+  DE + I   +    +  D   ++   P  ++ + I++ +  LHV + +SP    +R RLR  P+L+NCCTIDW+  W  ++L +VA         +  +E     E+      +     + + I +   F  EL+R  +++   ++E ++ F  +L+    +    + R   GL++L    S +  M+ +L  L P++K  S + +
Sbjct: 1693 DLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPQMLGWRPLMVSWI-NTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTK-ELSP-TSDTNLVRSLMNLIDCFMD-------------DFADENK-----------------------QKE--------RNDRENFSLLEGIFLFSLIWSVGASCTADDRIKYNKILRELMEGPISDLT----RNKFKLL--SGTEQTSSKALTVPFPEKGTIYDYQFIPEGLGRWDQW------IKKLADTPPI---------PKDVQFNEIIVPTLDTVRYSALMSLLTTHQKPSIFVGPTGTGKSVYIINFLLNQL-------------------------------------------------NKDIYKPL--------IVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIITINEFSDKSMFTIFSRILTWHLRTCYKFPDDFLDLT---TQIVNGTMTLYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLLDNADRSWLVNYIQEILRNYMQEDFHDLFKNLDFDNDGIVEEDDLRSLMFCDFHDPKREDFG---YREIPNVDALRVIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAEGDMQGVFLFTDT-QIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTKQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVA---------SRFLEDIEMSEEIREGCIDMCKSFHTSTINLSTTFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQGELEALHPQLKVASRQVD 2657          

HSP 3 Score: 72.7886 bits (177), Expect = 0.000e+0
Identity = 41/117 (35.04%), Postives = 61/117 (52.14%), Query Frame = 2
Query: 13361 FNIRDNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            + + D+ +    P+ GV + GL+LD A WN +   LA +     Y  +P++ L         K  SY  + PLY+T  R G LS++G S+NF+  + L SD+    WI RG A L Q
Sbjct: 3940 YEVMDDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSY--VAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQ 4054          

HSP 4 Score: 558.14 bits (1437), Expect = 1.533e-160
Identity = 312/822 (37.96%), Postives = 470/822 (57.18%), Query Frame = 2
Query: 3002 VKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNI---RVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKAL 5458
            V+A V + K  +P++  + NP L+ RHW  +  ++G  L  + + T+   I   +  +      ISE A+ E +LE  + K+   +  +EF +  +    T+I++ VDDI + L++  +   T++GS ++     Q+ +WE KL    ++LDEW+  Q  WLYLE IF + DI  Q+P EGR F  VD  WR +M+   +   VL   T + +L+ ++  N  LE I K L +YLE KR+ FPR FFLSNDELLEILS  +DP  VQ HL K F  + +++   +   +H  +     EGE   L   I   + RG  E+WL  LE+ + + + + I   +    +   ++W  +  GQ++L  +Q  ++  V  A+         G   +   +      ++ +   V   +    R  L A++V+ VH RD   +L++  +  + DFEW  Q+RY W+E  +  +   +++   YG EYLG SPR+V+ P  D C++T+ GAL+ +LGG  +GPAGTGKTET KDL+K + +QCVVFNCSD LD   + K   G++  G+W CFDEFNR++LEVLSV+A QI +I+   +S  E  +FE  E+KL+P C +FITMNP YAGR ELPDNL  LFR VAMMVPDY +I E++L+S GF+TA+ LS KI   YRLC++QLS Q HYD+G+R++KSVL   G+L+L+          N NEE+ +L+++I   N P+ ++ DLPLF+ I  DLF        +   L  +I  +   +  ++     EKI  +   +  RHG M++G    GKT    +L  AL
Sbjct:  860 VRARVEDFKQYIPLVQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKSMDKMMTEWEAMEFVIHPYRESGTFILSAVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDVMKMVVQNKHVLAVVTIERMLERMKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIARVEFTETLDITHMKSS----EGEVVELVDTISTTKARGQVEKWLVELERIMIKSIHKVIGDAITAYTKNARINWVRDWPGQTVLCVSQTFWTVEVQVAI-------PMGHKALEDYLGKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLANLVKKRISDDTDFEWLSQLRYYWHE--NNLETKMINAGLRYGYEYLGNSPRMVLAPFCDYCFLTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQIGINSGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYP--------NENEEI-LLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIRENCHSMNLQMTNFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGAL 1659          

HSP 5 Score: 35.039 bits (79), Expect = 1.533e-160
Identity = 19/66 (28.79%), Postives = 34/66 (51.52%), Query Frame = 1
Query: 5557 KIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSN 5754
            K+ + V+NPK++++  LYG  +  S EW +GI+ +  +   + S  ++  L      D    EN N
Sbjct: 1672 KVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMN 1737          
BLAST of dynein heavy chain 6, axonemal vs. TrEMBL
Match: A0A2C9M9G5 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106056933 PE=4 SV=1)

HSP 1 Score: 1110.9 bits (2872), Expect = 0.000e+0
Identity = 580/1286 (45.10%), Postives = 845/1286 (65.71%), Query Frame = 2
Query: 1634 ISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLIS-PSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKA-ASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETV---KLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLI 5476
            +SLSP       C++ +I   E T+  V     +  L +F     + +  KL+   E + E++ V+   P++ L+L  D  Y + +  + K     +  L  ++   +  C  VD++ K     S  +  W  ++F   L  + E I  +NK + ++R+  I ++  +      PY + V+   N+ L   A  HND+ + +++ A+K LD    TVEEFVEHL F+ +++ E+ ++DKE   +N++FT+  ++KV +  E++ALY+TL+ + Q LKN ++Y EAKKD+NIRKFS+ L+  I  I+  +M++K + ++   L  +      L+    L+ EV  L  K R+Y++YQERFGSSLSK   S   + Q  +  + N+   +Q D+ E+ERD+++R LLW++  EW +  E ++    D   V  +++ V++   T+ +LEK LP N+++P +K  V + K  +PVIIALRNP+L+ RHW +I+K+I  S++ +KNFT+G LI   I ++K  I EIS  A+NE TLE ML KV D++   +FRLV H+ RDT +I GV+DI   LEES +T+ TI+GS+Y+  I+ +VE+WERKL   ++ LDEW+ CQ++WLYLEQIF T DIQRQLP E +LF  VD  W+ +M++T+++P  LK     G L  LQ CN+ LEK+Q+ LEDYLE KR IFPR +FLSNDELL+IL++++DP  VQ HL K F N+ +L I     Q  ++  ++S+E E   +PRN+RVRG  EQWL T+E G+FE VK+ +K  L + +     +W L + GQ +L   QV F+++V+++   +   +S    T+ SI+  L Q    LA      +  Y+R ++EA++ I VHNRD    +L+N VK + DFEWK+Q+RY W+E S+ C V Q ++ F+YG EYLGCS RLVITPLTDRCY+T+TGAL+ +LGG   GPAGTGKTET+KDL+K MG+QCVVFNCS+ LD   + K  SG+ Q GSWCCFDEFNR+++EVLSV+A QI++IK+AKDS+  RF+FE ++IKLNP CG FITMNP+YAGRVELPDNL +LFRPVAMMVPDY LI E+ILFSEGF  AK LS KI NLY+L + QLS Q HYDFG+R+IKSVL++ GH R  +VL+ +     K+  NEE  ILI +++ +N P+ + +D+PLF+SI+ DLF       ++  +LE+SI +S +E+  ++WP+QIEK+K L SQ+  R GVML+GP+  GKT +R ILQKAL  LP++
Sbjct:  728 VSLSPSSAEFNACIRSMICYFEDTVVKVTPMLREPKLAVFYSPPKHDL--KLNCDEEEMEEKQEVMQEWPNLDLVLREDPAYQKILTGMFKYVEMEMQLLEQFISNYSGFCQMVDKSRKVNVEESIAKNPWTSEDFNHILGVHLEMIRRMNKMVTSRRVAMIQVEGVDFRDACLPYPQAVVDATNKCLPIIANKHNDDLMTIIKGASKRLDKTILTVEEFVEHLSFLGRMSTELPALDKEYDVVNKLFTVAKSYKVTIKAEEMALYQTLSPSFQHLKNTILYCEAKKDDNIRKFSSQLDSLIGNIKTSLMDLKIRVQDPELLHVDTHPLSALETTRLLQEEVHILSIKARSYASYQERFGSSLSKQRKSYYGELQGLERRSDNSIQEIQADLSEIERDLTLRTLLWQSLEEWAKLVEEWMETPFDSINVEGLQKNVNKFTQTLYMLEKGLPHNQVVPKLKEKVLDFKQGMPVIIALRNPSLKPRHWEEIQKVINKSISHDKNFTLGNLIEMNIFKHKDKIQEISTTASNEATLELMLHKVIDLWLSTDFRLVPHAGRDTLVIYGVEDIMAQLEESQVTVGTIRGSRYIGPIKAEVEEWERKLQVFSRTLDEWLTCQRNWLYLEQIFSTQDIQRQLPAEYKLFMTVDKAWKDIMRRTEDRPNALKSAITPGTLDTLQMCNANLEKVQRCLEDYLETKRFIFPRFYFLSNDELLDILAQSKDPNAVQPHLGKCFGNIKQLDIAFLPRQPPTVKSIISFEKETITMPRNVRVRGAVEQWLLTVEAGMFETVKKHLKIGLADWQMTNLKEWVLKHPGQVVLTVMQVMFNKDVTKSFD-SHHTKSALKQTLDSIVELLNQ----LASFTYARLQGYQRLSIEALLTITVHNRDIVIEMLKNKVKRKEDFEWKRQLRYEWDETSNNCLVLQSNANFQYGYEYLGCSNRLVITPLTDRCYLTLTGALHLHLGGSPAGPAGTGKTETVKDLAKAMGKQCVVFNCSEGLDYKMLGKFFSGLAQSGSWCCFDEFNRIDVEVLSVVAMQIHTIKSAKDSQLPRFMFEGRDIKLNPTCGYFITMNPTYAGRVELPDNLKYLFRPVAMMVPDYTLIAEIILFSEGFTAAKSLSQKIVNLYQLASKQLSQQDHYDFGMRTIKSVLVMAGHGR-RQVLLRDQANGEKITENEESYILIHSLRDANMPKFLAEDVPLFESILDDLFPGVTPPAQDTGVLEKSINMSIREMNLQLWPNQIEKVKQLYSQILVRQGVMLVGPTGGGKTSVRMILQKALILLPML 2005          

HSP 2 Score: 875.93 bits (2262), Expect = 0.000e+0
Identity = 506/1456 (34.75%), Postives = 800/1456 (54.95%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDE---------------------------------------INKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNR-----IGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPD---NIE--------------------WLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKE--------FSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDN-DANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQI--RKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFL-TNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASEN-----NNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHE----DQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFF--DSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSW--GLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYH-KYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVL 13289
            E + V++Y+ +CE DL SV PVL  ++ +L++L+KASISE+RVY  PP+LV  V++AVCVL      WA  KL LGD  FL+ LL Y+++   +K++  L++YT   +FNPE+VG VSLAC+ IC+WVLAI++Y++V  M+ PK++ V +A++AL+++++ L  KQN LKK++ H++ +  +YQ SV +++ LKER R+T  RL RA+ LI A+  E+ RW  S+K  D   + IIG  + SAA   + GP+T  YR +  + WI +   K IPI  ++  ++    A  ++ WHNNGLPRD    EN   + +++KWPL IDPQ Q  R+++   K   +V++  + + +  +E AI+VGD + + D+  ++DP L P+L +E + +G+  +IK+G+ E+EY+ +F+LYL +SL+NP  +  +   V +INFTV   GL+EQLLS++V +E+P +E +R + L + AND ++LR+LEDK+L +L  +   +++D +L Q L+ SK  + +I  R+ E+ + EK+L +ARK YLP+A RG+ IYFV+A+L  ++ MYQYSL WFQ++F+ C+ E                                       ++ +   + S S    L  +I+ +TY  Y + S GLFS H+  F+FML +SIMR + +  +       I   +W  F+  +  +++  ++ +    +  + K  D   N E                    W++  VW +C+FLE  L++ FS LC S     + W  +  +EN F++    F          F  + L  F+ LILI  L    L  S  L++K  LG  +      +L +++ ES AK P++FIL    DP + +++   ELRG+  +LD++S+GRGQ  KAE LI K  I KGRW+FLQNC L  SWMP LQ ++E       +N D  F+L LS+ P   FP+ ILQ  LK+ +E+P G+K  LL++F   G G V+E +Y+  S ++  R ++F LCLFN+V+ ER+ YG+LG+++PY+FNDSDLE+SI ++   L   +++ W AL+ + G + YGGR+TD+ DRRCL+ LL  + + +      + +   M+   P+      T F S+ SFI   +       +L G+ DNAE    E Q+ S I  II  Q +        QK+ D+ + LD+ + IS ++P  +E    DT         E    L   L   +    L   K+   E +      +S    +L QEI ++N+LL  I   +  L   + G   ++E LE   D +    +P  W        KSLS W +++  R+ F   W   +      K+ + + S   +   +  P    +   NY                       +WL  FF PQ  +TA++QN AR +  S+D L+   E+L
Sbjct: 3246 EMKIVQDYADECETDLASVLPVLRDAVASLETLDKASISEIRVYARPPQLVSTVISAVCVLFQKKTDWATGKLFLGDPQFLKMLLTYDRNNQPEKVFAKLKKYTKDPNFNPEAVGKVSLACKCICRWVLAIDNYNTVYKMVKPKQRRVQDAREALQLAQESLAKKQNSLKKIQAHLQMIQQQYQESVDQREALKERRRVTGIRLERASILISALADEEVRWAQSVKLLDIKLEGIIGDTLVSAAAVAYLGPFTAHYRNILVENWIRMCVEKDIPISKDFDIIKCMMDANQVMKWHNNGLPRDKLSTENATFVSRARKWPLFIDPQGQASRWIREMEKGRLKVVTGSEVNLMRTIETAIKVGDPVLIVDVGEELDPALRPVLLQETYHKGSQIVIKIGDVEIEYNENFRLYLATSLANPHYLPGIYLQVNVINFTVTFDGLQEQLLSVVVKQERPLLEKQRTQLLESIANDKQTLRDLEDKSLSMLHSTEGHLLDDQDLVQTLQDSKTKSQEIYLRVAESEETEKKLNIARKRYLPVATRGSVIYFVIAELANIDVMYQYSLTWFQSMFSTCITESIQESRTTFSHQTFASGVLRPSSAKSIKSMHNSESQEGDLDDQSDPDSSASLMEHLTNMIERLTYNIYRIVSVGLFSNHQLTFSFMLCSSIMRANTKTENTSLRIEGIQDNEWYLFLHGNVAAALKSQDREDKKESSDLSKSLDLGENTEEKADTKELKPTSAYKKIIPSWISESVWRQCQFLEATLEN-FSQLCLSLTDNDQQWELFRNAENVFELVREPFVSVLEKPGTVFEWQKLTKFQCLILIKTLRLDILPASLSLFIKDQLGSTYVATGTFDLRDVYNESMAKSPMIFILSPGCDPSSQLLRFAKELRGSILHLDMISLGRGQGPKAEELISKAQILKGRWVFLQNCHLAASWMPRLQSIVERFNQGNDENLDPQFRLWLSSRPDPSFPVSILQYGLKMTVEAPQGLKANLLRTFGSSGAGVVSENMYDKGSTKLAWRPLLFGLCLFNSVIHERKKYGTLGWNIPYEFNDSDLEVSILKLQMLLEEQDDIPWAALNYLTGEVTYGGRVTDDWDRRCLISLLNKFYNRSLFLPGYSYDSANMYHPMPED-----TKFASVFSFIE--ELPSYDRPDLFGMTDNAEKSCKEFQANSIIKTIISVQPRRATSITGSQKSNDT-AVLDLAEEISQRLPLCIE----DTSRTPNSVLMEPQRSLKSILQRDVDTKGLDKEKFKILESLTAKLAGNSALLTILRQEIDRFNHLLSVIQISLTQLTLAIKGEIVMSEQLEDAYDALLTQRIPSQWKNAAYESAKSLSSWVTDLHKRVLFFAGWAKLLSSTIEKKFKQTIRSAKDTSVEVEVPA---VTEPNY-----------------------FWLSAFFFPQGFLTAILQNHARKLGISVDSLSFGFEIL 4662          

HSP 3 Score: 763.066 bits (1969), Expect = 0.000e+0
Identity = 427/1229 (34.74%), Postives = 714/1229 (58.10%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQII--PNTSKQSQLFTLCCILEALILYLSANGGFDNL------SLDILDASKADSSRKVNESTTP-----------------FQDTKQF-PFIQKENSKVSF-LQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAAD---EFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINA-----NNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLN----TNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHF---RXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            ++   +NPK +++  LYG  +PN+ EW +G+I   T++                    F KE S       ++++E    +E    S  +    K    S+  + + Q V+++ + ++   + K  S+ +  +W+W++LDGP+++ WVENLNTVLDDS++LCLA+GERI++   ++ LFEVD+L  +SPATVSRCAM+Y+    + W+  VK+W+ N+L + FPESGK FL  LFE SI  G+ FL K  + Q I  P+ S    + TLC IL A + +++++GGF  L      S   +  +  D + + + STT                   + T  F P   K   K  F L+++P +L NLLGKL+VFAYTWS G    R+E +    + D +S ++SG ++ +  D   EFD F + LFD     G+RLP  N++IY YFVD++ G F PWD+L+PS K+LI+   +++    +        N+ +  EII ++D +R++FL++LL++N HPVLL+GDSG+GK+ +I+ +LK++ +  G+S   S +ILG +  Y++K  +LL ++ NLS  + + D   DI+  +   P+     + + I+ ++QT+  +    +  K++K+ +  +G PK +++++FIDDLN+P  +E+G+Q  LE++RQ++E+ GF+D   + W  + D +++ AC P    ++P + RL KHF + TLPQPS+ + Q I+QV++GR+  + +F  E+   L SIV   I+VY+        +P KSHY FN+R L K+I G+L +   +++ KE+  +  AHE  R  HDRL +  DREIFF+IL+D LH   K+ W  ++L +  ++FG FF +    S  +VY+ + D  KL+R  E       H  +N    T+  +FFK +++H++R  R+  Q  GH+L++G++G GK + V ++S I  C+IFRL + + Y    F  D+K +  K+ ++  P V  L+D  D+V +SF++D+ +++NSG +PDL++N+E++ I   LK     +        VY    ++I+K LHV + +SP    +R R R NP+LINCCTIDW+ +WS E+++SVA       E I++    +I   KE   H      + I++T  E+  ++  E RR Y+ +   ++E +  +  +L+ +  +  +N+ RL  GL  L    ++   M+E+L+ L P I+ K+++T+
Sbjct: 2035 VETFTINPKCVTLGELYGETDPNTFEWSDGLIANATRR--------------------FSKELS-LTSTTPVMDDEPKNSREASAGSASSSSNNKTHGASKSANAQKQPVIEEEMNDE--DEGKEESYIT--DWRWLILDGPVDTLWVENLNTVLDDSKVLCLASGERISLTPGMRLLFEVDNLSRASPATVSRCAMVYMDPVDLGWRPYVKTWL-NRLSRDFPESGKHFLQSLFESSIDKGLNFLHKYKEHQAIIAPDLSI---IATLCHILAAYLEFMTSHGGFGTLDEKDRDSKLTVQGTDDDMTSRNSSSTTGSKIRNKLFKKHVKIIDDLEPTDLFEPTHSKGPDKKKFYLEQHPNQLTNLLGKLFVFAYTWSIGGVLKRREFM----DEDDSSIRRSG-TVVDKVDINNEFDNFARELFDVEPPLGVRLPAGNRSIYGYFVDLEGGGFVPWDVLIPSTKSLIERGAVITIGETLGVVSDKKKNELKEAEIIPTVDIVRFTFLTSLLLMNKHPVLLSGDSGVGKTAIISHLLKELEKDGGTSVDKSQTILGSVLQYSEKQSHLLDNLSNLSFQNETEDATIDILSGAKGRPVGV---LSTMIQCSAQTTAKRIQAQILLKLIKKSRSSMGAPKGRRVIVFIDDLNMPAPEEYGAQPPLELLRQFLEMGGFYDTKKMVWKDILDVNVVAACGPPGGGRNPTTPRLLKHFSLFTLPQPSTKSLQHIYQVQLGRFLQEGEFMPEVMDSLFSIVSASIAVYYNMCAVMLPTPTKSHYTFNIRDLSKVIQGMLQSHSSVIMGKENCAQLFAHEATRVFHDRLTNPMDREIFFQILADNLHDYFKMRWTAEKLMEDSVLFGDFFDMAEHGSLHRVYRPLADKNKLVRVLEEY-----HMRMNMGEFTDQLVFFKDAVEHVVRAARVFRQPGGHLLLVGIDGTGKSTLVHLASYIANCEIFRLKLHNQYGMTEFHDDLKSLFMKAGVKGVPSVFLLTDA-DIVKESFLEDINSILNSGEVPDLFDNEEMDGITMELKSAATEAGIPDTRASVYSYFTQQIRKKLHVVLTMSPAGEKFRQRCRMNPALINCCTIDWFDEWSDEAMLSVAKVFFANTEFIVDEIHYDIIELKEKVAH----ICVGIHKTISEMSGRYWEEARRRYYSTPSSYMELIKLYSRMLKENKDEFMNNKGRLQTGLQTLTNAYAMAGSMQEELVSLGPIIEAKAKDTD 3216          

HSP 4 Score: 78.9518 bits (193), Expect = 4.695e-10
Identity = 63/269 (23.42%), Postives = 121/269 (44.98%), Query Frame = 2
Query:  446 FQVVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTC------------------QNYTDKINLSSYLEEISKE----RNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRIL 1186
             +VV+A  A+  ++++T+SAS V+  Y+              +S  ++TP   W+ E+ LF  + ++  F  FR WKAF+ W+  I   K    ++ L  +L   + + Q C+  V  + E   D   +   +S   +++  +DP  T NL EF   Q N+       L+++   ++E V + C                  +   +K+NL++YL+  + +    + LD   +  ++ E    RK +  +  FL+ +D  L  L   ++
Sbjct:  269 LEVVSANTARSQRMYFTISASYVSMCYETDEK----------MSESNATPALWWIWERRLFKMIFHIPVFVKFRLWKAFKNWKKTILRQKNKGQKDKLCKSLFIANEVLQGCLIHVRSICESTKD--VLKDGSSSSLISLIELDPGATLNLEEFELRQKNRCDRALLQLNRLREQIIEIVWEACATVAEMEGVAQGIRDDSGKKLNNKVNLTAYLDRGTTKNMLVKKLDQKKAKPLYAEIAEWRKILARLSCFLRCIDYLLQDLLRHLV 525          
BLAST of dynein heavy chain 6, axonemal vs. TrEMBL
Match: A0A2T7NYR1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_13943 PE=4 SV=1)

HSP 1 Score: 1093.95 bits (2828), Expect = 0.000e+0
Identity = 559/1221 (45.78%), Postives = 803/1221 (65.77%), Query Frame = 2
Query: 1838 PSIKLMLDTDMEYCENVKTILKMSTNSLIDLV-----HYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAA-SKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLI-SETVK-LNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLI 5476
            P ++L+L  D  Y      +L  S  S +D+       Y    +  C  VD++       S     W  D+F + L  +TE +  + K + ++R+G I ++ ++      PY +KV+  V+EKL   A   ND+ + +++ A+K LD  P TVEEFVEHL F+ +++ E+ ++DKE   ++++FTI  ++ V V  E LALYKTL+ + Q LK+ ++Y EAKKD+NIRKFS+ L+  I  I  ++ME+K + ++   L  +      L+ +  L+ EV  L  + R+Y++YQERFGSSLS    S        D  +  +A ++Q ++ E+ERD+++R LLW++  EW    + +     D   V ++++ V++   TV +LEK LP NE++P +K  V + K  +PVI +LRNP L+ RHW  I++ I   +++ K+FT+G L+   I ++K+ I +IS  A+NE TLE ML K+ D++   +FRLV H  RDT II G DDI   LEES +TI+TI+GS+YV  I+ QVE+WERKL   A+ LDEW+NCQ++WLYLEQIF T DIQRQLPNE ++F  VD  W+ +M++ +++P  L+     G L  LQ  N+ LEKI K LEDYLE KR +FPR +FLSNDELL+IL++++DP  VQ HL K F N+ +L+I     Q  ++  ++S E E   +PRNIR RG  EQWL T+E G+FE VK+ +K  L +      V+W L + GQ +L  TQ+ F+++V  AL    D  ST + T  +++S L +    LA  V   +++++R ++EA++ I VHNRD   +L++  V    DFEWKKQ+RY W+E ++ CQV Q ++ F+YG EYLGCSPRLVITPLTDRCY+T+TGA+N +LGG   GPAGTGKTET+KDL+K +G+QCVVFNCS+ +D   + K  SG+ Q GSWCCFDEFNR+++EVLSV+A QI +IK AKDS   RF+FE ++IKLN  C  FITMNP+YAGRVELPDNL  LFR VAMMVPDY LI E++LFSEGF+TAK LS KI NLY+L + QLS Q HYDFG+R+IKSVL++ GH R    L    T K L   EE ++LI +++ +N P+ + +D+PLF+SI+ DLF       ++   LE++I ++ ++ G + W  QIEK++ L+SQ+  RHGVML+GP+  GKT +R+ILQKAL  LP++
Sbjct:  948 PDLELILHDDPAY-----QLLLSSVQSHMDMEMETVEQYSSNYHQFCLMVDQSRHMKVDESMARSPWTTDDFNQVLAAHTEMVRRMKKMVMSRRVGMIQVKAEDFCGSCLPYPQKVVKEVHEKLPVIANKRNDDLLTIIKGASKRLDKFPDTVEEFVEHLSFLGRMSTELPALDKEYNIVHKLFTIARDYNVEVQPEDLALYKTLSPSFQHLKSTILYCEAKKDDNIRKFSSHLDTLIYNIHSKLMELKSRVQDPDLLHTDTMAVSALETIRNLQEEVQSLSVRARSYASYQERFGSSLSNTKKSYYGDLLMMDKKSDASAQDIQMELSEIERDLTLRGLLWQSLVEWAHLVDEWTATAFDSVNVESLQKNVNKLTQTVYMLEKGLPHNEVVPRLKEKVMDFKQGMPVITSLRNPYLRQRHWDAIQRTINKVISREKSFTLGNLLDMNIFKHKEKIQDISTTASNEATLELMLQKIIDLWQTTDFRLVPHVGRDTLIIYGADDIMAQLEESQVTIATIRGSRYVGPIKAQVEEWERKLQVFARTLDEWLNCQRNWLYLEQIFSTPDIQRQLPNEYKMFSSVDKSWKDIMRRVEDRPNALRSAIAPGTLDTLQQANASLEKIHKCLEDYLETKRFVFPRFYFLSNDELLDILAQSKDPNAVQPHLGKCFGNIKQLEIQQLLRQPPTVISIMSAEQEVITMPRNIRARGPVEQWLGTVEAGMFETVKKHLKLGLADWTDTNLVNWVLKHPGQVVLTVTQIHFNKDVQAAL----DQTSTLIATRDNMVSQLNE----LAGLVLSPLIAFQRQSIEALLTITVHNRDIMNTLIKQRVSKPSDFEWKKQLRYEWDETTNNCQVLQSNAAFQYGYEYLGCSPRLVITPLTDRCYLTLTGAMNLHLGGSPAGPAGTGKTETVKDLAKAVGKQCVVFNCSEGIDYKMLGKFFSGLAQSGSWCCFDEFNRIDIEVLSVVAQQILTIKTAKDSNSLRFMFEGRDIKLNATCAYFITMNPTYAGRVELPDNLKSLFRSVAMMVPDYALIAEIMLFSEGFVTAKSLSQKIVNLYQLASKQLSQQDHYDFGMRAIKSVLVMAGHGRRHAQLRNGHTAKQLTEEEESHVLIHSLRDANLPKFLAEDVPLFESILADLFPGVVPPEQDYGSLEKAISMAIRDQGLQHWSSQIEKVRQLHSQILVRHGVMLVGPTGGGKTTVRNILQKALVLLPML 2155          

HSP 2 Score: 865.914 bits (2236), Expect = 0.000e+0
Identity = 496/1454 (34.11%), Postives = 798/1454 (54.88%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVD----------------------------------------EINKEIGENVSISPETKLQK----IIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYG----------ENLKAFDSTGQ--IIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSEN-------PFDMSSY----NFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDN-DANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRK-----MIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNE-VQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGI-----EMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFI---IDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNK----YSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSI--GKSLSEWSSNVRIRIDFIGFW----CYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEV 13286
            ETE V+NY+ +C+ DL SV PVL+ +I +L++L+KASISE+RVY+ PP LVE VM+AVCVL    P W  A  +L D NFL+KLL ++K+++  K++  L++++  +DF P+ VG VS+ACRS+C+WVLA+EHY+ V  M+ PK+  V +A++AL +++  L  KQN LKK++ H+  +  +YQ+SV ++  LK+R+ +T++RL RA+ LI A++ EK RW  S+   D   + ++G+ +  AA   + GP TL YR+   +KW+ +    ++PI  N+        A  I+ W+N GLPRD    EN   +++++KWPLLIDPQ QG  +++       + ++    + +  LE A++VGD + ++++  ++DP L P++ +E  RRG   ++KLG+ E+EY+ +F+LY+ +S++NP  + ++     IINFTV   GL+EQLLS++V +E+P++E++R   L + A+D + LR+LEDK+L LLQ +   I++D +L   L++SK    +I  R++++ + E+++  ARK YLP+A RGA +YFVLA+L  ++ MYQYSL WFQ +F  C+                                         E +  +G +   + + +LQK    +I+ +T+  Y + S GLFS H+  F+F+L  SIMR + + +DN        +    H                 E L+A  S+G     KQ    EW+    W  C+ L   L  +F+ LC S     + W  +  SE+       PF +       N   F    L+ F+KL+LI +L S  L+ S   +V+  LGEK+ +    +L  ++  S +K P++FIL    DP + +++   ELRG++ +LD++S+GRGQ  +AE LI K  + KGRW+FLQNC L  SWMP LQ ++EN   +  D  D  F+L LS+ P S FP+ ILQ  +K+ +ESP G+K  +LK F   GTG +TE +Y    E ++K     +++ LCLFNAV+ ER+ +G LG+++PY+FNDSDLE++I ++   L + E V W AL  + G + YGGR+TD+ DRRCL++LL  +    +   G      +M+   P  L      F  + SF+   +  V    ++ G+ + +E    E Q+   I   +D+  + S      + TD    L++   I  ++P++VE   ++T      +  +  + + G ++  I    L  +K    Y+  + I+    S    VL QE+ ++N LL  IH  ++LL   + G   +++ LE     I    VPP W  +S    K L  W  ++  R+DF   W    C +I +++ +             A    G   I++ +                 +R     +WL  FF PQ  +TAV+QN AR +  SID L  +  V
Sbjct: 3331 ETEIVQNYADECQNDLASVLPVLQQAIASLETLDKASISEIRVYKTPPSLVETVMSAVCVLFQRKPDWPTATQMLRDPNFLKKLLQFDKNSVPSKVFTKLKKFSSVEDFKPDIVGKVSVACRSLCEWVLALEHYNDVYKMVKPKQARVEDAREALRLAQDSLANKQNSLKKIQKHLGLIQQQYQDSVTQRDALKKRMVVTSQRLQRASVLISALEDEKGRWLQSVDVLDGKLEGLVGNTLVGAAAVAYLGPLTLKYRQELVEKWVTMCRENNVPITQNFHLTNVMADANQIMKWYNCGLPRDKHSTENAIFVKRARKWPLLIDPQAQGVSWVRQMEGQRLKTVTATDPNLMRTLETAVKVGDPVLIKEVGEELDPALRPIVMQETVRRGGQVVMKLGDTEIEYNSNFRLYMATSMANPNFLPAIFIQTNIINFTVTFDGLQEQLLSVVVKQERPQLESQREELLESIASDRQLLRDLEDKSLSLLQKTEGHILDDQDLVDTLQQSKGKNQEIYTRVQQSEETERKIDAARKKYLPVARRGAVLYFVLAELANIDVMYQYSLDWFQQMFASCIASPVTNTLQGDVSMISSTSSTFATGILHPSSAHTIQSAEDFEKDTSLGTHSLPNDDEELQKHLHGMIERLTFSIYRIVSVGLFSSHQLTFSFLLCASIMRANSQGTDNVKSMLTTGSRRSSHDKDKGSKHEQRKRLTPIEQLEAEASSGDPNFHKQKRPPEWIAESNWKLCQLLNATLP-QFTSLCRSLITCHQQWESFRTSEDCFLLMEVPFCLGGSPEHGNVIAFDWHLLSRFQKLLLIRVLRSDALVASMVSFVQEQLGEKYLSTGTFDLKEIYEGSTSKSPLIFILSPGCDPASQLLRFAKELRGSSLHLDMISLGRGQGPRAEELINKAQVLKGRWVFLQNCHLAASWMPRLQNIVENFNRATTDEVDPQFRLWLSSRPDSSFPVSILQTGIKMTVESPKGLKANMLKIFGSSGTGIITEHMYE---EWVKKPNWHTLLYGLCLFNAVIHERKKFGRLGWNIPYEFNDSDLEVAILKLQMLLESQEDVPWQALLYLTGEVCYGGRVTDDWDRRCLLNLLNKFYCPESLLPGYSYSSGQMYQPVPDSL-----PFSMVLSFV--EELPVVDAPDIFGMTEISEKACRELQAFEIIHTLVDVQPRVSHGSSGSQKTDDEVVLELASGILEQVPQTVEAIQVETVASGTSQQKQMHLSVKGLVNRDINTKGLDKDKVNALYTAAQNILD--GSALITVLRQEMDRFNNLLHVIHTTLRLLCLAIKGEIIMSDQLEETYKSILKQEVPPQWSAVSYESNKPLGTWVKDLECRVDFFSTWAEILCKTIEQQFRQ-------------ATQQTGQQDIDMSD----------------PIRIQPNSFWLSAFFFPQGFLTAVLQNHARKVGISIDSLEFNFHV 4742          

HSP 3 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 412/1178 (34.97%), Postives = 686/1178 (58.23%), Query Frame = 1
Query: 5554 AKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQR--FSVESQDVLQDSVKNQF-----TKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGF------DNLSLDILDASKADSSRKVNESTTPFQDTK---------QFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNI--DTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGI-----NANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSN-SADIEDDII---EKSLYVPMETDTYIYSS-IKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAH--FRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQND 8973
              ++  VVNPK + +  LYG  +P++ EW +G+I   T++                    F KE +       +L       K  R +S         L+ S    +S ES+     S ++ F       + K ++     +W+WIVLDGP+++ WVENLNTVLDDS++LCLA+GERI++ + ++ LFEVD+L  +SPAT+SRCAM+Y+    + W+  VK+W+ ++LP+  PESGK  L  LF  +I  G++FL + S+   IP T + S +  LC IL A I +LS++GGF      D   L+ +   ++ +  KV  S     ++            P + +  +K  FLQK+P +L NLLGKL+VF++TWS G    RQED + +  +    A G +    I     EFD FV+ +F+     G+RLP  NK I+SYF+DM+   F  WD+LVPS K+LI+   +++    +     +   Q+   +I+ ++D +R+SFL+ LL+L  HPVLL GDSG+GK+ +IN++LK++ +++G+ T  S ++LG +F +++K   LL +I +L++F   S+D   D++   +KS      T T I S+ ++ ++QTS ++    +  K++K+G+D +G PK +K+++F+DDLN+P  ++FG+Q  LE++RQ                 + D +++ AC P    ++PIS RL K+FC+L LPQPS+ + Q I+QV++GR+F + +F  E+   L  +V   I+VY++  +    +P KSHY FN+R + K+I GL+ A++ ++V KE   +  AHE  R  HDRL+S  DR  FF+ILSD LH   K+ W+ D+L    ++FG FF +   ++  ++Y+ + D  KL R  E S   +++    +   +FF+ +++H++R  R+  Q  GH+L++G++G GK + V ++S I  C+I RL +   Y    FR D+K +  +S ++    V  L+D  D+V +SF++D+  ++NSG +PDL++N+EL+ I  +LK     ++     + VY   I++++++LHV + +SP    +R R R NPSLINCCTIDWY +WS E+++SVA   F   E I N +++IE  KE   H      + ++++  E G ++  E+RR Y+++   ++E +  +  +L+++
Sbjct: 2180 GHVETFVVNPKCVKLGELYGETDPHTFEWSDGLIAAATRR--------------------FSKETA-------ILTPSTEDPKAVRLASSETHASSSHLAHSYECFWSPESRIRKSGSWRHAFFSWENETERKELTEGPITDWRWIVLDGPVDTLWVENLNTVLDDSKVLCLASGERISLSSGMRLLFEVDNLSQASPATISRCAMVYMDPVDLGWRPFVKTWL-SKLPRDMPESGKNHLQTLFSHAIDKGLRFLQQHSRFLFIP-TPENSIITCLCSILGAYIDFLSSHGGFGNPDKEDGQGLNPVTPDESHTQVKVLNSPIKVPNSHLDVLLIINGGVPSVSE--TKKYFLQKHPGQLCNLLGKLFVFSFTWSVGGILHRQEDGDEDEVVYRHNADGHEKNIDI---CHEFDNFVREIFEVEPPLGVRLPAGNKNIFSYFIDMETSNFVLWDVLVPSTKSLIEKGAVITIGETMGLAMQHQKGQDHEAKIVPTVDIVRFSFLTGLLVLKKHPVLLTGDSGVGKTAIINNMLKEMEKESGT-TFKSGTVLGTVFNFSEKKSALLENISSLTQFGQESSDHVVDLLLGSDKS-----RTTTGILSTTVQMSAQTSSHRLQSQIKLKLIKKGRDALGAPKGRKVVVFVDDLNMPAPEKFGAQPPLELLRQ----------------DIVDVNIVAACGPPGGGRNPISPRLLKNFCLLALPQPSTRSLQHIYQVQLGRFFQEGEFMPEVLECLFPLVSAAIAVYYRMGSTMLPTPTKSHYTFNIRDVSKVIQGLMQANEAVIVGKESCAQIFAHEATRVFHDRLVSSQDRRTFFEILSDNLHDYFKVRWSADKLMNEAVLFGDFFEMD-DATEQRIYRPMMDQTKLTRVLEDSYMRYNYGE-KSIQLVFFRDAVEHVVRAARVFRQPGGHLLLVGLDGTGKSTVVHLASYIAQCEITRLKLHKHYGTSEFRDDLKTLFRQSGVKGINTVFLLAD-SDIVKESFLEDINCILNSGEVPDLFDNEELDGITMDLKASATEADVPDTRDAVYQFFIQRVRQHLHVTLTMSPAGDKFRQRCRMNPSLINCCTIDWYDEWSEEAMLSVAQVLFASTEFIANPQLDIEELKECVAH----ICVAVHKSVAETGPRYWQEMRRHYYVTPSSYMEQIRLYARMLRDN 3294          

HSP 4 Score: 97.4413 bits (241), Expect = 0.000e+0
Identity = 54/128 (42.19%), Postives = 70/128 (54.69%), Query Frame = 2
Query: 13397 PDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVI-----------------SEKNKKEDS--YTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCEID 13723
            P+ GVLVFGLYLD A WN E   L       R+C +P IH   V                  +E +  E S  +T+ CPLYRTP+R G LSS+G S+NF+  + + S + P FWILRG A  + C+ID
Sbjct: 4772 PEDGVLVFGLYLDGANWNPELHCLQDQQTDHRFCAMPEIHFEPVAVCFIVRVTPDTSAVRDDTEASTTEISSVFTYECPLYRTPARAGTLSSTGLSTNFVTAVNIPSAQPPDFWILRGVA--MMCQID 4897          

HSP 5 Score: 76.6406 bits (187), Expect = 2.526e-9
Identity = 67/301 (22.26%), Postives = 124/301 (41.20%), Query Frame = 2
Query:  446 FQVVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKER----NLDSSSSSF----------------------MHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDENSDENKKSK 1270
             QVV+A  A+   ++WTVSAS +T   +     +++           +TPV  WL E+ LF+ + N   F  FR WKAF  WR  I   K  +++  L   L   + + Q C+  V  L E      +  +      + +  +D S+T +L +F + Q  Q  +    +  +   ++E V ++C    +   ++  +   S  +     L + S+S                       ++ E    RK +  +  FL+ +D  L +L   ++   + K    ++ S    E  DEN++ +
Sbjct:  390 LQVVSANTARAQSLYWTVSASYITLCDERNGKVDQSS----------ATPVLWWLWERRLFYMVYNFPVFVKFRLWKAFSLWRYCIRHQKNSENQALLYKTLFMANEVLQGCIIHVQSLCE-----TAKGTSKDRGAILLVDLDSSKTLSLQDFQRKQELQCDMAFRMMSALREKVIELVWESCATVAEMEGITQGIRGDSPRKVTIQPLAACSTSHPKVLKNGSARDTDQKEKKKLKPLYAEIAEWRKILARLACFLRAVDYSLQELLRHLVFSAVQKLLDHLMTSYQAHEEDDENEREQ 675          
BLAST of dynein heavy chain 6, axonemal vs. TrEMBL
Match: W4ZJR4 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 1084.32 bits (2803), Expect = 0.000e+0
Identity = 562/1303 (43.13%), Postives = 840/1303 (64.47%), Query Frame = 2
Query: 1610 KIPGISVQISLSPILENILFCLKDLIEEAELTICS----VETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQ-QFDLFT------GNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHL-RLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINL 5482
            K+P   V ISL P  E  +  +K +I   E T+ S      T SS  C        Y +     +L             +P+    L  + EY  +V  +L+  + ++  +  Y          VD+A +     S  + +W  +EF   L  ++E +  ++   K +R G I ++ +N  +   PY   V+  V ++L + A   N+  + ++++A+K LD  P++VEEFVEHL F++++ +E+ S++KE   + ++FTI  +F VP+  E+LALY+TL  + Q LK+ ++Y EAKKDENI KFS DL   I+ +     +I+ + +  + L  +    + +++L  L +E+  +  K R+Y++YQ+RFGSS+S   S++R +    D  T      G +A  +  ++ E+ER++ +R LLWE+  EW    E++   + D   V+ +++ VS+   TV +LEK LP NE+LP +K LV   K  +PVI ALRNP L+ RHW +I+ +IG ++ ++KNFT+G+ +  ++ QYK  I +IS  A+NE TLE ML KV D++ V +FRLV HS RD  II G DDI   LEES +TI TI+GS+YV  I+  V++W+RKL+  A+ LDEW+ CQ++WLYLEQIF T DIQRQLP E +LF  VD  W+ +M++T+++P  L+C T  GVL+ILQT NS LEKI K LEDYLE KR++FPR +FLSND+LL+IL+++++P+ VQ HL K F N+  L+         ++  ++S EGEA  LP+N+R R   EQWL ++E  +F+ V+R +K  + +   K   DW +++ GQ +L   Q+ +++ V+ +L+   D +++  L        L+  L +LA  V++ +  YKR ++EA++VI VH+RD   +L+++ ++   DFEW KQ+RY W E  + C V Q ++ F+YG EYLGCS RLVITPLTDRCY+T+TGA++ +LGG   GPAGTGKTET+KDL+K +G+ C+VFNCS+ LD   + K  SG+ Q GSWCCFDEFNR+++EVLSVIA Q++SIK AKD+   RF+FE ++I+LN  CG+FITMNP+YAGRVELPDNL  LFRPV+MMVPDY LI E++LFSEGF +A+ LS+KI NLY+L + QLS Q HYDFG+R+IKSVL++ G   R  ++  +E   L+  EE  ILI A++ +N P+ + +D+PLF++I+ DLF   D    +  +LER+I ++ ++L  + WP QIE +K L+SQ+  RHGVML+GPS  GKT +R+ILQ+AL  LP I++
Sbjct: 1025 KVPS-KVTISLQPSREQFMSKVKGIIAGFEHTVVSGALLATTLSSPPC--------YGRRGGATAL-------------APTWSCSLGKNGEYGSSVTEVLQALSENVNSVQEYAKNFEPYTGMVDQARRVDVEGSLQKREWTTEEFNHVLSAHSEMVHSMDNMEKERRSGMIHVKVQNFQKTCLPYPTNVMVAVVKRLPQIANRRNENLLKVIKSASKKLDHMPQSVEEFVEHLSFLSRMGSELPSLEKEYFVVTRLFTIAKDFDVPIQPEELALYQTLMPSFQHLKSTIIYCEAKKDENISKFSDDLNIHIQGLLSEAYDIRNRVQAPTLLSADTLAVVAMEKLKLLSDELSAISGKARSYASYQDRFGSSIS---SQNRMKGISEDYMTSDYNDRGASAQQILSELSEIERELQLRKLLWESSDEWGNLVEDWTETQFDGLNVDVMQKNVSKFTQTVFMLEKGLPANEVLPRLKELVLSFKQGMPVITALRNPALRPRHWQEIQALIGRAIIRDKNFTLGKFLELQLFQYKDQINDISTTASNEATLEVMLNKVIDLWRVTDFRLVPHSGRDFSIIAGADDIMTQLEESQVTIGTIRGSRYVTPIKALVDEWDRKLNVFARTLDEWMMCQRNWLYLEQIFTTPDIQRQLPTEAKLFASVDKSWKDIMRRTEDRPNALRCATLPGVLEILQTNNSNLEKIHKCLEDYLETKRLVFPRFYFLSNDDLLDILAQSKNPDAVQPHLVKCFGNIKSLEFHREPKLPPTVRAMISAEGEAIFLPKNVRARNPVEQWLGSVESAMFDSVRRNLKESVGKW-GKDLEDWVMSHPGQIVLTVVQIMYNREVTASLE---DRKASKALM--ESRDRLVGRLNILAGMVTKPLPHYKRNSVEALMVIMVHSRDIVNNLIDSKIRKSDDFEWTKQLRYQWEEQGNSCIVHQANASFQYGYEYLGCSLRLVITPLTDRCYLTLTGAMHMHLGGSPAGPAGTGKTETVKDLAKSVGKLCLVFNCSEGLDYKMMGKFFSGLSQSGSWCCFDEFNRIDIEVLSVIAQQLHSIKTAKDANALRFMFEGRDIRLNTTCGVFITMNPTYAGRVELPDNLKSLFRPVSMMVPDYALIAEIMLFSEGFTSARSLSNKIVNLYQLASKQLSQQDHYDFGMRAIKSVLVMAGQRKRKAQMESTEAKPLSELEESYILIHALRDANMPKFLAEDVPLFENILADLFPGIDPPQPDFGVLERAISMAIRDLTLQHWPSQIEHVKQLHSQILVRHGVMLVGPSGGGKTSVRNILQRALVVLPTIHM 2296          

HSP 2 Score: 631.328 bits (1627), Expect = 8.426e-178
Identity = 346/1005 (34.43%), Postives = 558/1005 (55.52%), Query Frame = 1
Query: 5554 AKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQN----DLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRF--SVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVS---------FLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASG----------------KKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSG--INANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIE-----------DDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMD 8430
             ++D   +NPK + +  LYG  +PN+LEW +G++    +K   FS ++ +     L  ++  +  +N +    DL ++      +   R  S           S SQ    SV   D ++   +++  K     S ++  +WQW+VLDGP+++ WVENLNT LDDS++LCLANGERI++   ++ LFEVD+L  +SPAT+SRCAM+Y+    + W+  VK+W+ ++L K  PESGK+ L  LF+KS+  G++F+ +    Q +P  S+ S + TLC +L A + +L  NGGF N   D    S  +S        +     K+ P   KE  KV          +LQK+P +L N+LGK++VF Y WS G    R++D + +  I                     KK+    +  + EFD FV  +FD     G+RLP  ++TI+ YFV+++ G F PWD LVPS K+LID  G+   S G  +   NQ                      M    PVLL GDSG+GKS LI+ +LK++CR+ G++T +  SILG++F Y+D+  N+LS+I  L+    + D             D        V  +    + ++++ ++QT+  +    +  K++K+G+D +  P+ KK+++F+DDLN+P  +++G+Q  LE++RQ++EL+GF+D T L W  ++D +L+ AC+P    ++ IS RL KHFC+L LPQPS+ + Q I+QV++GR+    DF  ++K  L  +V   I++Y+K       +P KSHY FNLR L K+I GLL A++  V + E   + +AHE +R  HDRL+ D DR  FF+ L+D+LH   K+ W+ + L     +FG F  L  + S+ ++Y+ I D  KL    E  +   ++        +FF+++++H++R  R+  Q  GHM+++G++G GK + V+++  + GC++F+L +T  Y    FR D+K V  K+ ++    V  L+D D
Sbjct: 2314 GRVDTFTLNPKCVKMGELYGQTDPNTLEWTDGLLASAVRK---FSRESAS---HHLGVEDEGRPGTNISGTIRDLDSVSGMTTPRSASRGPSPGGGASYPPSTSASQSVPDSVTGDDTVRPLTEDRSEKMGHGASEQTPNDWQWLVLDGPVDTLWVENLNTALDDSKLLCLANGERISLTPGMRLLFEVDNLSQASPATISRCAMVYLDPVDLGWRPSVKTWI-SKLSKDIPESGKQHLQALFDKSLDKGLEFVQEYKGHQHVP-ASQTSMVNTLCNLLGAFLDFLGKNGGFGNP--DDERPSSGESLMSSQSGRSSRSGNKRGPKKNKEKPKVQSNRGSTKEWYLQKHPDQLLNMLGKIFVFCYVWSIGGVLRREDDSDDDGGISIGPAAGSGGGGGGGGGGGGGKKAELVEFNISYEFDGFVHDMFDTEPPLGVRLPSGSRTIFHYFVNLESGKFVPWDELVPSTKSLID-KGVTHVSLGEQLGVTNQ----------------------MSKEKPVLLTGDSGVGKSALISHMLKRLCREKGTTTEHG-SILGEVFNYSDRGTNILSNISALTSSVLNEDGMNGGGMMGGGAMDLTFMTGGQVKKQVTGLVSTTLQLSAQTAPARVTTQIQHKLIKKGRDTMVGPRGKKVVVFVDDLNLPAPEQYGAQPPLELLRQFMELHGFYDTTKLTWKNISDVTLVAACAPIGGGRNSISPRLLKHFCMLALPQPSTRSLQHIYQVQLGRFLENGDFLPDVKELLNPLVSASIAIYYKMCANILPTPAKSHYTFNLRDLSKVILGLLLANETTVTSTESAAQLLAHEAMRVFHDRLVDDKDRLKFFEFLADDLHNYFKVKWSAETLRDKPFLFGDFLDLN-APSAERIYRPINDYGKLASILEEFLVRINY---GGGQLVFFREALEHIVRAARVFRQPGGHMVLVGLDGTGKSTTVQLACHVAGCELFKLMLTRGYGQSDFRDDLKTVFRKAGVKGINVVFLLTDSD 3280          

HSP 3 Score: 74.7146 bits (182), Expect = 7.820e-9
Identity = 69/283 (24.38%), Postives = 118/283 (41.70%), Query Frame = 2
Query:  446 FQVVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTC-----------------QNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDE 1243
             QVV+  EA+ SK+ +T SA+ VT   +      E +  +IT       P  QW +E+ LF  +     F  FR WKAF  W+ N+  +K  + +  +   L  ++ I Q C+  V    E     ++      E  + +  +D  +T  L EF +NQ N+       L ++    ++   + C                    T K+ L     E SK+   D  S    +T+  + R  +  + +FL   D  ++ L HR++K  +    +F+  SI+  E
Sbjct:  417 LQVVSPNEARTSKLHFTASATFVTLHIEE----GEYEYDEIT-------PTMQWQYERRLFAAIHTQSVFVKFRIWKAFNVWKINVRAAKNAQAKTIMKKQLFTVNEILQRCLLYVRAQCEAACSSMT-GQGTGEKAICLVALDNHKTLTLGEFCKNQANRCDAAHLQLSRMREKFVKLAWECCVKVAEMEGINHKFLPGQGPLTKKVQLKRDKVEKSKK---DDKSIGPTYTQIAQWRAILLRLAKFLHATDYVILDLLHRLVKTAVRLLQEFLQMSISTGE 684          
BLAST of dynein heavy chain 6, axonemal vs. TrEMBL
Match: A0A2R2MJL3 (dynein heavy chain 6, axonemal OS=Lingula unguis OX=7574 GN=LOC106154273 PE=4 SV=1)

HSP 1 Score: 1083.94 bits (2802), Expect = 0.000e+0
Identity = 574/1295 (44.32%), Postives = 836/1295 (64.56%), Query Frame = 2
Query: 1610 KIPGISVQISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYN--KINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFT-GNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISET-VK-LNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLIN 5479
            ++P      +LSP    I   ++ +I   E T+  V +   +  L +F     +  K+N       E   +++P    P    +   D EY   +  ++   T +   +  +    +  C  V++A +     S  + QW  DEFQ  L  +T+++ ++   + +KR+G I L  +  ++   PY   V+ I+++KL   A   N++ IN+++ A K LD  P +VEEFVEHL F+ ++++E+  +DKE   + +MF+I  +F V +  E+ ALY+TL  + Q LK+ V++ EAKK+ENIRKFS DL+  + +IR  IMEIK K R+ + L  +      L+ +  L+++V  L +K R+Y +YQ+RFGSSLS++   S +    D       A  +Q ++ E+ERD+++R LLWE+  E  R  E +     D+  V ++++  +R   TV +LEK LP NE+LP +K  V + K  +PVI +LRNP L+ RHW  IE +IG ++ K KNFT+G L+   I ++K  I +IS  A+NE TLE ML KV D++   + RLV+H  RDTWII G DD+   LEES +TI TI+GS+YV  I++QVE+WERKL+  A+ LDEW+ CQ++WLYLEQIF T DIQRQLPNE +LF +VD  W+ +M++T+++P  LK  T  G L+ LQ+ N+ LEKI K LEDYLE KR++FPR +FLSND+LL+IL+++++P+ VQ HL K F N+  L+I +   Q  ++  ++S EGE   +P+N+R RG  E WL  +E G+F+ VK+ +K  L +    +  DW L + GQ +L   Q+ F+++V      T +P    +    SI  +L++ L +LA  VS ++ S+KR ++EA+++I VHNRD    +++N V  + DFEW KQ+RY W+E ++ C V Q ++ F YG EYLGCSPRLVITPLTDRCY+T+TGAL+ +LGG   GPAGTGKTET+KDL+K MG+QCVVFNCS+ LD   + K  SG  Q GSW CFDEFNR+++EVLSV+A Q+ +IKAAKD+   +F+FE ++IKLN  CGIFITMNPSYAGRVELPDNL +LFR VAMMVPDY  I E++LFSEGF  AK LS KI NLY+L + QLS Q HYDFG+R+IKSVL++ G  + +  L S+  VK +   EE  ILI +++ +N P+ + +D+PLF+SI+ DLF       ++  +LE++I +S ++ G + W  QIEK+K L SQ+  RHGVML+GP+  GK+  RSIL +AL  LP I+
Sbjct:  868 EVPKNRAHCTLSPNEYEIKRAMRGIITGFEYTVAQVGSMLREPRLAVFYSPPKHDLKLNYDEEREEEDREKQKPW---PDTAFIFGEDPEYMGLIDELMNYVTQAAEQVADFSENYDKYCLMVEQARRMDVEGSMAKKQWSTDEFQHVLSIHTDQVREMKNMVLSKRLGMILLMAEKFSEACMPYPTNVLNIIHKKLPVVANKRNEDLINIIKGALKKLDHFPSSVEEFVEHLSFLGRMSSELPVLDKEFAIVTKMFSIAKDFDVAIPAEEFALYQTLAPSFQHLKSTVLFCEAKKEENIRKFSTDLDSLVNDIRFTIMEIKNKVRDPALLHADTIPLAALENIKYLQDQVQTLASKARSYGSYQDRFGSSLSQSKKFSEEYLLMDRRDDAAKAQAVQHELSEIERDLTLRRLLWESSEELTRLMEEWTSTPFDKLNVESLQKHTNRFTQTVFMLEKGLPHNEVLPKLKERVLDFKQGMPVITSLRNPALRARHWSVIEGLIGKTIMKEKNFTLGNLLDMNIFKHKDKIQDISTTASNEHTLEIMLNKVIDLWQHTDLRLVAHQGRDTWIIAGADDLLAQLEESQVTIGTIRGSRYVTPIKSQVEEWERKLTVFARTLDEWMTCQRNWLYLEQIFSTPDIQRQLPNEAKLFSQVDKTWKDIMRRTEDRPNALKAATATGTLEALQSANANLEKIHKCLEDYLETKRLVFPRFYFLSNDDLLDILAQSRNPDAVQPHLGKCFGNIKALEIKTLPRQPPTVKCMISAEGEIVQMPKNVRARGPVETWLGGVEMGMFDTVKKHLKMGLSDWVGIKLQDWVLKHPGQVVLTVAQIMFNKDVLNCF-ATYEPRKAMM----SIQDNLVETLNVLAGLVSTNLASHKRLSIEALLIITVHNRDIVADMIDNKVTKKDDFEWMKQLRYQWDEQTNNCHVLQSNASFIYGYEYLGCSPRLVITPLTDRCYLTLTGALHLHLGGSPAGPAGTGKTETVKDLAKAMGKQCVVFNCSEGLDFKMLGKFFSGSSQSGSWSCFDEFNRIDVEVLSVVAQQLLTIKAAKDTGAPKFVFEGRDIKLNMTCGIFITMNPSYAGRVELPDNLKYLFRSVAMMVPDYTQIAEIMLFSEGFTAAKSLSGKIVNLYQLASKQLSQQDHYDFGMRAIKSVLVMSGQRKRQAQLSSDGRVKSMTEKEESYILIHSLRDANLPKFLAEDVPLFESILADLFPGIIPPEQDQGILEKAISMSIRDQGLQHWFSQIEKVKQLYSQILVRHGVMLVGPTGGGKSTARSILHRALVLLPSIS 2154          

HSP 2 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 433/1238 (34.98%), Postives = 715/1238 (57.75%), Query Frame = 1
Query: 5554 AKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMIS--FSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADS-----------------------SR---KVNESTTPFQDTKQFPFIQK-ENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILS------FSSGINANNQNRV-NEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETD-----TYIYSSI-KFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDH-EHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVA--HFRXXXXXXXXXXXXXTSKEDTMHNL----TEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
             ++++  +NPK + +  LYG  +PN+ EW +G+I    ++      S   ++  +   +        +   D+    N                        +S+    + Q V  D+  +    +          +W+W+VLDGP+++ WVENLNTVLDDS+ILCLANGERI++   ++ +FEVD+L  +SPAT+SRCAM+Y+    + WK  VK+W++ +LPK  PESGK  L  LF+ +++ G++F+ +  K Q +P     S +  LC IL +   ++S NGGF +   ++   S ADS                       SR   K+ E     +D       Q  ++ K  ++QKNP +    LGKL+ FA+TW+FG +  R ++++ +  +    G K    I     EFD FV+ L +     G+RLP  +KT++SYF+DM+ G F PWD+LVP   +LI+   +++       S+G     + R+ NEI+ ++D++RYSFL+ LL+LN HPVLL G+SG+GKS +I  +LK++ + NG++T N  +ILG +  ++DKNQ+LL +I +L+KF+   DI+    EK+L + M T+     T I +S+ +F++QT+  +    +  +++K+G+D +G PK KK+L+F+DD N+P  +E+G+Q  LE++RQ+++L GFFD   + W  + D +L+ AC P    ++P+S RL KHFC+L +PQPS+ + Q I+QV++GRYF   DF  E+K  L S+V   I++Y+K       +P KSHY FN+R L  +I GLL A  +++VNKE+  +  +HE  R  HDRL+   DR  FF  LS+ LH   K+ W  + L    ++FG F  +  +++  K+Y+ ITD  KL R  E    T  +  ++  +  +FFK++++H+ R  R+  Q  GHML++G++G GK + V++S+ I GC++F+L +T  YN   FR D+K V   + +Q    V  L+D  D+V +SF++D+  ++NSG +PDL++N+EL+ I+  LK     ++       VY   I+++++ LH+ + +SP  + +R R R NPSLINCCTIDWY +W+ E+++SVA  +F   + +      I   + + + +L     +  + I+ +      +F  E+RR Y+ +   ++E +  +  +L+ +  +   NR RL  GL++L E  SL+  M+E+L+ L PKI+EK+++TE
Sbjct: 2182 GRVEIFTINPKCVKLGELYGETDPNTFEWTDGLIAHAVRRFAREVASTPTEDRPSTAATALTSATGLTGATDVTASTNPSSPG------------------PISEVGETDGQTVAGDAADHPPDHETMHEGEMIPVDWKWLVLDGPVDTIWVENLNTVLDDSKILCLANGERISLGFGMRLMFEVDNLSQASPATISRCAMVYMDPVDLGWKPYVKTWLQ-RLPKEIPESGKHHLQALFDHTVEKGLEFMLQHQKFQSVP-VPAMSMVNCLCSILMSFFDFMSKNGGFGDPDKEVGRPSSADSHTSSQSRSSSRTDVSGTKKMKKRSRRQAKIKEELQKIEDRASAKKDQPHKDQKQYYMQKNPGKFTIFLGKLFAFAFTWAFGGSLQRFDEMDDDIAVTKKEGDKDKPDI-NICYEFDGFVRDLLEVEPPLGVRLPSGHKTMFSYFLDMESGNFVPWDVLVPKTNSLIEKGAVITIGDTMGLSTGHAKPGEGRLENEIVTTVDTVRYSFLTGLLLLNGHPVLLTGESGVGKSAIIKHMLKEMSKDNGTTTKNG-TILGNVLNFSDKNQSLLENISSLTKFAMEEDID---TEKNLDLLMGTNKPKQNTGISTSLLQFSAQTTSARTQLSIIHRLIKKGKDTLGGPKGKKVLVFVDDFNMPAPEEYGAQPPLELLRQFLDLGGFFDTRRMLWKDIMDVTLVGACGPVGGGRNPVSPRLLKHFCMLAVPQPSTRSLQHIYQVQLGRYFQDGDFMPEVKESLFSLVSASIAMYYKMCMNMLPTPAKSHYTFNIRDLTDVITGLLQAHQQVIVNKENCAQLFSHEATRVFHDRLVDSADRAAFFSFLSETLHDYFKVQWEAESLMHTPVLFGDFSHMDDATTG-KIYRPITDTVKLCRTLEEHFMTQQNIGNVQASQIVFFKEAVEHITRAARVFRQPGGHMLLVGIDGTGKSTTVQLSAHIAGCELFKLTLTRGYNMQDFRDDLKAVYKLAGVQGHNTVFLLTD-SDIVKESFLEDINCILNSGEVPDLFDNEELDGIVMELKAAATEADVPDTRVAVYQFFIQRVRRNLHIVLTMSPAGNKFRHRCRMNPSLINCCTIDWYDEWNEEAMLSVASVYFSNSDFVAESGQTINYEQNEQLEDLKLRVAQVCVNIHNSVSAATLRFWEEMRRKYYTTPSSYMELIRVYSMMLRGNKKEFMDNRDRLLVGLSKLSEANSLVGTMQEELVTLGPKIEEKAKDTE 3392          

HSP 3 Score: 363.614 bits (932), Expect = 0.000e+0
Identity = 171/408 (41.91%), Postives = 265/408 (64.95%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFK 10424
            ET+ V++Y+ +C++DL SV P L+ +I +LDSL+K+ ++E+RVY NPP LV  VM +VCVLL   P WA AK +LGDA FL++L+ ++K+ +  K+Y  L++YT   DF P+ VG VS+AC+S+C+WVLA+E Y+ V  M+ PK++ V EAK+AL ++++ L  KQ+ L K++DH+K L  +YQ+SV +++ LKER + T  R+ RA+ LI A+  EK RW  S+K  D   + ++G  + SAA   + G +T  YR     KW +      IPI + Y+ V+    A  +L W N GLP D+   EN   ++K +KWPLLIDPQ Q  +++        +++     +Y+  +ERAIRVG+ + L+++   +DP L P+L +E F RG   +IKLG+ E+EY+ +F+
Sbjct: 3422 ETQIVQDYADECQQDLNSVIPALQTAIGSLDSLDKSDVAEIRVYTNPPELVMTVMASVCVLLQQKPDWATAKQVLGDAGFLKRLVQFDKNNLPDKVYNKLKKYTKHADFTPDKVGTVSVACKSMCEWVLALERYNEVYKMVKPKQRRVEEAKEALHLAQKNLAQKQSSLSKIQDHLKLLQQQYQDSVNQRESLKERKKTTALRIQRASVLISALADEKVRWAESVKVLDFKLQGLVGDTLVSAAAVAYLGAFTAKYRRELILKWEERCRAAEIPISEEYELVKIIADANQVLQWQNEGLPTDTLSTENAIFVKKGRKWPLLIDPQGQASKWIAEMEGTKLKIVQASDPNYMRTMERAIRVGEPVLLQEVTETLDPSLKPILLQETFTRGGQQLIKLGDTEIEYNENFR 3829          

HSP 4 Score: 78.1814 bits (191), Expect = 7.230e-10
Identity = 54/182 (29.67%), Postives = 83/182 (45.60%), Query Frame = 2
Query:  452 VVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTC 997
            +V+   A+ S +FW+VSASSV+   Q   N  E  +          TPV  WL EK LF  + ++   N FR WKA+  W+NN+   K       LT  L   + + Q CV  V  L E     ++    + E  + +  ++ + T  L EF   Q  Q  L  + L  +   +++ V K+C
Sbjct:  377 IVSVNAARASPVFWSVSASSVSMCIQT-PNGEETFV----------TPVMLWLWEKRLFDMIYDLPVLNNFRIWKAYTLWKNNVRNHKTTNSLEILTKQLFCANEVLQGCVLHVQSLCEAASGSLT-GFGSGEAAICLVKVNKAVTLTLKEFVATQRLQGELALKQLFALRKKVIDVVWKSC 546          
BLAST of dynein heavy chain 6, axonemal vs. TrEMBL
Match: A0A267FX73 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001838g5 PE=4 SV=1)

HSP 1 Score: 1083.94 bits (2802), Expect = 0.000e+0
Identity = 544/1235 (44.05%), Postives = 811/1235 (65.67%), Query Frame = 2
Query: 1838 PSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGN---TASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQ------KQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRL--ERVLI-----------SETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLI 5476
            P+ +L+ D+D  +   +  +      S  ++  +       C  VD A +     +  +  W  ++F + L+  TE +  +   +  +R+ F+S+ T++      P+  +V+G ++E L ++A   N   +N +  A+K LD  P  VE+FV+HL F+NK   E+ +M+KE   +N+MFTI  +F V +  E +ALYKTL  + Q+LKN V+Y+EAKK+E++++FSADLE  I +IR  I +++ +     FL +   +   ++ +  L+ +V  L  K R+Y++YQERFGS      +++RQ + F   +G    TA  +Q+++ E+ERD+++R LLW++  EW + ++   +  L +  V++++++V++   TV +LEK LP N++LP +K  V E K+ +PV++ALRNPNL+ RHW  I+ ++  ++++++  T+ +LI + +L+++  I EIS  A+NE TLE ML KV +++   EFRLVSH  R TWI++G +DI   LEES +T+ TI+ S+YV  IR QVE+WER+L+  ++ LDEW++CQ++WLYLEQ+F T DIQRQLP E + F  VD +W+ LM++ +++P  L+C T  G  + LQ CN +L+K+QK LEDYLE KR+IFPR +FLSNDELL+IL++A++ + VQ HL KLF+NV +L I     Q  ++ ++ S EGE   +P+N+R RG  EQWL ++E G+F+ VK+ I++ L E          Q   W +++ GQ IL  TQ+ F+++V  AL  + DP       +       +Q L  +A  +S  +  + R ALEAM+++ VHNRD   SL +N V S  DF W+KQ+RY W++ S+QCQ  QVD+  +YG EYLGC+PRLV+TPLTDRCY+T+TGA++ +LGGC  GPAGTGKTET+KDL+K +G+ CVVFNCS+ LD   + KL SG+ Q GSW CFDEFNR+++EVLSV+A+Q+ +IKAAKD   +RF+FE +E+KL+  CGIFITMNP+YAGRVELPDNL  LFRPVAMMVP Y LI E++LFS GF +AK+LS KI NLY L + QLS Q HYDFG+R+IK VL++ G +R+  ++ LI                L  ++E  ILIQA++ SN PR + +D+PLF++IM DLF +F    +  + L+ +I  S  ELG +VW  Q+ K+  L  QL  RHGVML+GP+  GKT  R IL KAL  LP +
Sbjct:  925 PNRQLLFDSDAAHQAALSELNSTVDRSESNVAAFARQFIRFCGMVDTAKQLDVHKANAKRPWQTEDFHRALLTFTEHVSAMKAMVPEQRVDFVSVSTEDFASSCLPHPSRVLGQISEILPRQAHARNVSLLNHVHDASKRLDITPDNVEQFVDHLTFLNKTATELPAMEKEFLVVNRMFTIARDFGVQLEAESMALYKTLGPSYQRLKNIVMYHEAKKEESVQRFSADLESLINKIRNEITDLRVEVNQPMFLSRATAEKTAVEAIRELQEKVGGLSIKARSYASYQERFGSQ-----AQARQARFFSEDSGGASSTAKAIQQELAELERDLTLRRLLWDSLEEWRQLHKELELTPLHQLNVDSLQKSVAKFTQTVFMLEKGLPHNDVLPHLKEEVMEFKTGMPVVLALRNPNLKPRHWKDIDDVVQKNISQDELLTLVDLIETNVLRHRNTIQEISTTASNEATLEQMLRKVVELWQSTEFRLVSHQARGTWIVSGAEDIQAQLEESQLTVGTIRSSRYVGPIRNQVEEWERRLNLFSRTLDEWMSCQRNWLYLEQVFHTPDIQRQLPAESKAFAWVDKQWQELMRKVEDRPNALRCGTSAGTFETLQQCNIQLDKVQKCLEDYLETKRLIFPRFYFLSNDELLDILAQAKNFDAVQPHLPKLFSNVKQLDIRQLPRQPPTVFNMASAEGEIMSMPKNLRARGAVEQWLGSVEGGMFDTVKKHIRQGLAEHPGYAGKGVSQLQSWLVDHAGQVILTVTQIIFTRSVDAALNSS-DPHKG----VVKFSMSTVQLLNQVAGVISAPLSEHIRLALEAMLIVNVHNRDILTSLADNKVSSSEDFNWRKQLRYQWDDVSNQCQALQVDAVIQYGYEYLGCAPRLVLTPLTDRCYLTLTGAMSLHLGGCPAGPAGTGKTETVKDLAKSVGKHCVVFNCSEGLDYKMLGKLFSGLAQAGSWACFDEFNRIDIEVLSVVASQVQTIKAAKDQLAQRFVFEGREVKLDSSCGIFITMNPTYAGRVELPDNLKSLFRPVAMMVPHYALIAEILLFSGGFRSAKILSRKIVNLYELTSKQLSQQDHYDFGMRAIKYVLVMAGQMRMKAQQGLIEVPDLKASGGRGRHSVLTEDQEAYILIQALRDSNLPRFVAEDVPLFEAIMSDLFPNFSAPDKLSEHLDMAIRQSCHELGLQVWESQVAKVHQLYKQLLVRHGVMLVGPTCGGKTATRLILFKALGLLPSV 2149          

HSP 2 Score: 924.465 bits (2388), Expect = 0.000e+0
Identity = 504/1406 (35.85%), Postives = 784/1406 (55.76%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTP----SWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMR--------YSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFD--MSSYNF-KEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSK-----HHEDQKTTDSNSALDMLKV-----ISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLPRNLL---GDLEEYFAQS 13334
            E E VE Y+ +C++DL SV P L+ +++ALD+L+K  ISEVRVY NPP LV  VM +VCVLL V P     W  +K LL D +FL ++++ +KDAI+ K+++ L+++T Q +F P+  G VS AC+SIC WVLA+EHYH V NMI+PK++ V EAKKAL I+K  LE KQ +L  +   +  L    + SV E++ LK+R+  T  RL RA  L  A+  E+ RW  +I       + + G  + SA    + G  T  YR+ A ++W D+   KSIP+ D + FV  + + + +L+W N GL RD++ AEN  I+ +S++W L+IDPQ+QG R+LQ   + S ++       ++  +ERAIRVG+ + L D+   +DP LGP+LRKE F RG   +I++GEN+++Y   F+LYL ++  NP  + + + LV I+NF+V   GL+EQLLS +V++E+PE+E ER   L++ A D   LR LED+TLGLLQ ST  I++D +L + LE+S+  + +I +R+ +    E++L  AR+ YLP+A RGA IYFV+ADL  +N MYQ+SL+ F++ F   +  +  +  E+  +S E +++++I  VT  +    +  LFS HR  FAF+L  ++MR         S+  S   + Q+ W  F  LH              +       P  I+W +  V   C  LE      F GLC SF      W  +  +E+ F   +   N   +F    L+ F +L+LI +L   +L  S R  V   LG +F+    + L   F  + A+ P++F++   +DP   +M+L  +LRG+  +LD+VS+GRGQ  KAE LI K  I KGRW+FLQNC L  SWMP LQ+L+++ Q      D+ F+L+LS+ P + FP+ +L  + K+AIESP G+K+ L K+FA DGTG V+   +++Q+   R+++F LCLFN+V+LER  +GSLGF++PY+FNDSDLE+S+  +      + V W A+ +++G+I YGGR+TD  DRRCL  +L  +        G + F      L     +F    ++I  N     +  ++ G+  N+E   +E + +  +  +   Q +           + DS    D L +     ++  +P+SVE+  ++          E +    G      K   L   +  +  +      S  H +L QEI +Y+ LL ++ +D+K L   L G+  +T+SLE+ L     N VPP+W      KSLS W++++R R+ F+  W   ++R++ +   L+                + ++  +  E                    +WLP FF PQ  +TAV+Q +AR +   +D+L     VLP +     G +EE+  QS
Sbjct: 3434 EAEIVERYAFECQQDLDSVIPALQEAVRALDALSKQDISEVRVYTNPPDLVLQVMGSVCVLLGVKPDAKNPWKTSKQLLTDPHFLSRMVSLDKDAISPKVFRQLKKFTRQANFKPDQAGQVSRACQSICTWVLALEHYHDVQNMIVPKQRKVEEAKKALAIAKSNLEVKQKRLGLIVQQLAALQRDCEASVSERESLKQRLVQTGARLKRAGLLTAALGGERQRWEEAIDSLRLRLRTLSGDTLLSAGAVAYFGALTAPYRQAATQRWCDLCREKSIPLSDGFSFVGCQTTPHDLLDWQNRGLARDANSAENAVILHESRRWCLMIDPQQQGLRYLQG-LEPSLKLARATDPAFLQTVERAIRVGEPVVLLDVGESLDPTLGPVLRKEIFHRGGHKLIRVGENDIDYGDGFRLYLCTATHNPHFLPAASILVNIVNFSVTFEGLQEQLLSCVVAQERPELEQERAALLQSLARDGSLLRELEDRTLGLLQGSTGHILDDEDLPRTLEQSRSMSSEISERVAKAAATERELSAARQVYLPVATRGAVIYFVIADLPSINLMYQFSLSTFESSFRRVIAAVPSKNSEDQPLSLEQRMRQMIHDVTMTTQRTVTLALFSEHRLCFAFLLCAAVMRAVDRLPAAASVGTSAEPLPQRDWNFF--LHGAELAGLSATATSGTAAAPTDGPIEIDWPSESVRTACASLESAPSSGFEGLCASFSQATAQWQSFRDAEDAFKLMLKPPNLTPQFDWSKLSDFRRLLLIRLLRPAQLEASMRHLVARQLGPEFTGTNTAGLREAFESASAETPLLFLMAPGADPTAALMRLATDLRGSALHLDMVSLGRGQGPKAEELIGKAQILKGRWVFLQNCHLAASWMPRLQQLVDSFQRGTMQLDSQFRLLLSSKPDASFPVPVLHAACKVAIESPRGVKSLLRKAFAPDGTGLVSSRGFDSQTPDTRRLVFALCLFNSVLLERSRFGSLGFNVPYEFNDSDLEVSLVHL---TGKSTVDWPAVSHLVGDIAYGGRVTDERDRRCLAAVLGAFLRPEALQPGWQ-FATGLTSLPDE-AEFNWTQAYI--NQLPEAEPPDVFGMDSNSERAAMEARGRRLLDVVAAAQPRIATTTAAGSATSVDSIGGADALAMEVIEHLTQLLPKSVERESLEP---------EDLRKRLGPRQSLAKAMALEAQRSGSGTVASGKLGSALHQLLRQEIDRYDNLLRQVRRDLKQLRLALHGDTLMTDSLESALSAFLRNRVPPAWLRYESCKSLSAWAADLRTRVRFLAGWAERLVRDFQQRSGLL---------------KEPDMFPHGPEPF-----------------AHWLPAFFFPQGFLTAVLQAQARRLRVPVDLLEFRHRVLPSSPPIGSGSVEEFAFQS 4788          

HSP 3 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 419/1256 (33.36%), Postives = 706/1256 (56.21%), Query Frame = 1
Query: 5554 AKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFT------KDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGF---------------DNLSLDILDASKADSSRKVNESTTPFQ-DTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIE-TNIDTASGKK-----SGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDAS------GILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETD------TYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNI--QSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKV---------------YQQITDVEKLIRFFE-----SSINTFDHEHLNTN------NFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDP-NDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            A ++  ++NPK + +  L+G  +PN+ EW +G++  + +K     N+ Q     Q      +++     +   +         E   S+          SV     VE +    +S K++ +      +  KI+ +   ++W+W+VLDGP+++ WVENLNTVLDDS++LCLA+GER+ +  S++ LFEVD L  +SPAT+SRCAM+Y+    + W+   ++W   +LPK  PESG++ L  L E+S+  G+ FL +  + Q+I  + +   + TLC ++ A++ +++ +GGF                  +           SR    +T   Q + KQF           +++KNPKEL NLLGKL+VFA+TW+FG    RQE+++I+ +N+  A G       S   + + ADEFD  V  LFD     G+RLP  ++ I+ YFVD++ G F PW+ LVPS  +L++ +           SSG   + ++   E++ ++D+IRYSFL+ALL+++  PVLL G+SG+GK+ L+  +LK++   NG+ST    S+LG++  Y++K+  LL S++ L+  ++  D   D  +++     +T+      + ++++ +F +QT  ++    ++ ++VKR +D++GP K ++M++F+DDLN+P  DEFG+Q+ LE++RQ+++L GF+D   L W  V D  ++ AC P+   +  +S RL +HF +L+LP PSS + Q I+ V++GR+    DF  EI+  + ++V   I++Y++     K +P K HY +NLR L K++ G   A +K+V ++E       HE  R +HDRL +  DRE FF  L+DEL   LKL    D L    +MF +F     + SS                  Y  + D+ +L +  E       +   D      +       F+FFK++++H++R +R+L Q  GH+L+IG++G GK S V+++++I    + RL +T +Y    FR D+K    +S +QN   V  L+D  D+VN+SF++D+ +++NSG +PDL++ +ELE +L NLK  D  S  V D   ++Y   ++++++ LHV + LSP    +R R R NPSLINC TIDW+  WS E+++SVA    E+            +      + +A +  ++    +G +F  E +RPY+++   ++EF+  F  ++     K   NR RL++GL QL E+  L+  M+EDL++L P+I+ K++ETE
Sbjct: 2179 AHVEHVILNPKCVQLGELFGCTDPNTFEWTDGLVANIVRKFTKAENQQQQQQQQQQQQQQQQQQQQQSPETPKIPREGSAVSSENAGSATPVEGEDDDASVG---DVEGRKQSAESKKDEASGGQSSGQPEKILPY---QDWRWLVLDGPVDTLWVENLNTVLDDSKVLCLASGERVALTQSVRLLFEVDSLAQASPATISRCAMVYMDPVQLGWRPFARTWAA-RLPKDLPESGRKHLLDLMERSVSRGLTFLREKPQHQLI-RSPELGPVQTLCHLMSAMLNFMTDHGGFGAPDAVATATAGAGAAPAADVGGRGGGDAGSRAGEVTTAGGQAEAKQF-----------YMEKNPKELKNLLGKLFVFAFTWAFGGNLNRQEEMDIDISNLKGAGGGGAGGGGSKRPMEDVADEFDNLVHELFDTEPPLGVRLPSASRNIFGYFVDLESGNFLPWESLVPSSSSLVERATSVLGGSGGVGSSGGAVSRRSTQPELVATVDTIRYSFLTALLLVSRSPVLLVGESGVGKTALLRSLLKKLAEPNGASTQGK-SVLGQVLSYSEKSAGLLESLRALT--NDGDDDGSDAYQQTFLYGAQTEKQGLEQSLLFTTFEFTAQTRPSRLQSQISGRLVKRSRDVLGPRKGRRMVIFVDDLNMPLPDEFGTQAPLELLRQFLDLGGFYDLQKLSWRSVVDTVMLAACGPSGGGRHHVSPRLLRHFSLLSLPLPSSRSLQHIYHVQLGRFLQDHDFHAEIRDLMLNMVSCAINLYYRLRAALKPTPAKLHYTYNLRDLTKVVEGFYMASEKVVTSREACIDLFVHESTRVLHDRLCTPEDRETFFAHLADELRQQLKLRLTGDALRDQTLMFARFLDPSAAESSGARGGGGGAADEAAKNAPYAPVRDLRRLRQALEDLHMKQRVQEVDGAGDEASGGGGDQQFVFFKEAMEHIVRAVRVLGQPRGHLLLIGIDGTGKTSTVRMAASIARARVARLRLTRNYQLQDFRADLKSAFIRSAVQNSGTVFLLTDA-DIVNESFLEDVNSILNSGDVPDLFDAEELEGVLINLK-GDASSAGVQDNREELYAFFLDRVRRNLHVVLTLSPLGDRFRQRCRANPSLINCTTIDWFDPWSPEAMLSVAEVYFEQEDFAGADPALKPE------ICKACVTFHQDMEGIGKRFFEETKRPYYVTPSSYMEFIKTFSKMILESRTKFEGNRDRLTRGLRQLDESDRLVVTMQEDLVQLGPQIEAKAQETE 3404          

HSP 4 Score: 118.627 bits (296), Expect = 5.059e-22
Identity = 81/304 (26.64%), Postives = 150/304 (49.34%), Query Frame = 2
Query:  449 QVVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRIS-------INSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEE------ISKERNLD-------------SSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDEN-SDENKKSKIKN 1279
            +VV+A EAK+S ++WTVSAS VT     K + N  ++S        S P   WL E+ L   +  + TF  FR WKAF+ WR N+  +K  ++   LT +L   + + Q C++ V +L E    R +       +N  ++   + +  ++P++   L EF   Q  Q +L  + +  +  T++E   ++C    +   +++ + +      +S ER  D              S++   + ER + +K ++ + EFL+LLDCQ++ L HR++ R++ +   F+  S    E  + E ++ ++ N
Sbjct:  345 EVVSAYEAKQSAVYWTVSASFVTRF--EKLDKNNQEVS--------SMPTVLWLFERNLCQAIGEIRTFRQFRLWKAFKVWRCNVLAAKQQRNSLFLTKHLYAANEVLQGCLSHVQQLCEAACPRAASMQQQQQLNQSSASPGIALLVLNPNEPLPLDEFLDRQATQRQLGAKAIVALRQTIVELAYESCAVVAEMEGITTGIRDPPRPFRLSAERVADLTLPPGASSASPRRSTAEPSYAERGQWKKILRRLCEFLRLLDCQVMDLLHRLVLRDVRRLVDFLGASCVEGERLATEAERRRLAN 638          

HSP 5 Score: 87.4261 bits (215), Expect = 1.212e-12
Identity = 45/119 (37.82%), Postives = 64/119 (53.78%), Query Frame = 2
Query: 13397 PDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDS----------YTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCEID 13723
            P  GV VFGL LD+A W      L  +P   R+C+LP +H++   +      DS          +++ CP+YRT  R G LSS+G S+NF+C + L + +  S W LRG A L   +ID
Sbjct: 4793 PTDGVFVFGLVLDSAAWTESAGGLTESPPGSRFCELPAMHMLPCQTGNPDPADSTDSTAAGSASFSYDCPVYRTARRAGALSSTGHSTNFVCSVRLPATQPQSVWRLRGAALLCAPDID 4911          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 400/1372 (29.15%), Postives = 684/1372 (49.85%), Query Frame = 3
Query: 9204 TEAVENYSLKC-------EEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYR-EMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDN--IEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQI--RKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSW--GLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLT 13271
            +E +    +KC       + DL    P LE ++KAL+SLNK  ++E++ Y  PP LVE VM AV +L    P+WA AK  LG++NF+++L++++KD I+ ++ K + QY  Q DF PE +G VSLA +S+C WV A+E Y  +  ++ PKR  ++ A   L   +  L   +N+ ++VE+ +K L N+Y   + +++ L+++      +L RA  L+  +  E+ RW  +++  +K    ++G C+ +AA+ ++ GP+   YR E+    W+    +  +P    + F  F      + +W+  GLP D+   EN  I+ +  +WPL++DPQ Q  ++++    K   +VI  +  D++ +LE A++ G  + L++++ ++DP L P+L K F   G   ++KLG+ E+EY+P F+ Y+ + LSNP     ++   TI+NF V   GLE QLL ++V +E+PE+E +++  +   A+    L+ LED+ L LL ++T  +++D +L   L+ SKITA ++  +LE + Q E ++  AR+ Y P A R + ++FVL D+G ++ MYQ+SL  + +LF   +++  +      S   E ++  + D  TY  Y     GLF  H+ LF+F +   I+     E   ++   +++ F++               D  GQ+    DN    WL    W+     E++    F GL +SF+  P+ W +W  S  P +       E      N  +K++++  L   ++      ++   LG +F      ++  +  +S  K P++F+L    DP   +++L  E  G   +   +S+G+GQA  A  +I K  +  G W+FL NC L +SWMP L KL+E LQ+  +D+  +F+L LS+ PH +FPI ILQ  +K+  E P G+K+ + + + L     VTE+ ++  S  +  RK++F+LC F++++LER+ +  LG+++ Y FNDSD E+S   +  +L    E+ W+AL  +I  +NYGG +TD+ DRR L   + +Y  E             P   I       +   +I      VE  E + G   NA+I    +++++    ++  Q +      T    S  D +  IS  + + V +          L D+E    L       ++DD                  SP + VL QEI++YN LL  I   +  L   + G   ++ SLE +   I    VPP W     S+ K L+ W+ ++  R++    W  +                      H P                               V +WL GF  P   +TAV+Q+ AR  + S+D L+
Sbjct: 3045 SEKIGAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPTWAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQR------SHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKIL-----EVAGKLNMDEYSFFLR----------GGLVLDKEGQM----DNPCTSWLADSNWD--NITELDKLANFHGLMSSFEKYPKDWHQWYTSSEPENAPLPGEWE---TVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLA-EASGMGPSFHALSLGQGQAPIATRMI-KEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQV--EDSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLYQL-----VTESQFSRCSRPVVYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLDEYEEIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQDTYREYIRQLP-PVEHPE-VFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVPE----------LVDYESTQKL-------LQDD-----------------PSPLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEKAYPSL-KPLASWTRDLCQRVEQFAHWAET---------------------AHPP-------------------------------VLFWLSGFTFPTGFLTAVLQSSARQHNVSVDTLS 4288          

HSP 2 Score: 258.07 bits (658), Expect = 0.000e+0
Identity = 168/636 (26.42%), Postives = 330/636 (51.89%), Query Frame = 1
Query: 7219 IEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFD-HEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYF-LLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            + +S+   ++   +   +I  +SQT+ N     + S++ KR +    P   KKML F+DDLN+P +D+FGSQ  LE++R WI+   ++D          D  L+ +  P    ++ IS RL   F ++ +  P+ +  + IF   I +    ++F  E+K   + +    + +Y+    ++  +P K HY+FNLR + K+  GLL +       K+ + +   HE  R   DRL+   D E F  +L+++L     L + +    K   +FG F           VY+ + D + L  F ES +  ++    +   + + F+ +I+H+ R +R+++Q  G+ML++G+ G G+ S  ++++ I    +F++ +T  Y    FR DIKK+   + + N+P V   +D   ++++SF++D+ N+++SG +P+LY++DE E + S L  +    E+V +  D  F  LIE+++  LH+ + +SP    +R+R+R  P+L+NC T+DW+ +W  ++L+ VA              I  + E     +    + ++++  +   + ++EL+R  +++  +++E ++ +  +L     +     S+L  GL ++ +TRS +  M  +L +   K+ E  ++ E
Sbjct: 2408 VAQSVLQGLDPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWYDR-----QMKMDMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIFGTMINQKL--QEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAEKLGSLFDLTYHNICPNKQQPIFGDFL------KEPHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDT-QIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALS-DSARKENVLETADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAE-------RYLDGLILGNVEKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCE 3021          

HSP 3 Score: 62.003 bits (149), Expect = 0.000e+0
Identity = 39/116 (33.62%), Postives = 60/116 (51.72%), Query Frame = 2
Query: 13373 DNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIP-SFWILRGTAALLQCE 13717
            D++  ++ P  GV + GLYL+ A W+ +NS L      +  C +P IH   V + K   ++ Y+  CP Y  P R G    +G+ S F+  + LKS  +    WI RGTA L+  +
Sbjct: 4297 DDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKKVAKNMYS--CPCYYFPVRSG---GAGRPS-FVVGVDLKSGAVSYEHWIKRGTALLMSLD 4406          

HSP 4 Score: 593.193 bits (1528), Expect = 2.069e-171
Identity = 375/1187 (31.59%), Postives = 621/1187 (52.32%), Query Frame = 2
Query: 1973 DEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLP--QNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNK-NFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQ------KQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL-----PLINLSKE 5491
            D  ++ Y+ ++ P     +  F   + + +E   ++ K      + F+ L    L      +  +  G   + LS  A+    E  + ++     L   P+T+ E VE L+ +  +  ++  ++ +   I++ F I+  ++V V  E   L + LN   Q  +  V+  +    ++  KF + L    EE + ++    +   ++     N +    L+Q+  L+ ++  L          +E  G+           R    +F   T     +D++ +E+DI     +WE   +W+  ++ +   +    +   +  T       +  L + L   Q EI+   K  + + K ++P+I+ LR+P ++ RHW++I++ +  S   N   FT+ ++++  + Q+ + I EIS  A  E+++E  L  +   +      +  + ++      G +++   LE++ +T+ST+K S++V     +V+ WER LS   +V++  +  Q+ W+YLE IF   DI++QLP+E   F +++  W+++M +  +    L+     G+L+ L   NSKLE+IQKSL+ YLE KR IFPR +FLSND+LLEIL ++++P+ VQ HL K F N+  L+I+   +       + S +GE       + + G  E WL  +E+ +   +K  ++ C   +++      K   DW     GQ ++ ++Q++++ +V++ L      ES     + S+    +  L   +  +  ++    R  + A++ ++VH RD    L +        F+W  Q+R  W +    C + Q +++F+YG EYLG S RLVITPLTDRCYMT+T AL+ + GG  KGPAGTGKTET+KDL K +G   +V NCSD LD  ++ ++ SG+ Q G+W CFDEFNR+N+EVLSV+A QI SI +A  +    FIFE ++I L   CGIFITMNP YAGR ELPDNL  +FRP++M+VPD  LI E+ LF EGF   KVL+ K+  LY L   QLS Q HYDFGLR++ S+L   G  R  R  I+       +EE  IL+ ++K  N  +L + DLPLF  I+ DLF   +    +   L+ +IE    + G +V P  + K+  L     SRH  M++G + S K+V   ILQKAL+ +     P  NL  E
Sbjct:  962 DSFIRRYQHLNPP-----VSSFDSDIARYSEVANNVQKEETVLSVQFVLLDCSPLKFSLVQHCNEWQGKFTQLLSLMASTRLKELHSFLQDNAHRLSQPPQTLVELVEGLKLLETLQGDLNKIESQIPPIHEQFAILEKYEVSVEREVQDLLEALNGEWQGFQQVVIDSDIMLKKHKDKFKSGLFFSAEEFKKKMQTTMQDFNSTGPFGSNVSSEAALEQISVLRAQLESL----------KEEEGTI----------RHGLSIF--KTEQPTSKDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTENMESTAQTMYKNLNKLSRELKDKQWEIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDK------GTEEVFQALEDNQVTLSTMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGEFVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWP----GQMLITASQIQWTTDVTKCL--ITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDICLVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIA-------DEE--ILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHE 2100          

HSP 5 Score: 33.4982 bits (75), Expect = 2.069e-171
Identity = 21/76 (27.63%), Postives = 41/76 (53.95%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQN--VLNDQLSTDNFEKENS--NQNDLQTLLNNEQ 5790
            +NPKA+S+  LYG  + ++ EW +G++  + +   +    ++   V +  + T   E  NS  + N + TL+N E+
Sbjct: 2103 LNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGER 2178          

HSP 6 Score: 108.227 bits (269), Expect = 2.576e-22
Identity = 55/151 (36.42%), Postives = 93/151 (61.59%), Query Frame = 1
Query: 5929 KIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEAL 6381
            +I     K + +WIV DGP+++ W+E++N+V+DD+++L L NGERI +P  +  LFEV+DL  +SPATVSRC M+Y     + WK  V+SW+  +          + L +LF++ IK  + F     K +++P T + + + +LC + ++L
Sbjct: 2134 RIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDKRQKMEV-----DHLKRLFDRYIKKTISFKRTHCK-ELVPIT-ELNGVISLCRLYDSL 2277          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 403/1387 (29.06%), Postives = 683/1387 (49.24%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPS---------------WANAKLLLGDANFLQKLLNYEKDAINKK-MYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDS-FRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPET-WIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVT-ETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSAL-DMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIG--KSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLP 13292
            E +A++N   +CE DL    P LEA++ ALD+L  + ++ V+  +NPP  V++VM AVCV+  + P                W  +K LLGD NFL+ L  Y+KD I    M+K   +Y    DF+P  V   S A   +C+W+ A+E Y  V  ++ PK+  +  A+++L  +   L  K+ +LK+VED +  L    +   +EQ QL+ +V L   +L RA  LI  +  EK RW  +  D      N+ G  + SA    + G +T  +R+   K+W  +  +K+IP  D++   +       I  W+ +GLP DS   +N  I+  S++WPL+IDPQ Q  ++++ + +++   VI     DY+  LE  I+ G  + LE++  ++DP L PLL K+ F++G +  I+LGE+ +E+S  F+ Y+ + L NP  +  +   V+++NF +   GLE+QLL ++V+KE+PE+E ERN  +   A + + L+ +EDK L  LQ S   I+ D    Q L+ +KI + +I K+ +   + E ++  +R+ Y P+A   + ++F +ADL  ++ MYQYSL WF NL+   + + NK      S   E +L+ +I+  TY  Y      LF   + LF+F+L ++++    E         ++A F+ L T       N          +  PD   WL  + W+     EI       GL    +  P   ++    S+ P++       +     L+ F+K+I+   L   K+  +   Y+   LG+KF      +L   + +S++ IP+VF+L   +DP+  ++K   +     +N   +S+G+GQ   A  +IQ + + +G W+ LQNC L +SWM +L+K+ E+   S +    +F+L L+++P   FP+ ILQN +K+  E P G++  LL+S+  D   +    +  +N+     K+++ +C F+A+V ER+ +G LG+++PY FN+SDL ISI+Q+  F+ +  EV + A+  + G  NYGGR+TD+ DRR L+ +L ++ +++   N   MF  S K      + ++    FI  N  A +  E + G+ +N +I +   Q+K     +I+ Q    +   ++  +S L D+   I  K+P +                          +D A+       NK+         ++   + VL QE+++YN L   I   ++ L+  + G   +   LE +   + +  VP  W   S    K L  + ++   R+ F+  W               Y T             K N+                          +WL GFF  Q+ +T  MQN AR     ID+L+   EVLP
Sbjct: 2535 EAQALKN---ECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMAAVCVMKDIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLKVYDKDNIPAPVMHKIRSEYMTNPDFDPTKVAKASSAAEGLCKWITAMEVYDRVAKVVAPKKANLIVAQQSLAATMALLNQKRAELKEVEDRLAALKKTLEEKTEEQAQLQFQVDLCARKLERAEKLIGGLGGEKTRWSKAADDLQNTYDNLTGDVLISAGVIAYLGAFTAGFRQNCTKEWTKLCKSKNIPSSDDFSLSKTLGDPIKIRAWNISGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERENNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQIFKQGGMDCIRLGESVIEFSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKIMSNEISKKQQIAEKTELKIAESREGYRPIAKHSSILFFSIADLANIDPMYQYSLNWFVNLYINSIQDSNK------SKILEKRLRYLINHFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKE--------IEYAEFMFLLTGGVGLQNN----------VPNPDP-NWLQDKSWD-----EICRASDLPGL-QGLRYPPFCHFLPIYDSKEPYNTP---LPKPWCDKLSDFQKMIIYRCLRPDKIEPAISNYITGKLGKKFVEPPPFDLSKSYNDSNSTIPLVFVLSPGADPMASLLKFANDKNMGGANFKSISLGQGQGPIAVKMIQ-SAMKEGTWVCLQNCHLAVSWMSTLEKICEDF--SPETCHPDFRLWLTSYPSPMFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPVSDPQFFSACSNKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNSYEEVPFEAITYLTGECNYGGRVTDDWDRRLLLTILADFYNKDIIENPRYMFSPSGKYYSPPKSIYEDYVEFIR-NLPATQHPE-VFGMHENVDISKDLQQTKLLFDSLILTQGGGSKGGASSGGDSTLMDIANDIRTKLPENF------------------------NIDSAL-------NKFP------VLYEESMNTVLVQEMERYNNLCNTIRVSLQNLLKAIKGLVVMDAELEAIAGSLLVGKVPEKWAKRSYPSLKPLGSYITDFLTRLKFLQDW---------------YDTT------------KPNV--------------------------FWLSGFFFTQAFLTGAMQNYARKYSIPIDLLSFDYEVLP 3789          

HSP 2 Score: 341.273 bits (874), Expect = 0.000e+0
Identity = 273/1137 (24.01%), Postives = 520/1137 (45.73%), Query Frame = 1
Query: 5761 DLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSF-PESGKEFLYKLFEKSIKPGMKFLSK-CSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNI-DTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKT-IYSYFVDM-DKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIV-SLDSIRYSFLSALLMLNN--HPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSD--ELHMSLKLNWAHDELGKCD-----IMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLY---ENDELENILSNLKP-EDLGSESVS-DPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIF---IYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKE 9096
            D  TL+N      +E+ +   +N + I    +  +F   S +     V N F + A   +   K    W+V DGPI++ W+E++NTVLDD++ LCL +GE I +   +  +FE  DL  +SPATVSRC MIY+    + W   V SW+ N LP+    +     L +LF   I P ++ L K C ++    +T+  + + +L  + E L+                               T P  +                 +   K +   +   + F+  WS G +  R      +  + +  SGK     I  A  +++                 P ++K  +Y Y  +   KG +  W+    SIKN+               +   +V +IIV ++D+I  +  + L++  +   P+L  G +G GKS+ + + L                                  + NL+K                      + Y+   I F+++TS N++   + +++ KR + + GPP  KK ++F+DD+N+P ++ FG+Q  +E++RQ+ +   ++D        + D  LI A  P    ++ ++ R  +HF + ++   S +   RIF   +  Y    DF  +  +    IV   + VY K +     +P KSHY FNLR   +++ G L    + + NK  + +   HE+ R  +DRL+ D DR+  +K++ +  + H     +   + L  C+     ++FG +       +S ++Y ++  +E   +  ES +  ++  H N  N + F+  ++H+ R  R+L Q  G+ L++GV G G+ S  ++++ +    +F+  ++ +Y    +R D+K ++ K+ ++ +  V  L+D   +  ++F++D+ +++N+G +P+L+   E  E+  ++  ++P    G++S+   P  ++   + + ++ LHV +  SP    +R+RLR  PSLINCCTI+W+  W  E+L  VA+            +   + E + H   E  +     + +AI +  +F  EL R  +++   ++E +  F  +L N      + + R + GL++L    S + +MK++L++L PK+++
Sbjct: 1517 DTLTLMNERGYNDEEKVQYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREYASAETPDRK----WVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWLPLVTSWL-NTLPQPLQTQENSTLLLELFNWLIPPALRMLRKNCREVV---STTNSNTVVSLTRLFEMLL-------------------------------TEPVTE-----------------EPGNKNIRTWIMAAFAFSLVWSIGGSCDRDSRERFDQFLREILSGKLEEHPIPAAVSKWE----------------CPFNDKGLVYDYSYEFKGKGCWIHWN---ESIKNV------------TLGDKNTKVQDIIVPTIDTIFCTLFTTLIIFFSPFRPLLFVGPTGTGKSVYVKEKL----------------------------------MNNLNK----------------------ERYLPFFINFSARTSANQSQNIIMARLDKRRKGVFGPPMGKKCIIFVDDMNMPAMEVFGAQPPIELLRQYFDHGNWYDLKDTSKITLVDVQLISAMGPPGGGRNAVTPRFLRHFNICSMNAFSDDTMSRIFSNVVAFYLRNNDFPNDCFSIGNQIVAATLEVYKKAMENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLENKRTMIRLFVHEVFRVFYDRLVDDQDRDWLYKLMKNIVKEHFKESFDTVFEHLKLCEEDMRSLLFGDYM-TPDVEASERLYAEVPSMESFSQVVESYLTEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMADMTLFQPEISKNYGMNEWREDLKLLLKKAGVKGQKTVFLLTDA-QIKEEAFLEDVDSVLNTGEVPNLFAVDEKQEIMEVMHAVRPIAQAGNKSLEFSPLALFAFFVNRCRENLHVVVAFSPIGDAFRNRLRQFPSLINCCTINWFQPWPEEALERVAN------------KFLETLEMSDHERQEVMLICKTFHTSAIHLSEKFLSELGRHNYVTPTSYLELIAAFRLLLTNKRDTVMNAKKRYTNGLDKLAFAESQVGEMKKELVDLQPKLEQ 2496          

HSP 3 Score: 58.9214 bits (141), Expect = 0.000e+0
Identity = 42/117 (35.90%), Postives = 61/117 (52.14%), Query Frame = 2
Query: 13373 DNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCEID 13723
            D S T  +P+ GV V GL+LD A W+ ++  LA       +  +PII +        K +   TFL  L  T  R G LS++G S+NF+  + L + + P  WI RG A L  C++D
Sbjct: 3791 DTSAT--SPEDGVYVHGLFLDGARWDKKSGVLAEQHPKVLFDSVPIIWI--------KPKHCCTFLL-LSCTSERKGTLSTTGHSTNFVISIMLPTSKRPQHWIKRGVAML--CQLD 3894          

HSP 4 Score: 567 bits (1460), Expect = 9.659e-165
Identity = 319/823 (38.76%), Postives = 469/823 (56.99%), Query Frame = 2
Query: 3014 VNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNI---RVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQI--EKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            + E K  +P++  L NP ++ RHW ++ +++   LT N   T+ +++   +  Y +    IS  A+ E +LE  L  + + + ++ F   +H      I+T VD+I   L++  +   T++GS ++     +++ WE +L      +DEW+  Q  WLYLE IF + DI +Q+P EG+LF  VD  WR +M+   + P VL   +  G+L+ LQ  N+ LE+I K L  YLE KR+ FPR FFLSNDE+LEILS  +DP  VQ HL K F  + KL    +       +     EGE   L + I     RG  E+WL  +E  +   ++  I R  +   + +   W     GQ +L ++Q+ ++Q V  A++       +G+  + +  + L   L+ +   V   +    R  L A++ I VH RD    ++E  V  E DF+W  Q+RY WN  +   +V  ++   +Y  EYLG SPRLVITPLTDRCY T+ GA   NLGG  +GPAGTGKTET KDL+K +  QCVVFNCSD LD   + K   G+   G+W CFDEFNR+ LEVLSV+A QI  I+ A + + E F FE  E++LNP C + ITMNP YAGR ELPDNL  LFR VAMMVP+Y LI E+ L+S GF+ AK LS KI   YRLC++QLS Q HYD+G+R++K+VL+  G+L+L+          + NE++ +L+++IK  NEP+ ++ D+PLF  I  DLF        + +L     +   K+  + V P ++  +K+      +  RHG ML+G   +GKT +  +L   LT +
Sbjct:  724 IKEFKEHIPMVSILCNPGIRARHWEQMSEIVNHDLTPNSGTTLRKVLKQNLSAYMEHFETISAAASKEFSLEKALQNMVETWDIISFSHHAHRESGVSILTAVDEIQTMLDDQIVKTQTMRGSPFIKPFEKEIKAWEERLIRIQDTIDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGQLFQTVDKHWREVMRHCVKDPKVLPATSLTGLLEKLQESNNLLEQIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLDFLPNLDIQAMYSS----EGERVELIQLISTSEARGAVEKWLVQVEDVMLSSIRDVINRSRLAYPETKRSQWVREWPGQVVLCTSQMYWTQEVHEAIR-------SGVGGLKNYYNQLQSQLKDIVELVRGKLPKQTRTTLGALVTIDVHARDVVMEMIEKGVSHETDFQWLAQLRYYWN--NDNVRVCIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMKLEFFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFP--------DENEDI-LLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPAADYQLFLDCAQECCKK--HNVQPVKVFLDKMIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLM 1522          

HSP 5 Score: 37.3502 bits (85), Expect = 9.659e-165
Identity = 13/33 (39.39%), Postives = 23/33 (69.70%), Query Frame = 1
Query: 5557 KIDVQVVNPKALSINHLYGYVNPNSLEWIEGII 5655
            K+  + VNPK++++  L+G  +P S EW +GI+
Sbjct: 1532 KVQYRTVNPKSITMGQLFGQFDPVSHEWTDGIV 1564          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 488.034 bits (1255), Expect = 0.000e+0
Identity = 373/1380 (27.03%), Postives = 650/1380 (47.10%), Query Frame = 3
Query: 9234 CEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSV---TP---SWANAKLLLGDAN-FLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYR-EMAKKKWIDILGN--KSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQK----IIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLN--SFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMK--LVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSD-----FPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFL-TNNEVQWNALHNVIGNINYGGRITDNLDRR-CLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLPRN 13298
            CEEDL    P L A+ +AL++LNK +++E++ + +P   V  V  AV VL++     P   SW  AK+++   + FL  L+N+ K+ I++   K +Q Y    +F PE V   S A   +C WV+ I  ++ V   + PKR+ +N+A   L  +++KL   + ++  + +++  L  K++ +  ++ + ++    T   +  A  L+  + SE  RW  ++ +  +  + + G  +   A+ ++ G +T  YR E+    W   L      IP+      +        +  W N GLP D    EN  I+   ++WPL++DPQ QG ++++  + D+ +VI   Q+ Y+  +ERA+  G+ + +E++E  +DPVLGPLL +E  ++G    IK+G+ E EY+P F+L L + L+NP     +    T++NFTV   GLE+QLL+ +VS E+P++E  ++   +       +L+ LED  L  L  ++   + D+EL +NLE +K TA +I+++++E    E ++  AR+ Y P A R + +YF++ DL  ++ MYQ+SL  F  +F + V          +  +P+  L++    +IDS+T   +   + GLF   +  +   L+  I+  + E     I   +    ++      V                    +++L+   W   K L     D+F  L    + + + W K+   E P        ++F  ++ N  S +KL ++  L   ++  + R +V+  LG K+      +    F ES A  P+ FIL    DP+  V K    M    +  N   VS+G+GQ   AE  +      +G W+ LQN  L+  W+ +L+K +E      + +  NF++ +S  P S       P GIL+NS+KI  E P+G+   L K  ALD     T  +   ++E  + ++F+LC F+AVV ERR +G  G++  Y FN  DL IS+  +  +L  N++V ++ L  + G I YGG ITD+ DRR C  +L +    E   G   E+++     L G++ D+   + +I  +D    +   L GL  NAEI  L   S+     ++  Q +        D+ S          K+ ++V +  ++   ++F      ++ L GK++E                       SP+  V  QE ++ N L   I + +K L   L G   +T  +E + + I ++ VP S            W+      +  +  W                                 ++LN  +E      + NL   +       WL GFF+PQS +TA+MQ+ AR     +D +++  +VL +N
Sbjct: 2985 CEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLMAPGGRVPKDRSWKAAKVMMAKVDAFLDSLMNFNKENIHENCLKAIQPYLQDPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTWKPYLSQLKVPIPVTPGLDPLSMLMDDADVAAWQNEGLPADRMSTENATILTSCERWPLMVDPQLQGIKWIKNKYGDNLQVIRIGQRGYLDSIERALSAGEVVLIENLEEAVDPVLGPLLGQETIKKGR--YIKIGDKECEYNPRFRLILHTKLANPHYQPELQAQCTLMNFTVTRDGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTELVENLEITKRTAAEIEEKVKEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAV----------LKAAPDEALKQRVLNLIDSITSSVFQYTTRGLFECDKLTYTAQLAFQILLMNKE-----INPSELDFLLRYPVQPGVTSP-----------------VDFLSHHSWGGIKALCS--MDEFRNLDRDIESSAKRWKKFVECECP------EKEKFPQEWKNKTSLQKLCMMRALRPDRMNYAIRDFVEEKLGSKYVMGRSVDFAVSFEESGAATPMFFILSPGVDPLKDVEKHGRTMGYTFDNQNFHNVSLGQGQEVVAEQALDLA-AREGHWVILQNIHLVAKWLGTLEKKLEQ---HGEGSSQNFRVFISAEPSSSPEGHIIPQGILENSIKITNEPPLGMHANLHK--ALDNFNQDTLEMCARENE-FKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNYLEANSKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIKPEMMEG---ELYLAPGFPLPGNM-DYNGYHQYI--DDALPAESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPR--------DAGSGEGSGTSRDEKV-KAVLEETLEKLPEEF-----NMVELMGKVEER----------------------SPYVVVALQECERMNILTQEIKRSLKELNLGLKGELTMTNDMENLQNAIYLDQVPDS------------WTKRAYPSMCGLALWF-------------------------------TDLLNRIRELESWSSDFNLPPAV-------WLAGFFNPQSFLTAIMQSTARRNEWPLDKMSLQCDVLKKN 4223          

HSP 2 Score: 295.434 bits (755), Expect = 0.000e+0
Identity = 257/1077 (23.86%), Postives = 478/1077 (44.38%), Query Frame = 1
Query: 5893 QDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFL-SKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLY-VFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQS-PISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            +D + +   ++   VSH   K   WIVLDG I+  W+E+LNTV+DD+++L LA+ ERI +  +++ +FE+  L+ ++PATVSR  ++Y+ +  + W   V SW+     K   +S K  L  LF+K +   +  L S+  KI  IP   +QS +  LC +LE L+                                TP                    +  P + +  L +LY VFA  W+FG A  + + ++                      EF  +  + F       I+ P    T++ Y++D +   F+PW  +VP  +  +D    L                ++ + ++IR S+    L+    P++L G++G GKS+L+   L       GS   +  +I    F Y                ++ SA     +++  L  P+E                             K+     GPP +K+++ FIDD+N+P +D +G+     ++RQ ++ N ++D + LQ   +     +   +P   S  I+ RL +HF V  L  P  +A   I+   +G++  ++ FS  ++     +V + +  + +    +  + +K HYIFNLR L  I  G+L    + +   +D+ K   HE  R   D+++ D D   F K+ S+ +    +      E  K   M+  F    G       Y  +   E L +    ++++++ E     N + F  ++ H+ R  RIL    G+ L++GV G GK S  ++++ I   ++F++ +   Y     + D+  +  K+ ++N   V  ++D   + ++ F+  + +L+ SG IPDLY +DE+ENI+++++ E  G   +    + +   IE++++ L V +  SP  S  R R R  P+++NC  IDW+ +W  E+L SV+          F  E+E  + +   ++++   +++ +  +    +    RR  + +   F+E +  + ++L            RL  GL +L  T + +  +K  L      +K+K+E+ +
Sbjct: 2041 KDGLFSNIMRELANVSHAGPK---WIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINQADLGWNPPVSSWID----KREIQSEKANLTILFDKYLPACLDTLRSRFKKIIPIP---EQSMVQMLCHLLECLL--------------------------------TP--------------------EHTPPDCHKELYELYFVFAAIWAFGGALFQDQLVDYRV-------------------EFSKWWVTEFKT-----IKFP-SQGTVFDYYIDPETKKFEPWSKMVPRFE--MDPEIPLQAC-------------LVHTTETIRVSYFMERLLERRRPIMLVGNAGTGKSVLVGGKL-------GSLDPDKYTIKNVPFNY----------------YTTSA-----MLQAVLEKPLE-----------------------------KKAGRNYGPPGSKRLIYFIDDMNMPEVDAYGTVQPHTLIRQHMDYNHWYDRSKLQLKEIHSVQYVSCMNPTSGSFTINPRLQRHFSVFALSFPGVDALNTIYCSILGQHLSREGFSAVVQKSGPQLVQLALDFHQRVTATFLPTAIKFHYIFNLRDLSNIFQGMLFCKSECMKTPQDLVKVYLHESNRVYRDKMVEDKDFSTFDKLQSEMVGKFYEDMEEALEEAKVMNMYCHFALGIGEPR----YMPVQSWESLNKTLLEALDSYN-EVNAAMNLVLFGDAMSHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQITLKKGYGITDLKSDLGALCIKAGVKNIGTVFLMTDA-QVADEKFLVLVNDLLASGEIPDLYPDDEVENIINSVRNEVRGQGLLDSRENCWKFFIERVRRQLKVALCFSPVGSKLRVRSRKFPAVVNCTVIDWFHEWPQEALESVS--------LRFLQEVEHIEPEVKDSVSKFMAYVHVSVNKTSKDYLANERRYNYTTPKSFLEQIKLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKLAAQEVDLKQKNEDAD 2944          

HSP 3 Score: 48.1358 bits (113), Expect = 0.000e+0
Identity = 29/105 (27.62%), Postives = 47/105 (44.76%), Query Frame = 2
Query: 13397 PDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            P  G  V GL+++ A W+ +   +    +      +P+I + AV  +K +  + Y   CP+Y+T  R            ++    LK+   PS W L G A LLQ
Sbjct: 4231 PREGAYVHGLFMEGARWDTQAGVIVDARLKELTPAIPVIFIKAVPVDKQETRNVYQ--CPVYKTRQR---------GPTYVWTFNLKTKENPSKWTLAGVALLLQ 4324          

HSP 4 Score: 510.375 bits (1313), Expect = 5.669e-144
Identity = 292/890 (32.81%), Postives = 477/890 (53.60%), Query Frame = 2
Query: 2801 VEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIF-GTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXY--EGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLR---LERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQK 5452
            +++  +++S+   LW+  S      E +      E  V  +     R +  + +L+K     +    + + V    +SL  I  L+NP ++ RHW ++    G+  + +++ T+ +L++  +  ++  +  I + A  EM +E +LT++   +  +EF   SH      ++   +D+   LE++ + +  +  SK+V     +V  W+++LS    V+  W   Q+ W +LE IF G+ DI+ QLP + + F  +D +++ L     + P V++   K G+   L+    +L   +K+L +YL+ KR+ FPR +F+S+ +LL+ILS   DP  VQRHL+KLF N  K++ ++ +    S T +  +  E E  P        G  E WL  +   +   V+ ++   ++  E K    W  +   Q  L  TQ+ ++ +V  A     +     +          +  L  L   +   +    R  +  +  I VH RD    ++   V++   F W  Q+R+ W+E    C     D+ F Y  EYLG +PRLVITPLTDRCY+T+T +L+  + G   GPAGTGKTET KDL + +G    VFNCS+++D  +   +  G+ Q G+W CFDEFNR+++EVLSV+A Q+ SI+ A   + +RF F  +EI L P  GIFITMNP YAGR ELP+NL  LFRP AM+VPD+ LICE++L +EGFI A++L+ K   LY+LC + LS Q HYD+GLR+IKSVL++ G L+    ER             E  +L++A++  N P+++TDD+P+F  ++GDLF   D   + D   E+ +  S  +L  +   + + K+  L   L  RH V ++G + +GK+ +   L K
Sbjct: 1131 LKQCRKEVSILKELWDVVSVVRFNLEAWRTTPWREINVEEMELECKRFSKELRLLDKEARAWDAFCGLDSTVKNTLTSLRAIAELQNPAIRPRHWQQLMTATGVRFSMDEDTTLTDLLNLNLHHFEDEVRAIVDRAVKEMGMEKVLTELDATWTAMEFGYESHPRTSVPLLKSDEDLVETLEDNQVQLQNLMSSKHVAFFLEEVSSWQKRLSVADSVISIWFEVQRTWSHLESIFIGSEDIRSQLPEDSKRFEGIDTDFKELAYDAHKTPNVVEATNKPGLYSRLEDIQGRLALCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTDPHQVQRHLSKLFDNTAKMKFETDADGKPSKTGIGMFSKEEEYVPFNEPCDCTGQVEMWLNRVLDTMRATVRHEMTEAVVAYEDKPREQWLFDYPAQVALTCTQIWWTSDVGLAFSRLEEGYENAM---KEYYKKQVSQLNTLITMLIGQLSPGDRQKVMTICTIDVHARDVVAKIIAQKVENSQAFVWLSQLRHRWDEREKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKKRFNFMGEEINLFPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPER------------PEDQVLMRALRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDLDFEKFVRESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGNAGTGKSQVLKSLNK 2005          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 515.768 bits (1327), Expect = 2.631e-149
Identity = 279/750 (37.20%), Postives = 435/750 (58.00%), Query Frame = 2
Query: 3242 KVKDVYAVLEF---RLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQF-VDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLIN 5479
            +V D + V++F   R    +    +I+  VD+I  +L+++ + + ++ GS+++      ++ WE+ LS  ++V++ W+  Q+ W+YLE IF   DI+ QLP E + F  +D  ++ +M  T   P + +CC     L  LQ  +  LE+ QKSL DYL+ KR  FPR FF+S+DELL IL  + +P  VQ H+ K++ N+  L+ DS ++       +VS EGE   L + +   G  E W+  +   +    +   K  +    QK+  VDW L+  G  +L   QV ++  V    +     E   +      +   I NL      +++ +    R  L  +++I VH RD   S + + +    +FEW+ Q+R+ W++      V Q  + F YG EY+G + RLVITPLTDR Y+T+T AL+  LGG   GPAGTGKTE+ KDL+K +G  CVV NC + +D   V K+ SG+ Q G+W CFDEFNR++  VLSVI++QI +I+ A   + +RF FE +EI L+   GIFITMNP YAGR ELP+++  LFRPV ++VPD   ICE++LFSEGF+ AKVL+ K+T LY+L  +QLS Q HYDFGLR++KSVL++ G L+     ++E V         +L++A++  N P+ + +D+PLF  ++ DLF   D           ++E   +E  Y + P+Q++K+  +   + +RH  M++GP+  GK+V+ + L +A T L L+ 
Sbjct: 1271 EVVDTWEVMKFSVQRYFKGTQERGYILGSVDEIQQNLDDNAVNLQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLDYQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQIDNL---VRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDLNEDV---------VLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLGLLT 2007          

HSP 2 Score: 37.3502 bits (85), Expect = 2.631e-149
Identity = 25/79 (31.65%), Postives = 42/79 (53.16%), Query Frame = 1
Query: 5572 VVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQN--VLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
             +NPKA+S+  LYG ++P + +W +GI+  + + +   ++K +   +L D    D    EN N     N L TL N E+
Sbjct: 2011 ALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDG-DVDALWVENMNSVMDDNKLLTLANGER 2088          

HSP 3 Score: 496.123 bits (1276), Expect = 1.208e-139
Identity = 357/1220 (29.26%), Postives = 603/1220 (49.43%), Query Frame = 3
Query: 9285 ALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTP-SWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYR-EMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDSFRVISC-KQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDI--KKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNS---FEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIK-NQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN------NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENL--------LGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETV 12875
            AL  L+K+ ++E+R +  PP+ V++V   + V+      +W  AK ++ +ANFL+ L+  + D+I+    K ++ +    + + E +  +S A   + ++V A+  Y  V   I PKR+ V   +K    SK++LE  Q++L+ ++  +  L  KY  ++ E++ L+E  +L   RL  A  LI  + SE  RW   +++  K    ++G C+ SAA+ ++ G +   +R EM  + W   +  + IP+   ++          I  W +  LP D    +N  +  ++ ++P+ IDPQ+Q   +++   + +   IS     D++  LE AI+ G     +D++  IDPV+  +L K         +I LG+ E++Y P+FKLYL + L+NP+   +V     +IN+TV L GLE+QLLS+IV  E+ E+E +R R ++  + +   L++LED  L  L  ST  ++++ EL   LE++K  A ++  K +L ET  A+  +   R  Y P A RGA ++FVLA++ +VN MYQYSLA F  +F      + K +    SI P+ +L  I++++T   Y+    GLF  H+ LF+F ++  I     E+++ R  Q++   F+K          NL    S     K+    +WL  + W     L     ++F  L    +  P+ W  W      FD+ S     F +KY +S   F+KL+L+      ++  +   YV   +GEK+      +   +F +S    PIVFIL    +P N +MKL       T+ L  ++MG+GQ   A  L++ T + +G+W+ LQNC L++ W+  L+K +E  +I+K   D  F+L L+T P  DFPIGILQ SLK+  E P G+K N     F +       ET+ +      R +++ L  F+AVV ERR YG +G+++PYDFN+SD  + ++ + T+LT         + W +L  +IG + YGGR  D+ DRR L   +  Y        G  +F         H  D         S +  VE++E+L         GL  NAEI      ++     +I  Q       +T DS   +   + I+ ++ R ++  +   +  D ++          KL   +                     SP   VL QE++++N L++R+ + +  L   L+G   ++  L+ V
Sbjct: 3010 ALQDLDKSDVTEIRSFAKPPKQVQVVCECILVMRGHKEINWKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVRGFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSAD--IDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDY---SLRKSLPN--SILPK-RLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKI-----EQAEGRAPQEELEFFLK---------GNLSLEKS-----KRKKPCDWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNW------FDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKFLAMGQGQEKVALQLLE-TAVSRGQWLMLQNCHLLVKWLKDLEKALE--RITKPHPD--FRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLNMRATYFKIQ-----LETLMSCPHPAYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYLTKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMDEYL-------GDFIFDTFQPFHFFHNKDVDYRIPPDGSKEVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQP------QTGDSGGGISRDEYIA-QVARDIQNKLPSAFDLDVIRK---------KLGPDV---------------------SPTSVVLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEV 4142          

HSP 4 Score: 220.705 bits (561), Expect = 2.645e-56
Identity = 161/621 (25.93%), Postives = 304/621 (48.95%), Query Frame = 1
Query: 7270 SIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFD-NTSLQWTYVTDCSLIVAC--SPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIF---FKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            +I F+S+T+     + + + + KR ++  GPP  K +L+F+DDLN+P +DE+G+Q  + +++  ++  G +D    L    + D   I A   +   ++ +  R    F V  +P P   A   I+   +    H + F   I+     +    + +Y   I     +P K HYIFNLR L ++ NGL   + +  + +    +   +E +R  +DRLI++ D+ +     K L  E H   +L+ A  +     I+FG +     S S  +VY+ I D +     F+  +  ++ E+    N + F  ++ H+ R  RI+    GH L++GV G GK S  K+++   GCD+F + ++  Y+  +FR D+K +  K  ++N+  V   +D   +  + F++ + N++ SG +P L+ +DE E++L+ ++ E +   S      V+   I K    LH+ +G+SP   + R+R RN P L+N   IDW++ W  ++L +VA       +    +      E  + ++      ++ +  E    FQ +LRR  +++  ++++F++ +  +LQ+      +   RL  GL++L E    +  + + L E    + EKS   E
Sbjct: 2350 TINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKG--HTRPFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQE-HFGSELDSAMRD----PILFGDY-RTALSESEPRVYEDIQDYDACKALFQEILEEYN-ENKTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDA-HVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGHSKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQ----SFLGESPMIPAAHSETVIGHVC----MVHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACE 2952          

HSP 5 Score: 97.0561 bits (240), Expect = 5.840e-19
Identity = 46/109 (42.20%), Postives = 73/109 (66.97%), Query Frame = 1
Query: 5950 KKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSI 6276
            KK  ++I+ DG +++ WVEN+N+V+DD+++L LANGERI +      LFEV DL+ +SPATVSRC M++V  +++ +    + W+ ++ PK   +     L KLFEK +
Sbjct: 2051 KKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPKEQAD-----LRKLFEKYV 2154          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Cavefish
Match: DYNC1H1 (dynein cytoplasmic 1 heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2961])

HSP 1 Score: 468.774 bits (1205), Expect = 6.885e-138
Identity = 284/850 (33.41%), Postives = 472/850 (55.53%), Query Frame = 2
Query: 3041 VIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIF-GTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEA--FPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIE---------MEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWN----EFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAA-------KDSRFERFIFE--NKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELN------------ILIQAIKISNEPRLITDDLPLFKSIMGDLF-------GDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKAL 5458
            ++I L++  L+ RHW ++ K + ++   ++  T+G++    + + + ++ ++   A  EM LE  L ++++V+   E  LV++ N+   +I G DD+   ++E   ++S +K S Y          WE KL+    + D WI+ Q+ W+YLE IF G+ DI+  LP E + F  +  E+ +LM++  + PLV+     QGV + L+     L KIQK+L +YLE +R  FPR +F+ +++LLEI+  +++   +Q+H  K+FA V  + ++  +++   I+     EGE   +  P +I       +WL  +E+ +   + + +   + E         ++   +++W      Q +++S Q+ +S+NV  AL      +    L    +++ +   L +LA TV  +    +R  LE +I   VH RD  ++L++N + +   FEW  Q+R+ ++    +   Q  +   ++ F YG EYLG   +LV TPLTDRCY+TMT AL   LGG   GPAGTGKTE++K L   +GR  +VFNC +  D   + ++  G+ QVG+W CFDEFNR+   +LS ++ Q+  I+ A          R      E  NK++K++    IFITMNP YAGR  LPDNL  LFR +AM  PD  LI +V+L+S+GF TA+ L+ KI   ++LC++QLS Q HYDFGLR++KSVLI  G+++ ER+   +  K    E+++            ILIQ++  +  P+L+ +D+PL  S++ D+F       G+   + E  K +   + L+Y + G +V    +EK+  L    +  HG+M++GPS SGKT+   +L KAL
Sbjct:  503 LVIELKSEALKDRHWKQLMKRLHVNWVLSE-LTLGQIWDVDLQKNEMVVKDVLLVAQGEMALEEFLKQIREVWNSYELDLVNYQNK-CRLIRGWDDLFNKVKEHINSVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSADIKHLLPVETQRFQSISTEFLALMKKVTKSPLVMDVLNIQGVQRSLERLADLLGKIQKALGEYLERERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVASILLNEDNTEVLGISSR---EGEEVLYKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTEVGAFNKATGIDLGAYINWIDRYQAQLVVLSAQIDWSENVEMALTTIAGKDDMAPLQ--DVLTKVEATLNVLADTVLMEQPPIRRKKLEHLITELVHQRDVTRTLIKNKIDNPKSFEWLSQMRFYFDPKQTDVLQQLSIQMANAKFNYGFEYLGVQEKLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQVQYIQVALREHSNPNRDRSTPVTTELLNKQVKVSAEMAIFITMNPGYAGRSNLPDNLKKLFRSLAMTKPDRQLIAQVMLYSQGFRTAETLAKKIVPFFKLCDEQLSSQSHYDFGLRALKSVLISAGNVKRERIQKIKREKCERGEDVDENEIAENLPEQEILIQSVCETMVPKLVAEDIPLLFSLLSDVFPGVQYMRGEMTALREELKKVCAEMYLTYGD-GDDVGSMWVEKVLQLYQITQINHGLMMVGPSGSGKTMAWRVLLKAL 1344          

HSP 2 Score: 46.2098 bits (108), Expect = 6.885e-138
Identity = 25/81 (30.86%), Postives = 44/81 (54.32%), Query Frame = 1
Query: 5569 QVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMI-----SFSNKNQNVLNDQLSTDNFEKENS--NQNDLQTLLNNEQ 5790
             +++PKA+S +HLYG ++PN+ EW +G+   V +K+I         +   + +  +  +  E  NS  + N L TL N E+
Sbjct: 1355 HIIDPKAISKDHLYGTLDPNTREWTDGLFTHVLRKIIDNVRGELQKRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGER 1435          

HSP 3 Score: 353.599 bits (906), Expect = 7.606e-138
Identity = 314/1301 (24.14%), Postives = 587/1301 (45.12%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLS-VTPSWANAKLLLGDANFLQKLLNYE----KDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKD-SFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMA-SHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCK-FLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEK----------LILISILCSYKLIDSARLYVKLVLGEKFSTLLES--NLLNLF-TESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQA-TKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN----------NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGH----LTDFQSINSFIHSNDCAVE-KLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPL----FGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLS--EWSSNVRIRI 12974
            + E +++  L+ ++DL  V P +  +  A+ S+ K  + EVR   NPP  V++ + ++C+LL   T  W   + ++   NF+  ++N+      DAI +KM K+   Y     +N E V   SLAC  + +W +A  +Y  +   + P R  + + +   + +K K E  +  ++ +E  I     +Y   + E + +K  +     ++ R+ AL++++ +E++RW  + +        I G C+ SAA+  + G +    R+     W   L   +I    +    E+  +A   L W  N LP D    EN  ++++  ++PL+IDP  Q   F+   +KD      S     +   LE A+R G+ + ++D+E+  DP+L P+L +E  R G   +I LG+ +++ SPSF ++L +     +    +   VT +NFTV    L+ Q L+ ++  E+P+++ +R+  L+        LR LE   L  L +   +I++D  +   LE  K  A ++ +++EET    ++++   + YL L+   + IYF L  L  ++++YQYSL +F +++       +  + EN ++           SV+  +  +A + GL +I  PL  F    S++R    E        ++  F++            K    TG  + +   ++ LT E   +C+  + +     F  L +  +   E +  W  S +P         E SV Y+ + EK          L+LI      +L+  + ++V  VLG+ F ++ E   +L N+  +E     P++       D    V  L  E      ++  +S+G  +   KA+  I  T +  GRW+ L+N  L   W+  L+K + ++Q       A+F+L L+   +   P+ +L+       E P G+K  +L++F+      + +      +E+ R + F L  F+AV+ ER  Y  LG+S  Y+F +SDL  +   + T+L +          +++ W AL  ++    YGGRI +  D+R L   L+   +  +  +  ++ +K    + GH    + D      F+H  +   + +  + LGL  NAE V L  Q    +  ++  Q    ED    ++       +  S+   +      + T   ++L    Q+IPL      +  E IKD   RF                     E+E+K    +L  + +D+  +V    G K  T  L T+++ +   ++P SW   ++  S++  +W ++   RI
Sbjct: 2370 QQEVIKDKQLRVKQDLDQVEPAVIEAQNAVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEEISDAIREKMKKN---YMSNPSYNYEQVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLEDDAKDNKTKAEEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTALLKSLSAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHLQQANIQFRTDIARTEYLSNADERLRWQANSLPADDLCTENAIMLKRFNRYPLIIDPSGQATEFIMNEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVES-YDPILNPVLNREVRRTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLNEVLKAERPDVDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKKEAAEVTRKVEETDIVMQEVENVSQQYLSLSTACSSIYFTLEALNQMHFLYQYSLHFFLDIY-------HTVLYENANLK----------SVSDHTQRLAITRGLLNICFPLHFF----SVLRGVSSEPPY---DPEFQHFLR-----------GKEIVLTGMTLPK---VKGLTTE---QCEAMVRLSRLPTFKDLVDKVQ-ADEQFFMWLESNSP---------ELSVPYIWAEEKTTPIGQAVHQLLLIQAFRPDRLLAMSTIFVSRVLGDSFMSITEQPLDLANIVDSEVKPGTPVLMCSVPGYDASGLVRDLAAE---QNKHITSISIGSAEGFNKADRDI-NTAVKSGRWVMLENVHLAPGWLMQLEKKLHSMQ-----PHASFRLFLTMEINPKVPVNLLRAGRIFVFEPPPGVKANMLRTFSSIPVARMCKA----PNERAR-LYFLLAWFHAVIQERLRYAPLGWSKKYEFGESDLRSACDTVDTWLDDTAKGRQNISPDKIPWAALKTLMAQSIYGGRIDNEFDQRLLNTFLERIFTTGSFDSEFKLALK----VDGHKDIKMPDGIRREEFMHWVEMLPDTQTPSWLGLPSNAERVLLATQGTDMMGKLLKMQMLEDEDDLAYETEKK---QRTASSSDAQPAWMRTLHTTACNWL----QLIPLSVNPLKRTVENIKDPLFRF--------------------FEREVKMGARMLQDVRQDLTDVVQVCQGKKKQTNDLRTLINDLVKGILPRSWCRYTVPTSMTVIQWVADFSERI 3570          

HSP 4 Score: 160.999 bits (406), Expect = 7.606e-138
Identity = 133/599 (22.20%), Postives = 282/599 (47.08%), Query Frame = 1
Query: 7372 KKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNI---QSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAH-LTSIVDIPISVYFKTINQYK-TSPLKSHYIFNLRVLHKIINGLLNADDKL-VVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPN-DVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHN-----------LTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            K ++LF D++N+P +D++G+Q  +  +RQ +E  GF+  +   W  +     + AC+P     + P+S R  +H  V+ +  P   +  +I+     R   +   ++   A  LT+ +     V F T++Q + T   + HYI++ R + + + G+  A   L  +  E + +  AHE +R   DRL+ D +R       +DE   ++ L          D       P+  S+  +K Y  + + E+L  + ++ +  F  E L+    + F + + H++R  RI  Q  GH+L+IGV G GK +  +  + + G  ++++ +   Y    F  D++ V+ +S  +N   + ++ D  ++++  F++ +  L+ +G +P L+E DE   +++  K        + D + ++Y     ++ + LHV   ++P++   + R   +P+L N C ++W+ DWSTE+L  V      ++              T+++           +    +F+++T  +  N+      R   ++   +++F+N++ ++      +    +  L+ GL ++ ET   + +++ DL       + KS+E E
Sbjct: 1760 KWLVLFCDEINLPDMDKYGTQRVISFIRQMVEHGGFYRTSDQTWVKLERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQIYGT-FNRAMLRLIPTLRTYAEPLTAAM-----VEFYTMSQERFTQDTQPHYIYSPREMTRWVRGIFEALRPLETLPVEGLIRIWAHEALRLFQDRLVEDEERR-----WTDENIDNVALK----HFPNIDREKALNRPILYSNWLSKDYIPV-EQEELRDYVKARLKVFYEEELDVP-LVLFNEVLDHVLRIDRIFRQPQGHLLLIGVSGAGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEK-IAFIMDESNVLDSGFLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQKEGLMLDTHEELYKWFTSQVIRNLHVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQVGKEFTSKMDLEKPNYKVPDYMPTVYDKLPQIPTHREAIVNGCVFVHQTLHQANNRLAKRGGRTMAITPRHYLDFINHYANLFNEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDL-------RIKSQELE 2333          

HSP 5 Score: 88.9669 bits (219), Expect = 1.517e-16
Identity = 35/65 (53.85%), Postives = 53/65 (81.54%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIY 6156
            QWI+ DG ++  WVENLN+VLDD+++L L NGER+++P +++ +FEV DLK ++ ATVSRC M++
Sbjct: 1402 QWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVRIMFEVQDLKYATLATVSRCGMVW 1466          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 426/1189 (35.83%), Postives = 675/1189 (56.77%), Query Frame = 2
Query: 1976 EALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSL-TKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXX-------XXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINLSKEKMIVKKM 5512
            EALK  E         D+  F++ L +  E+  D     + + +G + +    L +   P   +    +N+ L   +    D  I+  R     L+  P T  EFV  L F+++I   +  +++E + + QM+ +I  FKVP   E L +Y TL  +I  ++N +     ++D N+ KF   L+K I E+ + +  +K++A++   LD    ++ + + L        +   +   Y  YQ+ F   ++           FD         L E  +E++R    + ++W++  EWE + + ++  + +  +   +   V++    V  LEK LP N ++P +K  V   +  LPV+  LRNP+L+ RHW  +E++IG  L  K    T+  LI  ++  Y + I ++S  A+ E +LE +L KV+D +   EF ++ H + +D +I+ G D+I + L++S + ISTI  S+YV  I+++V++W+R+L    + L+EW+ CQ++WLYLE IF   DIQRQLP E ++F +VD  W+ +M++    P  L+  T+ G+L   +  N+ LE+IQK LE YLE KR++FPR +FLSNDELLEIL++ ++P+ VQ HL K F  + +L+   + ++             +VS EGE   L + ++ RG  E WL  +E+ +F+ ++R  K  + E +     +W ++    Q +L   Q+ + +++++ L+G    +   L ++ +   +  + L  LA  V  ++    R  + A+I + VH RD    +++  V++  +FEW++Q+RY W+     C      S + YG EYLG  PRLVITPLTDRCY+ + GAL  +LGG   GPAGTGKTET KDL+K +  QCVVFNCSD LD   + +  SG+ Q G+WCCFDEFNR+++EVLSVIA Q+ +I+ AK ++  RF+FE +EIKL   C  FITMNP YAGR ELPDNL  LFRP+AMMVP+Y LI EVIL+SEGF +++VL+ K+T +Y+LC++QLS Q HYDFG+R++KSVL++ G L+ E   + E V         +LI+A++ SN P+ + DD  LF  I+ DLF   +    +   L+ SIE + K    +  P  + K+  L   +  RHGVML+GP+  GKT + + L  AL  L     SK     +K+
Sbjct:  590 EALKNKEH--------DVAFFEESLAKYHEQHKDAVAIKERRDLGMLLVDATKLKKKLIPSPLRCQNAINDLLPVLSRKKTDAIISEARDGQFKLEIVPSTTFEFVNSLTFLDEIQDRIQVLEEEMQIVVQMYQLIEQFKVPTPPEDLVVYSTLEQSIISVQNTIDKAVGERDGNLEKFCQHLDKDILELNMEVKIVKQRAQDPMILDITSDKTKVREILKEQMIATDEFQQQALQYRAYQKNFKVEVT----------NFD--------ALNEVCDELKR----KQMMWDSLDEWEVFTKEWLECQFETLDPEQLNSEVAKYAKIVNQLEKGLPPNNVVPLLKKKVEFIREKLPVVAFLRNPSLKARHWEMLEEIIGAPLRDKETPLTLAGLIELEVFHYAEQIQDVSGQASGEASLESILKKVEDGWKTAEFVVLPHRDSKDVFILAGTDEIQILLDDSIINISTITSSRYVGPIKSRVDEWQRQLLLFNQTLEEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMQVDKSWKDIMRKIYRLPNALRAATQPGLLDTFKNNNALLEQIQKCLEAYLESKRVVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAIARLEFALAPAEGEQERTFTNDILAMVSPEGEKVSLGKGLKARGNVEDWLGKVEEAMFQSLRRLTKMAIGEYQSMPRTEWVVSGLPSQVVLTVAQLMWCRDLTQCLEGG---DHDHLQSVANFEKENFERLNSLACLVRGNLPKIHRCIITALITVDVHARDIVTDMVQEKVETANNFEWQRQLRYYWDLELDNCVARMALSQYVYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKVPRFMFEGREIKLIQTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSRVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPHLREDV---------VLIRALRDSNLPKFLADDAMLFSGILSDLFPGVEIPNHDYGSLQSSIENALKARKLQAVPSMVHKVIQLYETMLVRHGVMLVGPTGGGKTTVYTALSDALGSLHEAGESKHNPFYQKV 1736          

HSP 2 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 414/1389 (29.81%), Postives = 684/1389 (49.24%), Query Frame = 3
Query: 9198 METEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIE--WLTLEVWNKCKFLEIELKDKFSGLCNSF--------------KLTPETWIKWNLSENPF----DMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIY--NNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAI-KDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLP 13292
            ++ E  +  +   + DL    P L+A+ +ALDSL+++ ISEVRV+ NPP  V  VM A+C++LS  P WA+AK LLGD+NFL++L +Y+K+ I++ + + L+ Y   KDF PE V  VS AC+S+C WV A++ Y  V   + PKR+ +  A+  L+ +   L  KQ +LK+VED I  L +++  SV E++ L + + LT  R+ RA  L  A+  E+ RW  S+        N+IG+   ++A   + G +T  YR+M   +WI       IPI  N+  +      + I  W+ +GLPRD+   EN  ++ + ++WPL+IDPQ Q  R+++    K+  ++I     +++  LE AIR+G  + LE+++  +DP L P+L K+ F  G   +I+LG+++++Y  +F+ Y+ + ++NP  +  V   VTIINFTV   GLE+QLLS +V  EKPE+E +RN  +     D   L+ +ED+ L LL  S   I+++ EL + L++SK+T+  IK RL+E    E+ +  AR+ Y P+A RG+ +YFV+A L  ++ MYQYSL +F+ LF   +     E  E  S   E +L+ ++      +Y   S GLF  H+ +F+FML   I+R     SD      +W  F++                + G   ++P   E  WL    WN C  LE  L   F GL                  +L PE W      + P     ++S    +    + L+ F+KL+L+      K++ +   +V   LG+ F      +L  L+ +  A  P+VF+L   SDP+    +   E+ G +  +  +S+G+GQ   AE LI++  +  G W+FLQNC L  SWM +++++I+ L         N++L LS+ P  +FP+ +LQNS+K+  E P G++  + ++F       +T   +  N   +  RK+IF +C F+A++ ER+ +G LG+++ Y+FNDSD E ++  +  F  +  + W+AL  + G I YGGR+TD+ D+RCL  +L+ + S      G  ++  S           Q    +I   +  +     + G+ +NA +   + Q    ++  I++       Q    SN                    I+       L    +++ + G ++    +D+  R N  +               VLEQE+ ++N LL  I   +  L   ++G   ++E +E + +    + VP              WS N    +  +G W         K L L  +   +      P +                               +W+ GFF PQ  +T  +QN AR  +  ID L    + LP
Sbjct: 2712 VKAEETQAMAADAQRDLDEALPALQAANRALDSLDRSDISEVRVFTNPPEGVRTVMEAICIVLSKKPDWASAKQLLGDSNFLKRLTDYDKENISEDVIQKLKVYINNKDFVPEKVERVSKACKSMCMWVRAMDLYSRVLKDVGPKRQRLATAQAELDATMAMLNDKQRRLKQVEDQIGALQDQFDMSVAEKESLAKNMALTQARMSRAGKLTSALGDEQIRWQESVAQFQVEINNVIGNVFIASACVAYYGAFTSHYRQMLIDRWISRCQELGIPINANFSLIGILGDPFEIRQWNTDGLPRDTVSTENGILVTRGRRWPLMIDPQDQANRWIRNKEMKNGLKIIKLTDGNFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRLLIRLGDSDVDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRNELIVRINADKNQLKVIEDRILKLLFTSEGNILDNEELIKTLQESKVTSGAIKTRLKEAEATEEMINTAREKYRPVAARGSVMYFVIASLSEIDPMYQYSLKYFKQLFNMTI-----ETSEKRSDLAE-RLELLLKQTLLATYTNISRGLFEQHKLIFSFMLCIEILRQHGHVSD-----AEWNLFLR---------------GAAGMDKERPTKPEIGWLAESTWNLCCDLEDHLP-CFKGLKREIVAIPILVTLGRLEIRLNPEAW--EGCMKEPLHFTEEVSENEIQGHWNERLSKFQKLVLVKSFMEEKVVFAMTDFVIENLGKAFIENPPVDLATLYQDMSASTPLVFVLSTGSDPMGAFQRFAREM-GYSERVHAISLGQGQGPIAEKLIEEA-VKSGDWVFLQNCHLAASWMLAMEEIIKALSEPNAVIHPNYRLFLSSMPTRNFPVTVLQNSVKVTNEPPKGLRANIRRAFT-----EITPAFFEKNVLGQNWRKIIFGICFFHAIIQERKKFGPLGWNIHYEFNDSDRECALLNLNLFCQDGRIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPKTLEPGY-LYSTSGIYYASEEKTLQDHKDYIE--NLPLNDDPEIFGMHENANLA-FQRQETGTLVKTILEVQPRSSGQGAGTSND------------------EIVKELADSILAKLPEILDMEGAMESLFTRDEKGRINSLTT--------------VLEQEVDRFNTLLQVIRSSLHTLKKAIAGFVVMSEEMEKIYNSFLNSQVP------------VLWSDNAYPSLKPLGGWV--------KDLALRTTFIDAWIKTGPPKS-------------------------------FWISGFFFPQGFLTGTLQNHARKYNLPIDELGFHYKTLP 3977          

HSP 3 Score: 478.789 bits (1231), Expect = 0.000e+0
Identity = 299/1064 (28.10%), Postives = 540/1064 (50.75%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSK-CSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIV-SLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDC-----SLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDP----NDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            +WIV DGP+++ W+ENLNTVLDD+++LCLAN ERI +   +  +FEV DLK +SPATVSRC M+Y+  + + W   V++WM N +   F E   +++  LFE  ++ G++F++K C+  Q +P                                   +D SK  +   + ES       K  P ++ E+S+          L +++ + +VF Y W+ G                       G  +    D+FD FVK  F+ N +   +LP  +  ++SY++D D     PW+ +VP+ +                 N +    E++V + D++R+ +L   L+   H VL  G +G+GKS++   +L                                                D I E++ YVP+         I F++QTS  +  + + SK+ K+ ++IIG P  K++++F+DDLN+P +D +GSQ  +E++RQ+ +  GF+D   + W  + D      ++   C+P    ++P++ R  +HF +L LP PS ++ ++IFQ  +  +    DF + +K   T+IV+  + +Y +   +   +P KSHYIFNLR L K + G+L  D   V ++  + +   HE  R  HDRLI++ D++ F  +L++       +    +   K  I+FG F  + G   + +VY+ +TDVEKL    +  ++ ++         +FF+ +I+H+ R  R++ Q  G+ L++GV G GK S  +++  + G   F++ ++  Y+  +F  D++K+   + ++++  V   +D   +V + F++D+ N++NSG +P+L+E DELE +L+  +P+   ++    P    ++V    I +++  LH+ + +SP    +R+R R  PS++NCCTIDW++ W  E+L+SV+          F   ++   ++   NL+E  + I+ +  E+   +  ELRR Y+ +   ++E +N +  +L     +  ++R R+  GL +L+ET  L+ K++ +L  L P +K+KSE+ E
Sbjct: 1783 KWIVCDGPVDALWIENLNTVLDDNKMLCLANSERIKLTPQIHMIFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWM-NGIIDKFGEDTGQYIMALFENYVEDGLRFVNKKCT--QAMPQ----------------------------------VDISKVTTLSCLLESLL---LGKGGPDLKMEHSR----------LTSIVCQTFVFCYLWAVG-----------------------GNLVENCWDQFDTFVKHQFEENHDA--KLP-SSGDLWSYYMDYDSKRLDPWERIVPNFR----------------YNKEVPFFEMLVPTTDTMRFGYLMEKLLAVKHSVLFTGTTGVGKSVVARGLL------------------------------------------------DKIQEEAQYVPL--------YINFSAQTSSTRTQEIIESKLEKKRKNIIGAPGKKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDAREDRGAMQPFCAPPGGGRNPVTPRFIRHFSMLCLPSPSEHSLKQIFQAILTGFL--VDFPVAVKQVATNIVEAAVEMYGRMSTELLPTPAKSHYIFNLRDLSKCMQGILQCDSGTVRDQNQIFRLFCHECQRVFHDRLINNEDKDYFNTMLAEMASKQFGVQVEAEYFVKHPILFGDFMKV-GVQRADRVYEDLTDVEKLKGVLQDYLDDYNLSSAKEMKLVFFQDAIEHVTRITRMIRQERGNALLVGVGGTGKQSLTRLACHMCGYRCFQIELSRGYSYDTFHEDLRKLYTIAGVEDKDTVFLFTDT-QIVIEEFLEDINNILNSGEVPNLFEKDELEKVLAATRPK---AKEAGIPEGNRDEVLQFFINRVRARLHIVLCMSPVGDAFRARCRMFPSIVNCCTIDWFVQWPREALLSVSK--------TFFTPVDLGSDELKENLSEMCVEIHMSVTELAEHYYAELRRRYYTTPTSYLELINLYLSMLGEKRSQLTNSRDRIKNGLTKLLETNELVDKLQLELSALEPVLKQKSEDVE 2683          

HSP 4 Score: 39.6614 bits (91), Expect = 0.000e+0
Identity = 23/82 (28.05%), Postives = 43/82 (52.44%), Query Frame = 1
Query: 5557 KIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            K+   V+NPK++S+  LYG VN  +LEW +G++ +  +  ++  +++   +      D    EN N     N +  L N+E+
Sbjct: 1735 KVHTTVLNPKSISMGELYGEVNNLTLEWRDGLMALSVRVAVADDSEDHKWIVCDGPVDALWIENLNTVLDDNKMLCLANSER 1816          

HSP 5 Score: 64.3142 bits (155), Expect = 8.425e-10
Identity = 34/102 (33.33%), Postives = 56/102 (54.90%), Query Frame = 2
Query: 13406 GVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            GVLV GL++D + W+ E+  +      +    LP++H       +N + D   +  PLY+T +R G LS++G S+NF+  + + S R   +WI +G A L Q
Sbjct: 4010 GVLVHGLFMDASRWDDEDMVMEDALAAQMNPPLPVLHFEPC---QNYQPDPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVFIPSKRDSDYWISKGAALLCQ 4108          

HSP 6 Score: 60.4622 bits (145), Expect = 1.464e-8
Identity = 53/235 (22.55%), Postives = 93/235 (39.57%), Query Frame = 2
Query:  575 SSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNL----SRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSS--YL--EEISKERNLDSSSSSFM------------------HTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNIS 1201
               D TP+ +W  E     +L ++ TF++FR WKAF  WR N+ + K+   R  L  NL    + L P   +  +  HR+                 N+ +  I+  +TY L EF   Q++ ++    +L +      E V   C+    +   +   Y    E+S +   ++  SS +                  +TE+   RK    +  F++L D  +V   H +    +S
Sbjct:  201 GDVDFTPLDRWEEEYRYHRRLLSIPTFSHFRKWKAFSVWRKNVRSKKINACRRALEENLFIVNASLRPALLNVKDMCHRVG----------------NMRLCMIESGRTYTLEEFMITQVDHLKEVLVHLSEFRELAKEVVRSACRTALLEAGFTPDDYFNDPELSGDEKAETGGSSILFQSQYDLDPFGDAPEKMSYTEQANKRKHCGKLTCFIRLADYVIVNTLHILAVNTVS 419          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 573.933 bits (1478), Expect = 1.946e-167
Identity = 336/889 (37.80%), Postives = 505/889 (56.81%), Query Frame = 2
Query: 2816 RDISMRYL-LWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSL---PQNEILPA-VKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNI---RVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKAL 5458
            +D+ M YL L+E   E+   ++ ++   L +   + V Q V      +  LE+SL   PQ  ++   +K+ V   ++ LP+   L NP L+ RHW  + +++G  L   +   + + +   +  +     +IS+ A+ E +LE  L K+   +  ++F L+ + +  T I++ VDDI + L++  +   T++GS ++    + +++WERKL    ++LDEW+  Q  WLYLE IF + DI  Q+P EGR F  VD  WR L++QT     VL   +   +L+ LQ     LE I K L DYLE KR+ FPR FFLSNDELLEILS  +DP  VQ HL K F  + +++   +   +H  +     EGE   L   I   + RG  E+WL  LE  +   V   I   +         +W     GQ++L  +Q  ++  V  A++G       G   +   ++     ++ +   V   +    R  L A++V+ VH RD   +LL+  +  + DF+W  Q+RY W +     Q   +++   YG EYLG +PRLVITPLTDRCY T+ GALN +LGG  +GPAGTGKTET KDL+K + +QCVVFNCSD LD   + K   G++  G+W CFDEFNR++LEVLSV+A QI +I+   ++  +  +FE  E+KLNP C +FITMNP YAGR ELPDNL  LFR VAMMVPDY +I E++L+S GF++A+ LS KI   YRLC++QLS Q HYD+G+R++KSVL   G+L+L+    SE      NE++ +++++I   N P+ +  DLPLF+ I  DLF        +  +L  +I+ + +++  ++     EKI  +   +  RHG M++G    GKT    +L  AL
Sbjct:  639 QDVLMPYLRLYEMAVEFTSKHKAWMEGPLADVNPDVVEQDVGNYWRGLYKLERSLQASPQALLIQQQLKSNVEAFRTHLPMAQVLCNPGLRGRHWDALSEVVGFPLLTQEQVCLEKFLEMNLESFLSKFNDISDTASKEYSLEKALEKMVREWDEMQFTLIVYRDSGTSILSAVDDIQMLLDDHIVKTQTMRGSPFIKPFESDMKEWERKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKTWRDLIKQTLTDTHVLAVVSIDKMLERLQKSTELLELILKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGISRVEFTEALDITHMKSS----EGEVVQLIETISTSKARGQVEKWLLELEAVMIRSVHNVIGEAMEAYPSTPRAEWVRAWPGQTVLCVSQAFWTSEVHEAIRG-------GQQVLERYLAQCNGQIDEVVGLVRGQLSQQSRVTLGALVVLDVHARDVLVALLKGGIAHDSDFQWLSQLRYYWED--GHLQTRMINAGLPYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSDTLMFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIMLYSFGFVSARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLK--YPSE------NEDI-LMLRSIVDVNLPKFLAHDLPLFEGITSDLFPGVKLPKPDYVVLLEAIKENCEKMNLQMTDFFAEKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAAAL 1505          

HSP 2 Score: 37.3502 bits (85), Expect = 1.946e-167
Identity = 18/66 (27.27%), Postives = 35/66 (53.03%), Query Frame = 1
Query: 5557 KIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSN 5754
            K+ + V+NPKA+++  LYG  +  S EW +G++ +  +   + ++ ++  L      D    EN N
Sbjct: 1518 KVQITVLNPKAITMGQLYGQFDAISHEWSDGVLAVSYRAFATSTSPDRKWLVFDGPVDAVWIENMN 1583          

HSP 3 Score: 348.206 bits (892), Expect = 9.917e-96
Identity = 262/1093 (23.97%), Postives = 506/1093 (46.29%), Query Frame = 1
Query: 5896 DSVKNQFTKDAKIVSHRS-----KKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNI-DTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSY-FVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQK-DFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWA----HDELGKCDI--------MFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNL----KPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKE 9096
            D++ ++++     VS+R+       + +W+V DGP+++ W+EN+NTVLDD++ LCL +GE I + ++   +FE  DL+ +SPATVSRC MIY+    + W+  + SW+ N  P       K  +  LFE+ +   ++F+ K +K ++ P +        L C L                 ++++D    D           F D           +K+  +  + ++++  +  +++F+  WS GA+ +    +  +  + +  SG  S     + +  F L  +++        +  P    ++Y Y F+   KG ++ W             +  LS +  I   + N  + I+ +LD+IR++ L  +L+ +  PVL  G +G                     T  S  I   +  + DKN                                   TY   +I F++QT+  +    +  K+ +R + + GP + K+M+LF+DD+N+P  +E+G+Q  +E++RQW++ + ++D        + +  ++ A  P    ++ ++ R  +HF  +T+ +    +   IF   +G +F  +  F  +       +V   + VY         +P KSHY+FNLR   ++I G+  +  +       + +   HE++R  +DRL+ D DR      +   +H  +K ++     HD  G   +        MF  F     S    K Y +++DVE+L    E  +  F++      N + F+ +I+H+ R  RIL Q   H L++GV G G+ S  ++++ +  C++F++ ++  Y    +R D+K+++ +S    +  V   +D   +  +SF++D+ NL+NSG IP+L+  DE + I   +    +  D   ++   P  +  + +++ +  LHV + +SP    +R+RLR  PSL+NCCTIDW+  W  ++L +VA            +E     E+T+ +  +     + + I +  +FQ E +R  +++   ++E ++ F D+L+   ++    + R   GL +L    S +  M+ +L  L P++ E
Sbjct: 1539 DAISHEWSDGVLAVSYRAFATSTSPDRKWLVFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHILGWRPLLTSWL-NARPPPLSAPHKALICALFERLVPCCLQFVRKSTK-ELSPTSDT-----NLVCSL-----------------MNLMDCQMDD-----------FHD----------ETKIKAM--DDRDVSAWIEGIFLFSLVWSVGASCSTHGQVLFDQLLRELMSGPLSA----DTSKRFHL-SENVEPPAEPFSVPFPAAG-SVYEYRFIQEGKGRWELW-------------TEALSLAPPI-PRDMNFNDIIVPTLDTIRFTALMEMLVTHQKPVLFVGPTG---------------------TGKSVYITNFLLKHLDKN-----------------------------------TYKPLTINFSAQTTAAQTQNIIMGKLDRRRKGVYGPAQGKRMVLFVDDVNMPAREEYGAQPPVELLRQWLDHSNWYDLKDCSMIKLENVQILGAMGPPGGGRNAVTARFLRHFNTVTINEFDDKSMFTIFSRIMGWHFTARFAFPTDFSVLTEQLVQSTMEVYKAATQNLLPTPTKSHYLFNLRDFSRVIQGVCLSLPETCPVAASIQRLWVHEVLRVFYDRLVDDADRTWLVAFIRKTIHTYMKEDFTQLFQHDSNGDGQVEDDDLRSLMFCDF---SDSKDDAKRYVEVSDVERLRLVVEGHLEEFNNLSKKPMNLVLFRFAIEHVCRISRILKQPRSHALLVGVGGSGRQSLTRLAAHMADCELFQVEISKGYATNEWREDLKRILRRSTDGEQNGVFLFTDT-QIKQESFLEDINNLLNSGEIPNLFAPDEKQEICEKMRQIDRQRDKDKQTDGSPLALLNMFVDRCRDQLHVVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPGDALQAVA---------TRYLEDVEVSEETLASCIDMCKLFHTSTIALSQKFQAEQQRYNYVTPTSYLELISTFKDLLEKKRLEVMRMKRRYEVGLEKLESATSQVAGMQAELAALQPQLLE 2495          

HSP 4 Score: 139.428 bits (350), Expect = 1.831e-32
Identity = 73/264 (27.65%), Postives = 138/264 (52.27%), Query Frame = 3
Query: 9231 KCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPS---------------WANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQ-QYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYRE 9974
            +C+ DL    P+L +++ ALD+L +  I+ V+  ++PP  V++VM A+ +L  V P                W  AK LLGD  FLQ L +++KD I   + K ++ +Y    +F+P+ +   S A   +C+WV+A+E Y  V  ++ PK+  +N+A+  L ++   L  KQ  L++V+D +  L    + + +++  L+ +V +  ++L RA  LI  +  E+ RW  + +       ++ G  + S+    + G +   +R+
Sbjct: 2541 ECDADLAEALPILRSALAALDTLTQQDITVVKTMKSPPAGVKLVMEAISILKGVKPDRVPDPSGSGRMVEDLWGPAKRLLGDMKFLQSLHDFDKDNIPVAIMKTIRAKYITNLEFDPDKIRNASTAAEGLCKWVIAMESYDKVAKVVAPKKVKLNQAEAELAVAMGSLRRKQEALREVQDKLAGLQQTLEANKQKKADLENQVDMCTKKLDRAEQLIGGLGGERSRWMEAARLLGIRYNDLTGDTLVSSGIVAYLGAFISSFRQ 2804          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003955.1 (pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 559.296 bits (1440), Expect = 4.258e-164
Identity = 323/812 (39.78%), Postives = 463/812 (57.02%), Query Frame = 2
Query: 3059 NPNLQL---RHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNI---RVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLF-GDFDEVLENDKLLERSIELSYKELGYEVWPDQI--EKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            +P++Q+   RHW ++ +++   +T +   T+ +++   ++ Y     +IS  A+ E +LE  L  + + +  + F  + +      I++ VD+I   L++  +   T++GS ++    T+++ WE +L    + LDEW+  Q  WLYLE IF + DI +Q+P EGRLF  VD  WR +M+     P VL   +  G+L+ LQ CN  L+KI K L  YLE KR+ FPR FFLSNDE+LEILS  +DP  VQ HL K F  + +L    +       +     EGE   L   +     RG  E+WL  +E  +   V+  I R        Q  DW     GQ ++  +Q+ ++  V  A+KG P     GL      + D ++++  L   V  D+    R  L A++ I VH RD    +++  V +E DF+W  Q+RY W   S Q +V  V+   +Y  EYLG SPRLVITPLTDRCY T+ GA   NLGG  +GPAGTGKTET KDL+K +  QCVVFNCSD LD   ++K   G+   G+W CFDEFNR+ LEVLSV+A QI  I+ A  ++   F FE  E+ LNP C + ITMNP YAGR ELPDNL  LFR VAMMVP+Y LI E+ L+S GF+ AK LS KI   YRLC++QLS Q HYD+G+R++K+VLI  G+L+L+          N NE++ +L+++IK  NEP+ ++ D+PLF  I  DLF G      +    LE + E   +   + V P ++  +K+      +  RHG ML+G   +GKT +  +L   LT +
Sbjct:  770 DPSVQMCRDRHWVQMSEVVENDITPDSGTTLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQYRETGVSILSSVDEIQSTLDDQIVKTQTMRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGFLPNLDIGAMFSS----EGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAYANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGP---QQGLREYSERLQDQLKDIVEL---VRGDLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWE--SEQVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFP--------NENEDI-LLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSR---HNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLM 1557          

HSP 2 Score: 40.817 bits (94), Expect = 4.258e-164
Identity = 39/160 (24.38%), Postives = 71/160 (44.38%), Query Frame = 1
Query: 5557 KIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQN--VLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSV--ESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVL 6024
            ++ ++ VNPKA+++  L+G  +P S EW +GI+    ++  S    ++   V +  + T   E  N+  +D   L               L++ EII+   +SQ  S+  E+ D+ Q S     ++   I    S+  WQ      P+  +W+  L   L
Sbjct: 1567 RVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQL--------------CLMSGEIIQ---MSQPMSLIFEAMDLSQASPAT-VSRCGMIYMEPSQLGWQ------PLVQSWLGTLPPTL 1702          

HSP 3 Score: 197.593 bits (501), Expect = 4.338e-50
Identity = 125/500 (25.00%), Postives = 227/500 (45.40%), Query Frame = 1
Query: 6913 ANNQNRVNEIIV-SLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDEL--HMSLKLNWAHDELGK-----CD-----IMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIK 8367
             +   +V +IIV ++D+ RY++L  L + ++ P+L  G +G GKS+ I +                                         K  N+ D       K  Y+P          + F++QTS N+    + SK+ KR + + GPP  K+ ++F+DD+N+P +++FG+Q  +E++RQ+ +   ++D        + D  L+ A  P    ++ ++ R  +HF + T+   S      IF   +  Y    DF  E  +    IV   + VY K +     +P KSHY FNLR   ++I G+L    +    +  + +   HE+ R  HDRL+ D DR   + +  D L  H     +   ++L +     C      +MFG +          ++Y ++  V++     E  +  ++  H N  N + F   ++H+ R  R+L Q  GH L++GV G G+ S  ++++A+ G  +F+  ++  Y +  +R D+K
Sbjct: 1857 GDKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKN-----------------------------------------KLMNNLD-------KERYLPF--------FVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEEGRPLCQEDMRKLMFGDYMN-PDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVK 2299          

HSP 4 Score: 107.842 bits (268), Expect = 5.307e-23
Identity = 61/184 (33.15%), Postives = 98/184 (53.26%), Query Frame = 1
Query: 5776 LNNEQGQRKERR-RSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQII 6324
            L +E+GQ  E R +   +N + I    +  +F   S +     V N F + A         + +W+V DGPI++ W+E++NTVLDD   LCL +GE I +   +  +FE  DL  +SPATVSRC MIY+    + W+  V+SW+    P    E  ++ L +LF   + P ++ + K  K+ ++
Sbjct: 1556 LMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFAS----SDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKMLML 1735          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003959.1 (pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003959.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 557.755 bits (1436), Expect = 1.100e-163
Identity = 323/814 (39.68%), Postives = 463/814 (56.88%), Query Frame = 2
Query: 3059 NPNLQL-----RHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNI---RVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLF-GDFDEVLENDKLLERSIELSYKELGYEVWPDQI--EKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            +P++Q+     RHW ++ +++   +T +   T+ +++   ++ Y     +IS  A+ E +LE  L  + + +  + F  + +      I++ VD+I   L++  +   T++GS ++    T+++ WE +L    + LDEW+  Q  WLYLE IF + DI +Q+P EGRLF  VD  WR +M+     P VL   +  G+L+ LQ CN  L+KI K L  YLE KR+ FPR FFLSNDE+LEILS  +DP  VQ HL K F  + +L    +       +     EGE   L   +     RG  E+WL  +E  +   V+  I R        Q  DW     GQ ++  +Q+ ++  V  A+KG P     GL      + D ++++  L   V  D+    R  L A++ I VH RD    +++  V +E DF+W  Q+RY W   S Q +V  V+   +Y  EYLG SPRLVITPLTDRCY T+ GA   NLGG  +GPAGTGKTET KDL+K +  QCVVFNCSD LD   ++K   G+   G+W CFDEFNR+ LEVLSV+A QI  I+ A  ++   F FE  E+ LNP C + ITMNP YAGR ELPDNL  LFR VAMMVP+Y LI E+ L+S GF+ AK LS KI   YRLC++QLS Q HYD+G+R++K+VLI  G+L+L+          N NE++ +L+++IK  NEP+ ++ D+PLF  I  DLF G      +    LE + E   +   + V P ++  +K+      +  RHG ML+G   +GKT +  +L   LT +
Sbjct:  768 DPSVQMCSIRDRHWVQMSEVVENDITPDSGTTLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQYRETGVSILSSVDEIQSTLDDQIVKTQTMRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGFLPNLDIGAMFSS----EGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAYANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGP---QQGLREYSERLQDQLKDIVEL---VRGDLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWE--SEQVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFP--------NENEDI-LLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSR---HNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLM 1557          

HSP 2 Score: 40.817 bits (94), Expect = 1.100e-163
Identity = 39/160 (24.38%), Postives = 71/160 (44.38%), Query Frame = 1
Query: 5557 KIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQN--VLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSV--ESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVL 6024
            ++ ++ VNPKA+++  L+G  +P S EW +GI+    ++  S    ++   V +  + T   E  N+  +D   L               L++ EII+   +SQ  S+  E+ D+ Q S     ++   I    S+  WQ      P+  +W+  L   L
Sbjct: 1567 RVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQL--------------CLMSGEIIQ---MSQPMSLIFEAMDLSQASPAT-VSRCGMIYMEPSQLGWQ------PLVQSWLGTLPPTL 1702          

HSP 3 Score: 197.593 bits (501), Expect = 3.794e-50
Identity = 125/500 (25.00%), Postives = 227/500 (45.40%), Query Frame = 1
Query: 6913 ANNQNRVNEIIV-SLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDEL--HMSLKLNWAHDELGK-----CD-----IMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIK 8367
             +   +V +IIV ++D+ RY++L  L + ++ P+L  G +G GKS+ I +                                         K  N+ D       K  Y+P          + F++QTS N+    + SK+ KR + + GPP  K+ ++F+DD+N+P +++FG+Q  +E++RQ+ +   ++D        + D  L+ A  P    ++ ++ R  +HF + T+   S      IF   +  Y    DF  E  +    IV   + VY K +     +P KSHY FNLR   ++I G+L    +    +  + +   HE+ R  HDRL+ D DR   + +  D L  H     +   ++L +     C      +MFG +          ++Y ++  V++     E  +  ++  H N  N + F   ++H+ R  R+L Q  GH L++GV G G+ S  ++++A+ G  +F+  ++  Y +  +R D+K
Sbjct: 1863 GDKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKN-----------------------------------------KLMNNLD-------KERYLPF--------FVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEEGRPLCQEDMRKLMFGDYMN-PDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVK 2305          

HSP 4 Score: 107.071 bits (266), Expect = 9.710e-23
Identity = 61/180 (33.89%), Postives = 95/180 (52.78%), Query Frame = 1
Query: 5776 LNNEQGQRKERR-RSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSK 6312
            L +E+GQ  E R +   +N + I    +  +F   S +     V N F + A         + +W+V DGPI++ W+E++NTVLDD   LCL +GE I +   +  +FE  DL  +SPATVSRC MIY+    + W+  V+SW+    P    E  ++ L +LF   + P ++ + K  K
Sbjct: 1556 LMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFAS----SDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCK 1731          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 507.294 bits (1305), Expect = 1.845e-144
Identity = 318/958 (33.19%), Postives = 496/958 (51.77%), Query Frame = 2
Query: 2627 DQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSL-TKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDIN--VDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVL-QILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVR----GLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQF-VDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQC--QVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEI-KLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNE-ELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALT 5461
            D+L   + +  DL  K   YS  +E FG  ++      R R++  L                   +   Y L+ T  E    Y   +   LD  ++N     +    +    L K+L + +    +K  ++    + P++  + N  +  RHW +I  + G +   ++ +F +  ++ + +L +K  I +I   A  E  ++  L  V   ++   F      +R   ++ G D       +E+S M ++++  ++Y    +  ++ W +KLS+T ++++ W+  Q  W+YLE +F   DI +QLP E + F  +D  W+ +MQ+  E P ++ CC     L Q+L     +LE  QKSL  YLE KR++FPR FF+S+  LLEIL +A DP  +Q HL  LF NV+++     + +          EGE+  L   +  +    G  E WL +L  G+   V   I++    +E   F +     +F   + +  Q+ ++++   AL    +        +P+     +  L  L    + D+   +R   E +I I VH +D    L+  ++KS  DFEW KQ R+ + E + +C  Q+T VD  F Y NEYLGC+ RLVITPLTDRCY+T++ AL  ++GG   GPAGTGKTET KD+ K +G+  VVFNCSD++D   + ++  G+ Q G+W CFDEFNR+ L VLSV A QIY +   K ++  +F+F + +I +++   GIF+TMNP YAGR ELP+NL   FR VAMMVPD  +I  V L S GF   ++LS K   LY+LC +QLS Q HYDFGLR+I SVL  +G ++          + N  E E  ++++ ++  N  +L+ +D PLF S++ DLF            LE +I    K  G    P  + KI  L    + RHG+M LGPS +GKT    +L KA+T
Sbjct: 1336 DRLQMCQMQFDDLWRKFTTYSGGEELFGLPVTDYPELQRIRRELAL-------------------LQKLYGLYNTVIESVDGYYEILWSDLDIEKINN---ELLDFQNKCRKLPKALKEWQAFEDLKKKIDNFNETCPLLEMMANKAMMSRHWERITNVTGHTFDIESDHFALKNIMEAPLLTFKDDIEDICISATKERDIDAKLKAVVSEWSSQCFTFAPFKSRGELLLKGSDTAEKVALMEDSLMVLASLMSNRYNVPFKPTIQQWVQKLSNTTEIIENWMMVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHEIPGIVVCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDPHTIQAHLLGLFDNVNQVGFHEKNYEQILSIESQ--EGESVTLVEPVMAQRGWQGNVETWLGSLLTGVRSTVHAVIRQAAAIIEDGAFKLHEFQTSFPAQVGLLAQMIWTRDSEVALNNAKNDRKI----MPATNQKFLDLLNELIDMTTRDLTKRERVKYETLITIHVHQKDIFDDLVRMNIKSTADFEWLKQSRFYFVEETDKCLIQITDVD--FHYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKRTQFVFTDGDIVEMDREFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVK----------RSNPEEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPELEEAILAQTKAAGLVHHPPWVLKIIQLYETQRVRHGMMALGPSGAGKTCCIHMLMKAMT 2253          

HSP 2 Score: 27.335 bits (59), Expect = 1.845e-144
Identity = 9/35 (25.71%), Postives = 22/35 (62.86%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMI 5679
            +NPKA++   ++G ++  + +W +GI   + +K +
Sbjct: 2264 MNPKAITAPQMFGTLDVATNDWTDGIFSTLWRKTL 2298          

HSP 3 Score: 208.379 bits (529), Expect = 2.474e-53
Identity = 158/636 (24.84%), Postives = 303/636 (47.64%), Query Frame = 1
Query: 7246 ETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFD-NTSLQWTYVTDCSLIVAC--SPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQV-KIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIF----FKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLK-----GSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTN-NFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDP---NDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVA-HFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEK 9099
            + + ++  S+ F+S T+ N   + + S + KR     GPP  +KM +FIDD+N+P I+E+G Q T E+VRQ +E NGF++     ++T + D   + A       ++ I +RL + FC+     PS+ +  +IF+    G +  ++ F  E+     ++V     ++  T  +   +P K HYIFNLR L +I  G+L  + ++  + + +     HE +R I DR  +  D++ F     KI+ D+ H +        E+   D M     P           + KVY+ I    +L    ++ +  ++      N + +FF  ++ H+I+  RI+    G+ L++GV G GK S  +++S I G   F++ ++  YN  +   D+K++  K+  Q +      +D +++ +++F++ + N++ SG + +L+  DE++ I   L P  L  E    P    ++Y   + +++  LHV +  SP    +R+R    P+LI+ CT+DW+  W  ++L +VA HF                  +    + +A         E   ++    RR  +++   ++ F+  +  I             R+  GL++L E    ++++  +L     ++KEK
Sbjct: 2578 DAELHLTKSLNFSSATTPNMFQRTVESYVDKRMGTTYGPPAGRKMTIFIDDINMPIINEWGDQITNEIVRQLMENNGFYNLEKPGEFTTIVDVQFVAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNASIDKIFRTFAEGHFCPERGFPEEVNQLAVALVPTTRRLWQATKVKMLPTPAKFHYIFNLRDLSRIWQGMLIMNSEVCRSSDMLLALFGHECVRVIADRFTAQQDKDWFNGTMSKIMLDD-HGTAAAASMEAEVYFVDFMRDAPEPTGEEPDDADLEAPKVYEPIPSFPQLAERLQAFLVQYNESVRGANMDLVFFADAMVHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYSSFQITLSRTYNMSNLMEDLKQLYRKTGQQGKGVTFIFTD-NEIKDEAFLEYMNNVLASGEVSNLFARDEIDEITQELIPV-LKKEHPRRPPTNENLYDYFLSRVRANLHVVLCFSPVGEKFRARALKFPALISGCTMDWFQSWPRDALTAVAGHF--------LAEYRVECTPEVKRGVVDAMAVFQDMVAERCVEYFERFRRQTYVTPKSYLSFIGGYKSIYSEKLSNVALLSERMRTGLSKLQEAEKSVSQLSREL-----EVKEK 3197          

HSP 4 Score: 99.3673 bits (246), Expect = 2.616e-20
Identity = 89/367 (24.25%), Postives = 156/367 (42.51%), Query Frame = 1
Query: 5965 WIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDIL 7065
            WI+LDGP+++ W+ENLN+VLDD++ L LANG+RI +  + K +FE  ++ N+SPATVSR  M+++    + W+  V++W+                                     Q +P    Q    T+  + + LI ++       N  +DIL+      + ++ +   P  D ++      E+S               L +L VF+  WS GA       LE+E   D A                + F+++   + S   +    ++ +I+ Y V  D G ++ W+  VP      D   +  +S+ +  N           +D++R  FL   +M     VLL G+ G  K+++I   +
Sbjct: 2307 WILLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPIVQAWL-------------------------------------QGLPTEQAQVLWSTMDSVFQDLINFVFTAV---NPKMDILECMYIKQAIELLKGLLPEADERRL-----EHSH--------------LQRLLVFSLMWSVGAL------LELE---DRA--------------RMEAFLRA---HPSHLDLPGSANDDSIFEYVVG-DSGGWEHWNTRVPEFAYPRDT--VPEYSAILVPN-----------VDNVRTDFLMQCIMKQEKAVLLIGEQGTAKTVMIKGYM 2574          

HSP 5 Score: 95.5153 bits (236), Expect = 3.817e-19
Identity = 58/220 (26.36%), Postives = 104/220 (47.27%), Query Frame = 3
Query: 9237 EEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLL--------------SVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEK 9854
            E+ L +  P LE +  AL ++  A I  VR    PP L+  +M+ V +L                + PSW+ A+ L+  A FL  LL + KD IN++M   L  Y   +D+N E+   V      +C W  A+  +  +N  ++P +  +   +  L +++ +L+  Q QL + +  +  +   Y  +V+E++ L +       ++  A ALI+ +  EK
Sbjct: 3249 EKKLEAAKPALEEAEAALQTIKPADIGTVRKLSKPPHLIMRIMDCVLLLFRRRVDTVVPEPERPCMRPSWSEAQKLMNFAGFLNSLLTFSKDTINEEMVDLLMPYMEMEDYNLETARNVCGNVAGLCSWTKAMVTFFGINKEVLPLKANLIIQESRLAVAQGELDRAQAQLDEKQRELDAVQAMYDTAVREKQILVDDAEACRRKMNNATALIDGLGGEK 3468          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 298.516 bits (763), Expect = 1.053e-80
Identity = 233/836 (27.87%), Postives = 401/836 (47.97%), Query Frame = 2
Query: 2963 LEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGL-----SLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFG-TVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRG--LAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNF-GQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKK-QIRYLWNEFSSQCQ---VTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTV 5431
            L +++ Q E+  ++ + VN   S   +++ L++  L+ RHW+ I + IG      +L     F++ +++   +   + ++ +I E A  E  +E  L ++K  +   ++ ++ HS+    ++   D +    +E    + ++K S Y         D E KL+  +++   W+  Q +WL L  I G  +DIQ  LP E   F  +  E++ +  +  +    ++          L+     L+ I+ SL  +LE +R  FPR +FL ND+LL+I+   +  + V + + K+F ++  +                  EGE   L   I ++    A++WL  L+  I   V  Q + CL +++    ++  ++ +  Q+IL+S QV +++ V + L+   +  S     +   I  L+  L       S D V  K   +EA++V  +H  +    L     K E    W K Q  Y  N+         ++Q     +Y  EY+G   RL+ TPL    + T+T +L+   GGC  GPAGTGKTET+K   + +GR  VVFNC D  D   +++LL G+ Q+G+W CFDEFNR++ +VLS ++A I  I+              +E  L+P+  +FIT+NP Y GR ELP+NL   FR  +M  P    I E+IL   GF  +K L+SKI +   L + + S   HY FGLR++K V      LR    LISE       E    +++++K    P L   D  +FK  +  +F      L N K + + ++ + +  G+ +  + ++K        K++  ++L+G +  GKT 
Sbjct: 1275 LPRAVKQFEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWKEAQYEVIEHSS-GLKLVREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLEDFITGVRSV-----EGEVLNLNEKIELKDSIQAQEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVVVSKYIFQAILLSAQVMWTELVEKCLQ--TNQFSKYWKEVDMKIKGLLDKL-----NKSSDNVKKK---IEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGV------LRNCSPLISE-----FGEGEKTVVESLKRVILPSLGDTDELVFKDELSKIFDSAGTPL-NSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTA 2082          

HSP 2 Score: 186.037 bits (471), Expect = 8.705e-47
Identity = 134/559 (23.97%), Postives = 276/559 (49.37%), Query Frame = 3
Query: 9255 VTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPS-WANAKLLLGDANFLQKLLNYE-----KDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWI--DILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKW-PLLIDPQKQGKRFLQTTFKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLF 10904
            + P +  + + + ++ K  ++E+R   NPP  V+IVM AVC +L    S W + +  +   +F+  +++Y+     K  I K M    +++    +F  E++   S AC  + QWV A  ++  V   + P R+ +   +     +K  L   +   + +E  I+    KY   +++ + +K  +      L R+ +L++++  EK+RW ++ K   K ++ +IG+C+ S+ Y T+ G   L  RE A    I   +LG  ++  + NY+F+++  +    + W   GL ++    EN++I+  S+   P L+DP       +   + +   ++S  ++ ++  LE AIR G  + ++D E   DP++  L+ +EF   GN   +++G++E++ S  FKL++ S   +  +   +   V +++F  N   +E ++  + +++E  E++ +R   ++        L+NLE + L  L +S   ++ + EL   L   K  A++I+K+L E+ +   Q     + Y  +     +I+ +L   G  ++ Y  S+  F + F
Sbjct: 3101 IEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQFSNWRDIQQFIRKDDFIHNIVHYDTTLHMKPQIRKYME---EEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFG--HLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTVLLSFLEEGFVKRLENAIRFGSVVIIQDGEF-FDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCF 3653          

HSP 3 Score: 152.525 bits (384), Expect = 1.304e-36
Identity = 144/648 (22.22%), Postives = 294/648 (45.37%), Query Frame = 1
Query: 6865 NLIDASGILSFSS--------GINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNI---QSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSI--EIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNA-DDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHK-SILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNL--KPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAH 8757
             ++ A+  LSFSS         + A+   R + +I ++D+I++  +   L+ +   ++L G  G GK++++N+ L+          S+   ++G  F  +   +++LS++                                               +H       +G  ++     K ++LF D++N+P +D++GSQ+ +  +RQ +E  GF+     +W  +    ++ AC+P     + P+SER T+H  +L L  PS  +  +I+++     +++  F +  E +++        + +Y +   +Y T  L+SHY+F+ R L +++ G+  A +         + +  A+E  R   DRL+   ++  F ++L + +   L     + +LG           L  S   +  ++++   + L+ F E    TF  E L     +  +  + H++R  R L Q  GHM++IG    GK    +  + + G  I +  +    N   F   +KK I   S+ ++R C++   D  +++  +F++ +  L+ +  IPDL++ +E + +L+NL  K   LG   +    ++Y   + +I K LHV   +    +   S + ++P+L N C I+W  DW T+++  VA+
Sbjct: 2358 TIVIANDKLSFSSFCSEIPSVSLEAHEVMRPDIVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNNALR---------NSSLYDVVGINFSKDTTTEHILSALH----------------------------------------------RHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEI-----YYKAIFKLVPEFRSYTEPFARASVHLYNECKARYSTG-LQSHYLFSPRELTRLVRGVYTAINTGPRQTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYL----PNQDLGNISST-----SLLFSGLLSLDFKEVNKTD-LVNFIEERFKTFCDEELEV-PMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLII--DESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGL-LLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVAN 2930          

HSP 4 Score: 77.411 bits (189), Expect = 7.262e-14
Identity = 29/64 (45.31%), Postives = 49/64 (76.56%), Query Frame = 1
Query: 5965 WIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIY 6156
            W+V D  ++  +VE +N+VLDD++IL L NGER+ IP + + LFE D+L +++PAT++RC +++
Sbjct: 2151 WVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLW 2214          

HSP 5 Score: 65.855 bits (159), Expect = 1.901e-10
Identity = 61/248 (24.60%), Postives = 109/248 (43.95%), Query Frame = 3
Query: 11577 FILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQ-ATKAESLIQKTHIHKGRWIFLQNCDLMISWMPS-LQKLIENLQISKQDNDANFKLILSTHPHSD-FPIGILQNSLKIAIESPIGIKN---QLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFL---TNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNN 12293
            F + +  D ++   KL+   + +  +L I+ +G  +    A+  I K+ I  G WI LQN  + +SW+ + L K +E  + +++     FK+ ++ H   D  P  +LQ + +   E   GI +    L  S    G  +   ++Y           F L  F+A++  R      GFS  Y FND D + +   +   L   + N + W  + + I  I YGG+I +  D   +  L  +    ++N
Sbjct: 3786 FTMASERD-VDGTFKLIELAKASKESLKIIPLGSIENLNYAQEEISKSKIEGG-WILLQNIQMSLSWVKTYLHKHVEETKAAEEHE--KFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILDTVKDLWGSQFFTGKISGVWSVY---------CTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVVAKLCAHVFCGSDN 4020          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Nematostella
Match: EDO42194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S285])

HSP 1 Score: 781.941 bits (2018), Expect = 0.000e+0
Identity = 462/1397 (33.07%), Postives = 746/1397 (53.40%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQG-KRFLQTTFKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIM---RYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDN--IEWLTLEVWNKCKFLEIELKDKFSGLC-----NSFKLTPETWIKWNL--------------SENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQ--SEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLT-NNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASE---NNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSK--HHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSI--GKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEV 13286
            E   V+  + + + DL +  P L+ +I ALD+L+K+ ISE+RVY  PP +V  V+ AVC LL   P W  AKLLLGD  FL+KL+NY+K+++  K++  L++YT   +FNP++VG +S+ACRS+CQWVLA+E+Y  V  M+ PK+K   E++ AL ++K+ L  KQ  L K++D +  L  +Y +SV++ ++LK +  LT  RL RA+ L  A+  E+ RW++S+++  K    ++G    SAA  T+ G +T  YR     +WI +   +SIP+   ++  +       I  W N+ LP D    EN  I++  ++WPLLIDPQ+Q  K  +Q    +  +V+     +Y+  LE AI +GD + +ED+  Q+DP L P+L K    +GN+ +I++GE ++EY+ +F+LYL + L+NP  +  V    TIINFTV L GL++QLLS  V +E P++E +R   L    ND   +R LED++L LL  S   I++D +L   L++S+  A  I++R++     E+ +  +R+ YLP+A RGA +YFVL DL  ++ MYQ+SL WF NLF  CV     E  ++VS+S    L  ++D +T   Y + SH LF+ H+  F+FML TSI+   +++   +   I +++W  F++                S GQ+I + +    +W++  +W +C  +   L   FSGLC     N   +   T+ K N+              +   + M + N   +    L  F++L+L+ IL    LI S R +V+  +G KF T +  +L  ++ ES+A+ P++FIL   SDP + +++   ELRG T +LD++S+GRGQ  +AE +I K +  KG+W+FLQNC    S+MP LQ++I  +  S+   D  F++ LS+ P   FP+ ILQ  LK+ +E P G+K+ LL++F   G G VTE ++ +       R+++F LCLFN++V ER+ + +LG+++PY+F  SDLE+SI+ +   LT + +V W+ L  + G+I YGGR+TD  D+RCL  LL  + +    N++    E  V  P      L+   +    + + D        L G+  NA +V L +Q+K+ + +++  Q K   H   K T     L++   I +++P +  +  +                                N  +   +++         VL+QE+ + + LL  IH  +  L   + G   ++E+LE   + +  N VP  W   S    K L  W  N+  R+DF   W           LEL ++                                      R++   YWLP FF PQ+ +TAV+Q  +R+ +  +D L    +V
Sbjct:  802 EAMRVQAIADEAQRDLDNAIPQLQLAISALDALDKSDISEIRVYTKPPAMVMTVLAAVCTLLQQKPDWNTAKLLLGDQGFLKKLVNYDKNSVPDKVFVRLKKYTQHPEFNPDNVGKISVACRSMCQWVLALENYADVYKMVAPKQKRCEESQAALAMAKENLRLKQASLNKIQDQLNILQRQYDDSVQQLEELKVKKNLTLARLDRASVLTTALAEEQIRWNTSLEEVAKQCTGLLGDTFVSAAAVTYLGAFTSSYRSHLIMRWIALCNKESIPVGREFELSDVLSEKIEIQKWLNDELPHDKHSVENAVIMKHCRRWPLLIDPQEQAVKWIMQREKSNGLKVVKATDPNYLRALEDAIPLGDPVLIEDVGEQLDPSLNPILTKNIILQGNMHVIRMGETDIEYNENFRLYLTTPLANPHFLPDVCIKSTIINFTVTLEGLQDQLLSRTVMQENPKLEEDRRETLVNLVNDRSKVRELEDRSLSLLNSSRGNILDDEDLITTLDESEKMAHVIQQRVDLAEHTEESINASREKYLPVAARGAILYFVLTDLSSLDVMYQFSLPWFTNLFANCV-----ESSKDVSLS--EYLTALVDLITENVYRVVSHALFARHKLTFSFMLCTSILMQDKWTSRGTLRSITEEEWIFFLR--------------GGSLGQLINKMNKPPAKWISASMWKECLQISNSLS-AFSGLCSNMAVNIHSIKHSTYDKKNIPRKHTIYISQKVFSANGEWQMVNGNGNGWLCTSLTRFQRLMLVKILRPECLIKSVRQFVEEEMGTKFITTVGFDLQEMYDESNARTPLIFILSPGSDPASQLLRFAHELRGTTLHLDMISLGRGQGPRAEEVINKAYQQKGKWVFLQNCQHAASFMPRLQQIIRRISHSETQLDPQFRMWLSSKPDPSFPVSILQAGLKMTVEPPPGVKSNLLRTFGAVG-GAVTEAVFEDAGPGPAWRRLLFGLCLFNSLVHERKKFNALGWNIPYEFTTSDLEVSIQMLHMMLTEHRDVPWDELCYLTGDIAYGGRVTDQWDQRCLKSLLTRFYNPSVLNDDYAFTEDLVYRPPPPNISLSVCCTYIEGLPATDSP-----ELFGMNHNAAMVYLGDQAKNLVSNLLAGQPKVAFHTGSKKTSDGIILELAADIMSRLPIAYTRQPVS-------------------------------NASTQSTLLV---------VLDQELNRIDRLLQVIHTSLSSLRQAVKGTLVMSEALEQAFEALLNNQVPLEWKKHSYESCKPLGSWVDNLVKRVDFFACW-----------LELAFA--------------------------------------RQHPRAYWLPAFFHPQAFLTAVLQTHSRMRNVPLDSLAFEYKV 2081          

HSP 2 Score: 483.411 bits (1243), Expect = 0.000e+0
Identity = 273/868 (31.45%), Postives = 464/868 (53.46%), Query Frame = 1
Query: 6532 KVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNN----FIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYF-LLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            + S++Q+NP  L   LGK+YVFA+TW+FG      E                          FD FV+ LF NN +  I LP    T+++Y++DM+ G F  WD+LVP+ + LI  S        +   + +R   ++ ++D++RY+FL AL+ +N HPVLL G+SG+GKS L+ D L ++    G+        LGKI                                                 +F++ T+ ++    + S++VKRG+D++GP   KK++LF+DDLN+P  DE+ SQ  LE++RQ ++  GF+D   L W  + D +L+ ACSP    +S ++ RL +HF +L LP PS+   + I+  ++GR+  + DF+ EI+     IV + + +YF        +P K+HY FNLR L K+I G+L A   ++  +E   + +AHE  R  HDRLI+  DR  F+ +LS +LH+  K+ W  + L    IM+G FF        T++Y+ +++ ++++   +     +D   L++ N    F+FF  ++QH+ R  R+      HM+++GV G GK + V++++ I  C   +  ++  Y    F  DIKK    + ++    V++L+  D +  D F++D+ +++++G +P+++++++ ENI   LK E L S  + D  +  F   I +++K LHV I  SP    +R R R  PSLINCCTIDWY  W  ++L SVA          F++     K     +L  A + +++   +  ++F  EL+R Y+ +   +IEF++ F  +      + +S+R RL+ GL +L E+ +L++ M+ +LI+L PK+++K+++TE
Sbjct:    5 RTSYVQRNPTHLLTFLGKVYVFAFTWAFGGTLDLHE-------------------------VFDTFVRDLFMNNGDLSILLPAGQATMFAYYIDMETGNFARWDLLVPATRTLIAKS--------VTEYDVDR--SLVPTVDTVRYAFLVALMAMNKHPVLLTGESGVGKSTLLYDTLARLASPGGTG-------LGKI-------------------------------------------------QFSAHTTASRTRTFIESRLVKRGRDVLGPRPGKKLILFVDDLNMPQPDEYSSQPPLELLRQVMDAGGFYDTKKLLWKELRDVTLLTACSPPGGGRSTLNNRLLRHFSMLCLPHPSTKWLRHIYNTQLGRFLEKVDFTREIRDSRECIVSVAMGLYFNLSVNLLPTPAKTHYTFNLRDLSKLIEGMLQAHPTIITIREHFAQLLAHEASRVFHDRLINQDDRAYFYDVLSKQLHLGFKVRWEPEMLQDEPIMYGDFFD-TNMPHGTRIYRLLSNYDRVLHILQ---EYYDKAKLSSGNMEQRFVFFDMAVQHVARAARVFRHPGSHMMLVGVGGTGKVTVVRLAAFIQDCRFIKPQVSRVYQRAEFWEDIKKAYFNAGIKGESTVLFLT--DSVAKDMFLEDVSSILSTGEVPNMFDHEDYENIFLELKGEVLRS-GIQDTKEATFNFFIHRVRKKLHVVISTSPVGPSFRQRCRLYPSLINCCTIDWYDKWPQDALRSVA--VSYLESMEFEVVEVPDKAALKRSLASAFVQVHQDVEDDTDRFYKELQRLYYTTPTSYIEFVHIFMFMFHEKASQISSSRKRLATGLQKLSESNALVSTMQAELIQLGPKLEQKAKDTE 772          

HSP 3 Score: 52.373 bits (124), Expect = 6.807e-6
Identity = 40/116 (34.48%), Postives = 56/116 (48.28%), Query Frame = 2
Query: 13364 NIRDNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            + R  S T    + G +V+GLYLD A W+  +  L   P  +R   LP +H +       + E      CP+YRT  R   L SSG ++NF+  + L S +    WI RG A L Q
Sbjct: 2099 DFRRASFTGNATEEGTIVYGLYLDGASWDHTDGCLQEAPDGQRISPLPELHFVPYQVRDQQYE------CPIYRTSLRASSLLSSGLTTNFVTAVNLPSRQPCDHWITRGVAMLCQ 2208          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Nematostella
Match: EDO42618 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0X9])

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 343/883 (38.84%), Postives = 502/883 (56.85%), Query Frame = 2
Query: 2840 LWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNEC-------KSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            +W T S+W++W+++++   L   +   + Q V+ +  T+    K   +   +PA + +  E        K  +P+I  LRNP ++ RHW ++ K +   +  N   T  + +   +  +  II +I E A  E ++E  L K++  +  L   ++++    T+I+   DD +  L++  +   ++  S Y      ++  WE KL  T  V+DEW+ CQ++WLYLE IF + DI RQLP E + +  ++  WR +M   K  P V+  C    +L+ L+ CN  LE++QK L +YLE KR  FPR +FLS+DELLEILS+ +DP  VQ HL K F N+ KL+ +     S   +     EGE      ++   G  E WL  +E  +   ++  +++ L         +W L   GQ ++   Q  +++ V+ AL+      S G L      + L   L  L   V  D+    R  L A+IVI+VH  D A  ++E  V+S  DFEW  Q+RY W E      +  V++ F+YG EYLG + RLVITPLTDRCY+T+TGAL+   GG   GPAGTGKTET KDL K M  QCVVFNCSD+LD   + K   G+   G+W CFDEFNR+++EVLSV+A QI +I+ A ++R ERF+FE  E+ L P C +FITMNP YAGR ELPDNL  LFRPVAMMVP+Y LI E+ LFS GF  AK L+ KIT  ++L ++QLS Q HYDFG+R++K+V+   G+L+ E   +SE +         I+++AI+  N P+ + DDL LF+ I+ DLF    E   +  +LE SI  +  + G +     + K   L      RHG+ML+GP+ SGKT    +L+KA+T L
Sbjct:  943 MWLTASDWQKWHDSWMNDPLTTIDAEQLEQNVNNSFKTIFKCYKHFKE---IPACQQVAYEVREKIEAFKPYIPLIQGLRNPGMRSRHWEQLSKELCFPVVANAQLTFTKCLEMGLQDHTDIIAKIGEIAGKEYSIEQALDKMESEWKPLLLDILAYKETGTFIMKVSDDCSQLLDDHIVMTQSMSFSPYKKPFEDRITSWEGKLVMTQDVMDEWLQCQRNWLYLEPIFSSEDINRQLPVESKRYQTMERIWRKVMNAAKSNPQVISLCPDARLLESLRECNKLLEQVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLKFEEDLRISSMFSG----EGENVDFSTDLYPTGNVEDWLLEVENTMRNSLRDTLRKALELYPTVPRTEWVLQWPGQVVIAGCQTFWTREVTEALQEN----SLGELN-----TALRNQLNDLVTLVRGDLSKLARLILGALIVIEVHACDVAGKMVEEGVQSANDFEWISQLRYYWEE--DNMVIRAVNAQFDYGYEYLGNTGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAMAVQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDVEVLSVVAQQISTIQQALEARVERFMFEGVELNLKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPNYALIAEISLFSFGFSEAKGLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKREAPDMSEEL---------IVLRAIRDVNVPKFLQDDLKLFRGIVSDLFPHVKEQPIDYGVLEDSIRKTCLKTGLQDVDGFVTKCIQLYETTVVRHGLMLVGPTGSGKTQCYEVLKKAMTAL 1798          

HSP 2 Score: 92.4337 bits (228), Expect = 4.314e-18
Identity = 47/120 (39.17%), Postives = 75/120 (62.50%), Query Frame = 1
Query: 5938 SHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFL 6297
            S  S  + +W V DGP+++ W+EN+NTVLDD++ LCL +GE I +   +  +FEV DL  +SPATVSRC M+Y+    +     V  ++K +LP +   + K+ L  LF+  ++  +KF+
Sbjct: 1851 SSSSTPDLKWYVFDGPVDAVWIENMNTVLDDNKKLCLTSGEIIKLSEVMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLSPYVVCYLK-RLPDAI-FNYKDKLQALFDGFLESSLKFI 1968          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 331/1032 (32.07%), Postives = 574/1032 (55.62%), Query Frame = 3
Query: 9234 CEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYR-EMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDN--IEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYN--NQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIE 12308
             + DL    P L+ ++KAL+SLNK  ++E++ Y  PP LVE VM AV +L    P+WA AK  LGD NF+++L+NY+KD +  ++ K +  Y  Q DF PE +G VSLA +S+C WV A+E Y  +  ++ PK++ +++A   LE  +  L   + +LK+V D ++ L  +Y     ++++L+ +  L   +L RA  L+  +  E+DRW +S+   ++    ++G C+ +AA+ ++ GP+   YR E+  K W+  +    +    N+ F  F     T+  W+  GLP D+   EN  ++ +  +WPL+IDPQ Q  ++++    K   ++I  +Q DY+  LE A++ G  + L++++ ++DP L P+L K   + G   +IKLG+ E+EYSP F+ Y+ + LSNP     ++   TI+NF V   GLE QLL ++V +E+PE+E +++  +   A   + L  LED+ L LLQ +   +++D +L   L  SK T+ ++ ++L  + Q E ++  AR+ Y P A R + ++FVL D+G ++ MYQ+SL  + +LF   +++  +      S + + ++Q + +  TY  Y     GLF  H+ LF+F + + I+     E+  ++   ++  F++               D  GQ+    DN   +WLT   W+     E++    F G+  SF+  P  W +W  S  P +       E +    N  ++++++  L   ++  +A  ++   LG KF      ++ ++  +S  + P++F+L    DP + +++L  E  G ++    +S+G+GQA  A  +I K  +  G W+FL NC L +SWMP L KL+E LQ+  +D   +F+L LS+ PH +FPI ILQ  +K+  E P G+K  + + + L     +TE  ++  ++ ++ +K++F LC F++V+LERR +  LG+++ Y FNDSD E+S   +  +L    E  W+AL  ++  +NYGG +TD+ DRR    LL +Y +E  N   I+
Sbjct: 2904 AQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQSEPTWAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKIGTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQR------SPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKIL-----EAAGKLNMDEYNFFLRGGV----------VLDREGQM----DNPCTQWLTDTSWDNVT--ELDKLPNFHGIVTSFEQYPRDWNQWYTSSEPENTPLPGEWENAC---NELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLA-ENCGMSNRFHALSLGQGQAPIATRMI-KEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQV--EDPHPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLYQL-----ITEQQFSRCHKQDKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLDEYEETPWDALKYLVAGVNYGGHVTDDFDRR----LLHSYINEMFNDQAIQ 3892          

HSP 2 Score: 296.59 bits (758), Expect = 0.000e+0
Identity = 207/781 (26.50%), Postives = 378/781 (48.40%), Query Frame = 1
Query: 6790 TIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIV-SLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHE-HLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGS-ESVSD-PNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            T+Y Y VD+ +  +  W+                   SG   N      +I++ ++D++RY FL   L+    PVLL G  G GK                  TS +  +L K                                       ++  TY    I  ++QTS N   + + SK+ KR + +  P   K+M+ F+DD N+P  D FGSQ  LE++R WI+   ++D       YV D  L+ +  P    +  IS+RL   F ++ +  P  +  +RIF   I +    +DF  ++K     +    I +Y   + +   +P + HY+FNLR + KI  GLL A+  L   K  + +   HE  R   DRLI + DRE F  +LSD+L     L + +    K   +FG F           +Y+ + D + + R+ E  +  ++ E  +   N + F+ +I+H+ R +R++ Q  G+ML++G+ G G+ S  +++S II   +F++ +T  Y    FR D+K++ +++ + N+P V   +D   L  + F++D+ N+++SG +P+LY+ DE E + + L   D+ + E V D P  ++   IE+++  LH+ + +SP    +R+R+R  P+ +NC TIDW+ +W  ++L+ VA          +   IE   E+T  N+ +  + ++R+ +++  +  +EL+R  +++  +++E ++ +  +L     +     S+L  GL+++ +TR+ +  M  +L + T K+ E  ++ E
Sbjct: 2174 TVYEYHVDIKQKTWASWED---------------KLRSGWRYNPSVPFYKIMIPTVDTVRYDFLVYNLIQAKRPVLLTGPVGTGK------------------TSVAQKVLQK---------------------------------------LDPKTYGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDYGFWYDRMKQTVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIFGTMINQKL--QDFEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSDKLGSMFDLTFHNLCPNKQSPIFGNFM------KDDTMYEDLVDFKAIKRYMEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQAL-EEGFLEDVNNILSSGEVPNLYKPDEFEEVRTALS--DIAAKEDVQDTPESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAE--------RYLENIELGDEETKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCE 2863          

HSP 3 Score: 600.512 bits (1547), Expect = 2.131e-175
Identity = 365/1103 (33.09%), Postives = 598/1103 (54.22%), Query Frame = 2
Query: 2222 EFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDE---TEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTK-NKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXY--EGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQK--QFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL-----PLINLSKE 5491
            E  N ++   K L   P+T++E  + L  + ++  ++ +++ +   ++Q F I+  ++V +  E   +   L+      +  ++  +    ++  KF   L    EE +  +         +   D  Q++      +G        +   +   + Y E+  +  S+  S    R+  ++F    A  L +D++ +E+D+     +W    EWE  ++ + V K  E   T++ T  Q + +  + + + E      EI  ++K+ + + K ++P+I  L+N  ++ RHW +I+  +         +FT+ ++I   + Q+ + I EIS  A+ E+++E  ++ +  ++  +   +  + +R  + +   D++   LE++ +T+ST+K S+YV     +V+ WER LS   +V++  +  Q+ W+YLE IF   DI++QLP E   F +V+  W+ +MQ+  + P  L+     G+L+ L   N+KLE+IQKSL+ YLE KR IFPR +FLSND+LLEIL ++++PE VQ HL K F N+  L++            V  Y  EGE      ++ + G  E WL  +E+ +   +K  +K C + +++   +   W     GQ  + S+Q++++ + ++AL  +   E      + S+    +  L   +  +   +   +R  + A++ I+VH RD  + L++        FEW  Q+R  W++    C V Q ++ F+YG EYLG S RLVITPLTDRCYMT+T AL+ + GG  KGPAGTGKTET+KDL K +G   +V NCS+ LD  ++ ++ SG+ Q G+W CFDEFNR+N+EVLSV+A QI SI +A  +   RF+FE +EI L   CGIFITMNP YAGR ELPDNL  +FRP++M VPD  +I E+ILF+EGF   KVL+ K+  LY L   QLS Q HYDFGLR++ SVL   G  +     +S       +EE  IL+ ++K  N  +L T D PLF  I+ DLF   +  + +   L  +I    K+ GY+  P+ I KI  L     SRH  +++G + SGK+V   +LQ A+T L     P  N+ +E
Sbjct:  869 ELNNFLKGNAKKLSAPPETLDELGDSLSLLEQLQNDLPNIEAKFAPLHQQFAILEKYEVAIPEEVQGMLDALSGEWLLFQQCLIDSDVMLKKSKEKFKTGLIHSSEEFKKTV---------NGLFDDFQSKGPFSSSIG--------VKEALEQVTQYHEQVVNLKSQETS---LRRGLNIFKIEQA--LSKDLQNLEKDLEHLEQVWTVTKEWEELWDTWKVGKFVELVTTDMETQAQLLFKRLNKI-IREVKDKNWEICDSIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFTLEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKDRGHFRLKQTDEVFQQLEDNQVTLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFDKTEAVGMYSAEGEYVEFGHSVLLEGPVEAWLCDVERSMRWTLKELLKHCRLGLKKSLSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSK--ERGDKKALKSLKKKQVSMLNKFSEMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVFEGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMS-------DEE--ILLLSMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDGEPGFNVVRE 1937          

HSP 4 Score: 37.7354 bits (86), Expect = 2.131e-175
Identity = 22/76 (28.95%), Postives = 38/76 (50.00%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +NPKA+S+  LYG  + N+ EW +G++  V ++  S     +  +      D    E+ N     N + TL+N E+
Sbjct: 1940 INPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGER 2015          

HSP 5 Score: 112.464 bits (280), Expect = 4.398e-24
Identity = 54/140 (38.57%), Postives = 91/140 (65.00%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEAL 6381
            +WI+ D P+++ W+E++N+V+DD+++L L NGERI++P  +  LFEV+DL  +SPATVSRC M+Y   + + W+  V SW+  ++ K       E L +LFEK +   ++F     K + +P TS+ + + +LC + +AL
Sbjct: 1982 KWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRVDK----QSVEHLQRLFEKFVPKVLEFRKHHCK-EPVP-TSELNSVVSLCVLFDAL 2115          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Nematostella
Match: EDO31800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW2])

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 418/1407 (29.71%), Postives = 684/1407 (48.61%), Query Frame = 3
Query: 9201 ETEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQ----PDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVK-YLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQI--RKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFI-HSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSK--HHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIG--KSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLPRNLLGDLEEYFAQSELFDVTKTYSTSEIIP 13382
            ET A+   + + ++DL    P LEA+ KALDSL+K+ ISE+RV+  PP LV  VM ++C+LL V P W +AK +LGDA FL+KL++Y+KD I     + L++Y     F  E V  VS ACRS+  WV A++ Y  V   + PKR  +  A+  LE+    L  KQ  L +VE  I  L   Y +S+ E++ L + +  T  RL RA+ L  A+  E+ RW  ++   +    N++G+   +AA   + G +T +YR      WI+      +P+ D++  +      Y I  W+++GLPRDS  A    I++       L     +  R+++T   K+  ++I     +++  LE  IR+G  + LE++   +DP L P+L K+ F +G   +I+LG+++++Y  +F+ Y+ + L+NP  +  V   VTIINFTV   GLE+QLLS +V  E+P++E++RN+ +    +D   L+ +ED+ L LL  S   I++D  L   L +SK+T+  I  RL+E  + E+++ +AR+ Y P+A RG+ +YFV+A L  V+ MYQYSL +F+ LF  C++   K      +   + +L+ ++++ T   Y   + GLF   + +F+FML   IMR         I  ++W  F++                 TG + K+    PD + WLT  +WN C  LE ++   F G    F   P T    NL ++         K  S +  L SFE+LI I      K++ +A  +V   LG+ F      +L  LF      IP++FIL   SDP+N  ++   ++   T  +  +S+G+GQ   AE LI       G W+FLQNC L  SWM +++  I++L  ++ +   +F+L LS+ P   FP+ +LQNS+K+  E P G++    ++F     G +    + +    +  RK++F +C F+A++ ER+ +G LG+++ Y+FNDSD   +++ +  FL +  + W+AL  + G I YGGR+TD  D+RCL  +L  + S       +E   K  +  I     F+S++ +  + ++  +     + G+ +NA I     ++   I  ++  Q +       KT D          I  ++  S+   ++D        D E+      + D        R+N  +               VL QE+ ++N LL  I   +  L   + G   ++  L+ V      N VP  W   S    K L  W  ++ +R  F+  W                        +H P                                 +W+ GFF PQ  +T  +QN AR  +  ID LT S  VLP        +Y  Q E+ + T      + +P
Sbjct: 2517 ETSAI---AAEAQKDLDEALPALEAAQKALDSLDKSDISELRVFTKPPELVMTVMESICILLGVKPDWPSAKTMLGDAGFLKKLMDYDKDKIPDSTLRKLKKYIDNPKFVVEVVEKVSKACRSMVMWVRAMDLYARVYRTVEPKRAKLAAAQAELEVVMSTLREKQASLAEVESKIAELQAAYDHSIAEKETLTKNIAQTAARLKRASKLTTALGDEQGRWTENVAAFELEIGNVVGNVFVAAACVAYFGAFTSLYRHELINSWIEQCKELGVPVSDDFSLINVLADPYEIRQWNSDGLPRDSLKAIEDRILKLLNMRSTLF---LKANRWIRTKEAKNGLKIIKLTDNNFLRTLENCIRIGMPVLLEEVGESLDPALEPILLKQTFVQGGRLLIRLGDSDIDYDKNFRFYMTTKLANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLERPDLEDQRNQLIVRINSDKNQLKAIEDRILKLLFHSEGNILDDEVLINTLNESKVTSGVISTRLKEAERTEEKITIAREKYRPVATRGSVMYFVVASLAEVDPMYQYSLKYFKQLFNACIESSEK------TDDLDRRLEILLNNCTESVYVNVARGLFEKDKLVFSFMLCGDIMR-----QQEIITDEEWNFFLR----------------GTGGLDKERPAKPD-VPWLTDFMWNTCCDLE-DVLHSFKGFKGDFVKAPITISMGNLQQSEVGDDDQAEKPRSWQDRLTSFERLIFIKAFKEEKVVFAAVDFVCENLGKTFVESPSIDLPVLFENVSNMIPLIFILSTGSDPMNAFLRFARDM-NYTERIQAISLGQGQGPVAEKLIANAS-KNGDWVFLQNCHLAASWMLAMETTIKDLTNNEAEVHEDFRLFLSSMPTKAFPVTVLQNSVKVTNEPPKGLRANTKRAF-----GELMADPFESHVLGVRWRKLVFGICFFHAIIQERKKFGPLGWNIKYEFNDSDRMCALENLKMFLVDENIPWDALTFITGQITYGGRVTDEWDQRCLTTILGRFFSPKI----LEDNYKFSESGIYFPPGFESLHDYREYVDNLPLTDEPEVFGMHENANIAFQTQETHQLIYTVLEVQPRLASSGGGKTNDE---------IVYELADSILGKLMDVL------DMEKAEKSLFETDAKG-----RYNSLT--------------TVLGQEVDRFNNLLKVIKNSLTQLQKAIKGLVVMSLELDKVYTSFLNNQVPDMWANSSYPSLKPLGSWVKDLVLRTMFVEQWI-----------------------IHGPPKS------------------------------FWISGFFFPQGFLTGTLQNHARKYNLPIDQLTFSYNVLP--------QYRNQEEVAEETAKLEYGQALP 3782          

HSP 2 Score: 474.167 bits (1219), Expect = 0.000e+0
Identity = 297/1057 (28.10%), Postives = 532/1057 (50.33%), Query Frame = 1
Query: 5962 QWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSK-CSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSES---VSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            +WIV DGP+++ W+EN+NTVLDD+++LCLAN ERI +  ++  LFEV DL  +SPATVSRC M+Y+    + W+  V+SWM+    K   E  +E+L+ LF+  +  G+KF SK C++     + SK +   T+CC+ ++   +  A GG D  +LD                                          P +L+ L+   ++F + WS G          +ET                  + FD F + LF +  +  +R+P  +  +YSY+VD D    +PW+ ++P+ K          +SS +        + ++ ++D++R+ FL   L+  N  VL  G +G+GKS++   IL                                                DDI +KS         Y+   + F++QTS  +  + + +K+ K+ ++I+G P  K+M++F+DDLN+P +D +GSQ  +E++RQ+ +  GF+D   L W  + D ++  AC+P    ++P++ R  +HF +  +P  + +    IF+  +  +    DF  E++    +IV   + +Y +       +P KSHY+FNLR L K I G+L AD  ++ +K  + +   HE  R   DRLI+  D+  F  I+S+  H   +   + ++     I+FG F  + G+  + K+Y+++TD++K+       ++ ++         +FF  +I+H+ R  R++ Q  G+ L++GV G GK S  +++  +     F++ +T  Y+  +FR D+KK+   + ++    V   +D   +V + F++D+ N++NSG +P+L+E +E E +L+  +P  L  E+     D + V+   I +++  LH+ + +SP    +R+R R  PSL+NCCTIDW+ +W  E+L+SV+        +NF  E++   E     + E  + I+ +   + ++F  ELRR Y+ +   ++E +  +  +L     +    R R+  GL +L+ET  L+  M+ +L+ L P++K+KS + E
Sbjct: 1588 KWIVCDGPVDALWIENMNTVLDDNKMLCLANSERIKLNNTIHMLFEVQDLAVASPATVSRCGMVYMDPNELGWRPFVRSWMQKHSDK-MKEETREYLWNLFDHYVDAGLKFASKKCTQAMQQVDISKVT---TMCCLFDSF--FFPAKGGPD-FNLD------------------------------------------PTKLHPLICTAFLFVFLWSIGGNL-------VET----------------CNESFDTFTRDLFADTHD--VRIP-GSGDLYSYYVDFDTRRMEPWEKIIPAFK----------YSSEVP-----YFDLLVPTVDTVRFGFLMDKLLSVNKSVLYTGTTGVGKSVIAKAIL------------------------------------------------DDISQKS--------NYMAIMMNFSAQTSSQRTQEMIETKLEKKRKNILGAPAGKRMVIFVDDLNMPKLDTYGSQPPIELLRQYQDFRGFYDREKLFWKEIHDMTICSACAPPGGGRNPVTPRFLRHFSMFCIPSSAEHTLGHIFKSIVSGFLL--DFPAEVRECADAIVGASVEIYARMSTDLLPTPAKSHYVFNLRDLSKCIQGVLQADPGVIRDKGQIFRLFCHEASRVFQDRLINKEDKTFFNTIMSEMAHKHFQQARSPEKFESNPILFGDFMKM-GADPADKLYEELTDLKKVKNLLTDYLDDYNMNSSKEMKLVFFMDAIEHISRIARMVRQPRGNALLVGVGGTGKQSLTRLACHMSAYKCFQIELTRGYDYSAFREDLKKLYDVAGVKGENTVFLFTDT-QIVVEEFLEDINNILNSGEVPNLFEPEEYEAVLNGTRP--LAKEAGIPEGDRDGVFDYFISRVRNNLHIVLCMSPVGDAFRTRCRMFPSLVNCCTIDWFTEWPREALLSVS--------SNFFEEVDLGAEGVKDKVAEMCVEIHTSVSTMADRFYAELRRRYYTTPTSYLELITLYLSMLDEKRKQLIGARDRVKNGLKKLLETNDLVDTMQVELVALEPQLKQKSLDVE 2484          

HSP 3 Score: 425.246 bits (1092), Expect = 1.071e-122
Identity = 212/426 (49.77%), Postives = 281/426 (65.96%), Query Frame = 2
Query: 4193 NLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLEND-KLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            NL  LA  V   +    R  L A+I I VH RD    ++   V SE +FEW KQ+RY W+     C V   +S + YG EYLG S RLVITPLTDRCY+ + GAL  +LGG   GPAGTGKTET KDL+K + +QCVVFNCS+ LD   + +  SG+ Q G+WCCFDEFNR+++EVLSVIA Q+ +I+ AK ++  RF+FE +EIKL P C  FITMNP YAGR ELPDNL  LFRP+AMMVP+Y LI EVIL+SEGF ++K L+ K+T +YRLC++QLS Q HYDFG+R++KSVL++ G L+     + E V         +LI+A++ SN P+ +  D  LF++I+ DLF    E+ ++D   L+ +IE      G +  P  ++K+  L   +  RHGVML+GP+ SGKT    +LQ  LT L
Sbjct: 1113 NLNNLAALVRGVLPKLTRNILGALITIDVHARDIVTGMVNAKVDSENNFEWIKQLRYYWDPDLDNCVVRMSNSMYIYGYEYLGASARLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSEGLDFKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLLTIRNAKVAKASRFMFEGREIKLVPSCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKNLARKMTQMYRLCSEQLSQQDHYDFGMRAVKSVLVMAGALKRSNPDLEEDV---------VLIRALRDSNLPKFLAADAILFRAILTDLFPG-KEIPDHDYGKLQSTIEDCMVAKGLQAIPALVKKVIQLYETMIVRHGVMLVGPTGSGKTTNYMMLQDTLTSL 1528          

HSP 4 Score: 37.7354 bits (86), Expect = 1.071e-122
Identity = 19/81 (23.46%), Postives = 41/81 (50.62%), Query Frame = 1
Query: 5560 IDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSN----QNDLQTLLNNEQ 5790
            +   ++NPK++++  LYG VN  ++EW +G++ +  ++ +  +  +   +      D    EN N     N +  L N+E+
Sbjct: 1541 VQTHILNPKSVTMGELYGEVNKLTMEWRDGLMALKVRQCVQETTPDHKWIVCDGPVDALWIENMNTVLDDNKMLCLANSER 1621          

HSP 5 Score: 343.199 bits (879), Expect = 7.810e-94
Identity = 212/671 (31.59%), Postives = 361/671 (53.80%), Query Frame = 2
Query: 1835 SPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILN-FCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSN-RDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKL 3841
             PS+  M + D      +++I    +N+      Y      +  FY +    + E I E E   D++ F   L +   +       +  K IG I    + L +   P   K + ++N+ L K A    D+ +   + A   L+  P +  ++V+ L F+++I  ++  ++ E+ +I +++ +I N+KVP   E LA+Y+TL   +  ++N +    A++D NI KF   ++K I ++   + E+K+KA++   LD +     I+  L  L+ ++  L +    Y +YQ+ F   ++K                       E++EEV  ++ ++  LW +  EW++  +++     +E    T+   V +   TV  LEK LP N ++P +K  +   +  LPVI  LRNP L+ RHW +I+++        +  T+G L   +  ++ + I E+S  A++E +LE +L KV+D +   EF ++ H + +D +I+ GVDDI   L++S + +STI GS++V  IR +VE+W+R+L   ++ +DEW+ CQ++WLYLE IF   DIQRQLP E ++F  VD  W+ +M++    P  L+  T+ G+L+  Q  N+ L++IQK LE YLE K +IFPR +FLSNDELLEILS+ ++P  VQ HL K F  + KL
Sbjct:  346 GPSLATMFEDDRHLQGVIQSIRDAISNAFDMAWKYANTFEPYRKFYQENESLDLEAIREGEH--DVEFFATSLEKYNSEHEQAVGIMAKKPIGMILADLRKLKEVLIPSPLKCLEVINDILPKLAKKRTDDLMKFCQDAQFELEVVPSSTNDYVKSLTFLDEIQEKIDDIEAESMTIKELYDLIDNYKVPTPPEDLAVYQTLRPTVTAVRNVIDKSLAERDSNIDKFCTCMDKDIVQLGKDVKEVKQKAQDPKILDSSSKSESIIAYLKELQGKMDRLHDTAFTYKSYQKNFKVEVTKF----------------------EELEEVHAELRLKQSLWNSLVEWDQSQQDWTETLFEELNPETLSNNVMKYAKTVMQLEKGLPPNSVVPILKEKLENMRHKLPVITNLRNPALKQRHWDQIQQIFNYHFKDEEPLTLGLLDKIEAFEHTESIEEVSGQASSEASLEGILKKVEDAWKSTEFIVLPHRDSKDVFILGGVDDIQAVLDDSMINVSTIAGSRHVGPIRPRVEEWQRQLYLFSETMDEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMTVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKCVIFPRFYFLSNDELLEILSQTRNPHAVQPHLQKCFDAIAKL 992          

HSP 6 Score: 78.1814 bits (191), Expect = 1.194e-13
Identity = 42/105 (40.00%), Postives = 61/105 (58.10%), Query Frame = 2
Query: 13397 PDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQ 13711
            PD GVLV GLYLD A W+ ++  L           LPI+H+     + N   D   ++ PLY+T +R G+LS++G S+NF+  + L +D   +FWI +GTA L Q
Sbjct: 3790 PDDGVLVHGLYLDGARWDDDSMMLGDARYGEMNPPLPILHMEP---QMNLVPDPSQYMSPLYKTSARAGVLSTTGHSTNFVVSVYLPTDLPQAFWIEKGTALLCQ 3891          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Nematostella
Match: EDO45806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR2])

HSP 1 Score: 525.013 bits (1351), Expect = 0.000e+0
Identity = 331/1046 (31.64%), Postives = 558/1046 (53.35%), Query Frame = 3
Query: 9198 METEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPS---------------WANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQ-YTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNK-CKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVT-ETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNY 12275
            M  +A+++   +C++DL    P+LE+++ AL++L  A I+ V+  ++PP  V++VM A+C+L  V P                WA +K +LGD  FLQ L  Y+KD I     K ++Q YT   +F+P+ +   S A   +C+WV+A++ Y   +++     K+++    ++    Q L  K+  LK+V+D +  L  KY+ +VK++  L+++V L +++L RA  LI  +  EK RW            N+IG  + S+    + G +T  +R+   + +     +    +E     V        I +W   GLP DS   EN  II  + +WPL+IDPQ Q  ++++    K++  VI     DY+  LE  I+ G  + LE++  ++DP+L PLL K+ F++G    IK+G++ +EYS  F+ Y+ + L NP  +      VT++NF +   GLE+QLL ++V++E+PE+E E+N  +   A +   L+ +EDK L +L  S   I+ D      L  SK+ A +I ++     + E+++   R  Y P+A+  A ++F +ADL  +  MYQYSL WF NLF   +D  N E  E +    + +L+ + +  TY  Y      LF   + LF+F+L  +I+ +     D  + + +W   +    T  V  +N  +  ++           WL    W++ C+  ++    KF G    F  T E W K   S  P  M      E+  K+ + F+K++L+  L   K+    + +V + LG+K+      +L   F +S++  P++F+L   SDP   ++K   +   + S L  +S+G+GQ   A  +I+K  +  G W+ LQNC L  SWMP+L+KL E L       D  F+L L+++P  +FP+ +LQN +K+  E P GI+  +++S+  D   +    T    +S Q +KM+F LC F+A+V ERR +G LG+++PY+FN++DL IS++Q+  F+   +EVQ+ AL  + G  NYGGR+TD+ DRR L+ +L  +
Sbjct: 2577 MAAKAIKD---ECDKDLGEAIPILESALAALNTLTPADITVVKTMKSPPAGVKLVMEAICILKGVKPDRIPDPSGSGKKIEDFWAPSKRILGDMKFLQGLQTYDKDNIPAPAIKQIRQKYTSNPEFDPDKIKVASTAAEGLCRWVIAMDSYEKYDHLTT-TFKSIDLLLMSVLCDFQGLNKKRAALKEVQDKLARLQEKYEANVKKKSDLEKQVDLCSKKLDRAEKLIGGLGGEKTRWTEVANALGVRYTNLIGDVLVSSGVVAYLGAFTAAFRQGTCRAY----SSSGRLVEYGRVLVALIAQPVKIRDWTIFGLPTDSFSIENGIIINNANRWPLMIDPQGQANKWIKNMEKKNNLHVIKLTDADYVRTLENCIQFGTPVLLENVGEELDPLLEPLLLKQTFKQGGSICIKVGDSVIEYSKDFRFYITTKLRNPHYLPETAVKVTLLNFMITPEGLEDQLLGIVVARERPELEEEKNALILQSAENKRQLKEIEDKILEVLSSSEGNILEDETAINVLSSSKVLANEISEKQAIAEETEEKIDKTRMGYTPIAVHSAILFFSIADLANIEPMYQYSLTWFINLFIMSID--NSEKSEEL----DKRLENLRNHFTYSLYCNVCRSLFEKDKLLFSFLLCVNILMH-----DGEVCRDEWRFLL----TGGVGLDNPHSNPAS-----------WLPSRSWDEICRLDDM---SKFKGFRQKFPRTLEGWKKIYDSNEPQTMPLPG--EWEEKF-DFFQKMVLLRCLRPDKITPCVQNFVTVKLGKKYIEPPPFDLGKAFADSNSCAPLIFVLSPGSDPTAALLKFADDQGFSGSKLSSLSLGQGQGPIALRMIEKA-VKDGTWVVLQNCHLATSWMPTLEKLCEELNPDTTHPD--FRLWLTSYPSPNFPVTVLQNGVKMTNEPPKGIRANIIRSYLGDPISDPEFFTGTGQKSPQFKKMLFGLCFFHALVQERRQFGPLGWNIPYEFNETDLRISVQQLHMFMNKYDEVQYEALKYLTGECNYGGRVTDDRDRRTLLTILNKF 3579          

HSP 2 Score: 335.88 bits (860), Expect = 0.000e+0
Identity = 272/1110 (24.50%), Postives = 509/1110 (45.86%), Query Frame = 1
Query: 5896 DSVKNQFTKDAKIVSHRS-----KKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGA--------AFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNK-TIYSY-FVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIV-SLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNA----FQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIING-LLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSD--ELHMSLKLNWAHDEL-----GKC---DIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNL----KPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            D V ++++     V++R+       + +W++ DGP+++ W+EN+NTVLDD++ LCL +GE I + ++   +FE  DL+ +SPATVSRC MIY+    + WK  + SW+ + LPK+  E  KE +  LF++  +  ++F+ K                                 GGF  LS         + +  VN S     DT     + + + +  F + N +E+   L  +Y+F+  WS GA        +F +     +E  +   S  KS + I E  D                    P  +K T+Y Y F+    G    W++    IK+       ++F            NEII+ ++D++RY++L   L+ +  P L  G +G                  G S   ++ +L K+                                         +TY    I F++QT+  +    + SK+ KR + + GPP  KK ++F+DDLN+P  + +G+Q  +E++RQW++   ++D       ++ D  ++ A  P    ++PI+ R  +HF  +++ +         F RI    +      + FS +       +V+  + +Y   I     +P KSHY+FNLR   ++I G LL+A D+ +   + + +  +HE+ R  +DRL+   DR+  +  L +  + H++++ +     L     GK    D+    F     + +  K Y ++ D++KL    E+ ++ F++        + F+ +I+H+ R  R++ Q  GH L++GV G G+ S  ++++ +   D+F++ +   Y +  +R DIK ++ K+       V   +D   +  +SF++D+ NL+N+G +P+L+  DE + I   +    +  D   ++   P  ++   IE+++  LH+ + +SP    +R+RLR  PSL+NCCTIDW+  W  ++L  VA            +E    + D      E     + +  ++  ++Q EL+R  +++   ++E ++ F  +L     +    + R   GL +L   +S +  M+E+L  L P++ +  +E +
Sbjct: 1579 DPVSHEWSDGVLAVNYRAFASSTTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLNSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWKPLLTSWL-HTLPKTLNEENKELIKDLFDRMEEALLQFIRK---------------------------------GGFKELS-------PTNDTNLVN-SHMNMMDT----LMDEFHDEQRFKELNEREVAAWLECIYLFSCVWSLGATLDGEGRKSFDKLLREIVEGPLSLES--KSKYHILEIVDP------------PPRPFLCPFPSKATVYDYRFIKEGMG---KWELWTEEIKDAPPIPKDMAF------------NEIIIPTVDTVRYTYLMEQLVTHGKPSLFVGPTG-----------------TGKSVYITNFLLKKL----------------------------------------EETYKPLLINFSAQTTAKQTQDIIMSKLDKRRKGVYGPPLGKKTVVFVDDLNMPAREVYGAQPPIELLRQWLDHWQWYDLKDTSPIHLVDIQILAAMGPPGGGRNPITPRFLRHFNTISITKFDDGTMVKIFSRIMNWHLTTNASCRGFSKDFGPIGDMLVNGTLEIYRNAIVNLLPTPAKSHYLFNLRDFARVIQGTLLSAPDR-ITEHDMLKRLWSHEVFRVFYDRLVDGGDRDWLYNNLREVCKSHLNVEFDTLFQRLDFDGDGKVKEDDLRSLVFCDFTDAKADPKPYVEVEDLDKLRGVVENYLDEFNNMSKKPMTLVLFRFAIEHVSRISRVIKQPRGHCLLVGVGGSGRQSLTRLAAHMADFDLFQVEIGKGYTSTEWREDIKAILRKTAEGETNGVFLFTDT-QIKEESFLEDINNLLNAGEVPNLFPLDEKQEICEKMRQFDRQRDKSKQTDGSPVALFNYFIERVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPADALQVVAQ---------RFLEECEIEADVKEGCVEMCKSFHTSTRDLSLRYQSELKRHNYVTPTSYLELISTFKALLNKKQQEVVKAKRRYEVGLEKLNSAQSQVASMQEELEALQPQLIQAGKEVD 2545          

HSP 3 Score: 580.482 bits (1495), Expect = 1.052e-169
Identity = 330/881 (37.46%), Postives = 487/881 (55.28%), Query Frame = 2
Query: 2840 LWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQ----NEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNI---RVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALT 5461
            L+ET  E++  Y+ ++       + + V         ++  LEK L +      I   +K  V E K  LP++  + NP L+ RHW ++ +++G  L  +++  + ++    +  Y      ISE A+ E +LE  + K+   +  +EF ++ +    T I++ +DDI   L++  +   T++GS ++     ++++WE KL  T +++DEW+  Q  WLYLE IF + DI  Q+P EGR F  VD  WR  M+       VL     + +L  L+  N  LE I K L +YLE KR+ FPR FFLSNDELLEILS  +DP  VQ HL K F  +  LQ   +   +H  +     EGE   L   I   + RG  E+WL  L++ +   V++ I   +    +++ V W  +  GQ++L  TQ  ++  V +A++G        L    S I D++         V   +    R  L A++V+ VH RD    L E  + SE DFEW  Q+RY + E         + ++  YG EYLG S RLVITPLTDRCY T+ GAL  +LGG  +GPAGTGKTET KDL+K + +QCVVFNCSD LD   + K   G+   G+W CFDEFNR++LEVLSV+A QI +I+    S  +  +FE  EIKL+P C +FITMNP YAGR ELPDNL  LFR VAMMVP+Y +I E+ L+S GF+ A+ L+ KI   Y LC++QLS Q HYD+G+R++KSVL   G+L+L+          + NE++ +++++I   N P+ +  DLPLF  I  DLF        +  +L  +     K +  ++  + + KI  +   +  RHG M++G    GKT    +L KAL+
Sbjct:  688 LYETTVEFQNKYKEWMEGPWGTIDPDKVESETGNYWRSLYKLEKQLTEVPLAQRIAGRMKTKVEEFKEYLPLVQVVFNPGLRDRHWEQMSEILGFPLKPDEDMNLAKMAEMNLEPYLAQFETISEAASKEFSLEKAMEKMVGEWDAVEFVMIPYRETGTHILSSIDDIQTLLDDQIVKTQTMRGSPFIKPFENEIKEWEGKLILTQEIIDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKNWRETMKVAVLDKHVLTVIGIEKMLGKLKKSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLQFTDTLDITHMKSS----EGELVLLKDVISTSKARGQVEKWLLELQEDMVASVRKVIMEAMEAYLKEERVKWVRDWPGQTVLCVTQYYWTAEVHKAIRGGQKQLDQYLQQNNSQIDDIV-------TLVRGKLSKQNRATLGALVVLDVHARDVLTKLCELGISSEDDFEWLAQLRYYFEE--ENVMTRMISAHLAYGYEYLGNSGRLVITPLTDRCYRTLFGALQLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQMGIKSGGDTLLFEGTEIKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPNYAMIAEISLYSYGFVNARSLAVKIVTTYTLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYP--------DENEDI-LMLRSINDVNLPKFLAHDLPLFAGITSDLFPGVQLPKPDYTVLTAAAAEVCKSMNLQMVDEFLTKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAKALS 1546          

HSP 4 Score: 38.891 bits (89), Expect = 1.052e-169
Identity = 19/66 (28.79%), Postives = 35/66 (53.03%), Query Frame = 1
Query: 5557 KIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSN 5754
            K+ + V+NPK++++  LYG  +P S EW +G++ +  +   S +  ++  L      D    EN N
Sbjct: 1558 KVQIVVINPKSITMGQLYGQFDPVSHEWSDGVLAVNYRAFASSTTPDRKWLIFDGPVDAVWIENMN 1623          

HSP 5 Score: 71.2478 bits (173), Expect = 1.078e-16
Identity = 38/121 (31.40%), Postives = 67/121 (55.37%), Query Frame = 2
Query: 13361 FNIRDNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCEID 13723
            F + ++ K    P+ GV V GL+++ A W+ +  ++  +     +  LP++ L    +E  KK   Y  + P+Y+T  R G LS++G S+NF+  + L SD+    W++RG A L  C++D
Sbjct: 3824 FEVLEDKKYETPPEDGVYVNGLFMEGARWDRDTKAIGESQAKVLFDSLPVMWLCPCKTEDIKKRPHY--VTPVYKTSERRGTLSTTGHSTNFVMEMRLPSDQPQEHWVMRGVALL--CQLD 3940          

HSP 6 Score: 36.5798 bits (83), Expect = 1.078e-16
Identity = 17/38 (44.74%), Postives = 22/38 (57.89%), Query Frame = 3
Query: 13176 YWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVL 13289
            +W+ GFF  Q+ +T   QN AR     ID+LT   EVL
Sbjct: 3790 FWISGFFFTQAFLTGSKQNFARKYTIPIDLLTFDFEVL 3827          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 404/1393 (29.00%), Postives = 676/1393 (48.53%), Query Frame = 3
Query: 9198 METEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKAS-ISEVRVYRNPPRLVEIVMNAVCVLLSVTPS---------------WANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQ-QYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKD-SFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLA--RKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIM-RYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNK-CKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQ---IRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTN-NEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIG--KSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLP 13292
            M+    +    +CE DL    P LEA++ ALD+L + S IS V+  +NPP  V++VM AVCV+ +V P                W  +K LLGD NFL+ L  Y+KD I   + + ++ ++    DF+P  V   S A   +C+W+ A+E Y  V  ++ PK+  + EA+++L  +K  L+ K+ +LK+VED +  L   ++   +E+ +L+ +V     +L RA  LI  +  EK  W  +  D      N+ G  + SA    + GP+T  +R+   K W  +  +K+IP  D++   +   +   I  W+  GLP DS   +N  I+  S++ PL+IDPQ Q  ++++   KD +  VI     DY+  LE  I+ G  + LE++  ++DP L PLL K+ F++G +  IKLGE  +EYS  F+ Y+ + L NP  +  V   V+++NF +   GLE+QLL ++V+KE PE+E ER   +   AN+   L+ +ED  L  LQ S   I+ D    Q L+ +KI + +I K+ +  I  + +L++A  R+ Y  +A   + ++F +ADL  ++ MYQYSL WF NL+   + +I  ++ +        +L+ + D  TY  Y      LF   + LF+F+L  +++ R  +E SD           +    T  +  +N          +  PD   WL  + W++ C+  E+     F GL  +F   PE +     S  P    S +      + L   +K+I+   L    ++ +   +V   LG+KF      +L   F +S++ IP+VF+L   +DP+  ++K   + + + S    +S+G+GQ   A  +I  T +  G W+ LQNC L +SWM +L+K+ E+  ++    D  F+L L+++P   FP+GILQN +K+  E P G++  LL+S+  D   +     +N   ++     K++F LC F+A+V ER+ +G LG+++PY FN+SDL IS++Q+  F+   ++V + A+  + G  NYGGR+TD+ DRR LM  L ++  E+           S K      + ++    FI   +  + +   + GL +N +I +   Q+K     +++ Q        ++  ++    L  I+N I                    +Q+ P F +  EA+    L++            ++   + VL QE+++YN L   I   ++ L+  L G   +   LE V   + +  VP  W   S    K L  + ++   R+ F+  W                         +  G  K+                            +WL GFF  Q+ +T VMQN AR     ID+LT   EVLP
Sbjct: 2315 MKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRIPDPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEK-IWSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIVRNSRR-PLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFKQG-VESIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAKE-PELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSIQDIKSKVLKQ-------RLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLARKEIEHSD-----------LMFLLTGGIGLQN---------TVANPDP-SWLQDKSWDEICRASELP---GFQGL-EAFIKNPEDFKLIYDSREP---CSIDLPAPWCEKLTDLQKMIIFRCL-RPDMVPAVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADPM-ALLKFASDKKMDGSRFQSISLGQGQGPIAAKMI-FTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTTCHQD--FRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSYLTDPVSD--PNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYDKVPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFAPPKSSYEDYIQFIE--NLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNT---LYDIANNILT------------------QQLPPTFDR--EAV---LLKYP---------VLYEESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVW-------------------------YENGQPKV----------------------------FWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTFDFEVLP 3570          

HSP 2 Score: 253.447 bits (646), Expect = 0.000e+0
Identity = 174/650 (26.77%), Postives = 325/650 (50.00%), Query Frame = 1
Query: 7225 KSLYVP------METDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSP--NIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILS-----------DELHMSLKLNWAHDELGKCDIMFGKFF--PLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKP-EDLGSESVS-DPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQ---FQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKE 9096
            KS+YV       ++ D Y+   I F++ TS N+    + SKM KR + + GPP  K+ +LF+DDLN+P  ++FG+Q  +E++RQ+++ +G +D        + D   I A  P    ++ ++ R  +H  ++++   S +    IF   +     +  FS E       IV   + VY K +     +P KSHY FNLR   ++I G L      +  K+ + +   HE+ R  HDRL+ D DR   +++++           D++   LK     +E    +++FG +    L+G     ++Y ++  +E      +S +  ++  H N  N + F   ++H+ R  R+L Q  G+ L++GV G G+ S  ++++++    +F+  ++ +Y    +R D+K+++ ++        V+L     + +++F++D+ +++N+G +P+L+  DE + I+  ++P    G +SV   P  ++   + + ++ LHV +  SP    +R RLR  PSLINCCTIDW+  W  E+L  VA+                   +   N  +  I I +T     NQ   FQ EL R  +++   ++E +  F  ++        + + R   GL+QL    S + KMK++L++L PK+++
Sbjct: 1649 KSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLD-HGHYDLKDTSKISLVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSIVAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFNVPFDQVFGQLKQGDKLEEKDMQNLLFGDYMNPDLEGDE---RLYTEVPSIETFAEVVKSCLEEYNQMHKNRMNLVIF-YLLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLTLFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVAN-------------SFLESLEMSENERQEVITICKTFHTSANQLSDFQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQ 2280          

HSP 3 Score: 73.9442 bits (180), Expect = 0.000e+0
Identity = 43/121 (35.54%), Postives = 65/121 (53.72%), Query Frame = 2
Query: 13361 FNIRDNSKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRR--YCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCE 13717
            F +    K+   P+ GV V GL+LD A W+ E     +   H R  +  +PII +     +KN  +    ++CPLY+T  R G LS++G S+NF+  + L + + P  WI RG A LLQ +
Sbjct: 3566 FEVLPIDKSETPPEDGVYVNGLFLDGARWDKEG---VLTEQHPRILFDSMPIIWVKP--EKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHWIKRGVAMLLQLD 3681          

HSP 4 Score: 520.005 bits (1338), Expect = 2.064e-148
Identity = 305/820 (37.20%), Postives = 438/820 (53.41%), Query Frame = 2
Query: 3014 VNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQI--EKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFL 5467
            + + K  +PV+  L NP L+ RHW K+ ++ G  LT N   ++ +L+  K+  + +    IS  A+ E +LE  +  +  V+  + F    H +    I T +DDI + L++  +   T+ GS +V   +++++ WE +L H  + +DEW+  Q  WLYLE IF + DI +Q+P EGRLF  VD  WR +M    +   VL+  +  G+L+ LQ  N+ LEKI K L  YLE KR+ FP   + S  E +E++      E                                                G  E+WL  LE G+   V+  I R     E+     W     GQ +L ++Q+ ++  V +A            L +      L   L  +   V  ++    R  L A++ I VH RD  + L+E  V  E DFEW  Q+RY W   + +  +   D  + Y  EYLG SPRLVITPLTDRCY T+ GA + NLGG  +GPAGTGKTET KDL+K +  QCVVFNCSD LD   + K   G+   G+W CFDEFNR+ LEVLSV+A Q+  I+ A   + E F FE   +KLNP C + ITMNP YAGR ELPDNL  LFR VAMMVP+Y LI E+ L+S GF+ AK LS+KI   YRLC++QLS Q HYD+G+R++K+VL+  G+L+L+          N NE++ +L+++IK  NEP+ ++ D+PLF  I  DLF      + + KL   + E   K   + V P ++  +K+      +  RH  ML+G S +GKT +  +L   L+ +
Sbjct:  567 IQKFKDYIPVVSILCNPGLRGRHWEKMSQIAGFDLTPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTGVSIFTALDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKIMKGLNAYLEKKRLFFP--MYSSEGERVELIQNISTSE----------------------------------------------ANGAVEKWLLQLEDGMISSVRDIIDRSR-AYEKTARNQWVKEWPGQVVLCTSQIFWTLEVHKA------------LGLKKYYQQLQNQLNEIVELVRGELPKQTRTTLGALVTIDVHARDVVKDLIEK-VSDETDFEWLAQLRYYWMNDNVRVHIINCDVKYAY--EYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDFEGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFP--------NENEDI-LLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAAEECCK--IHNVQPTKVFTDKLIQTYEMMIVRH-FMLVGESFAGKTKVLHVLADTLSLM 1310          

HSP 5 Score: 30.0314 bits (66), Expect = 2.064e-148
Identity = 10/33 (30.30%), Postives = 22/33 (66.67%), Query Frame = 1
Query: 5557 KIDVQVVNPKALSINHLYGYVNPNSLEWIEGII 5655
            K+  + +NPK++++  L+G  +  S EW +G++
Sbjct: 1320 KVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVV 1352          

HSP 6 Score: 110.153 bits (274), Expect = 6.116e-23
Identity = 73/219 (33.33%), Postives = 113/219 (51.60%), Query Frame = 1
Query: 5776 LNNEQGQRKERRRS-SLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPES-GKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSL 6426
            L NE+G  +E +     LN + I    +  +F + S +     V N F + A   +   K    W+V DGPI++ W+E++NTVLDD++ LCL +GE I +   +  +FE +DL  +SPATVSRC MIY+    + WK  V SW+ N LP        +  +  LF   I P ++ L +  + +++P T+  S      C L  +IL      G D+ S+
Sbjct: 1309 LMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRK----WVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWI-NTLPDPLQSPDNRSLILDLFHWLIPPSLQMLRRHCR-EVVPTTN--SHTVVALCRLFKMILDEPVKTGPDDESI 1519          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 494.582 bits (1272), Expect = 4.856e-140
Identity = 301/841 (35.79%), Postives = 458/841 (54.46%), Query Frame = 2
Query: 2963 LEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSL-TKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITG--VDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVL-QILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQF--VDWALNNFGQSI-LVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKE-IKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALT 5461
            L ++L + +    +K  ++E     P++  + +  +  RHW +I ++ G +L  +++NF +  ++ +  L+YK+ I +I   A  E  +E  L +V   +    F      NR   ++ G    ++   LE+S M + ++  ++Y    + Q++ W + LS+T+ +++ W+  Q  W+YLE +F   DI +QLP E +LF  +D  W  +M +  E P V++ C     + Q+L     +L+  QKSL  YLE KR++FPR FF+S+  LLEIL +A D   +Q HL  +F N+  +Q                 E E   L R I   G  E WL  L +     +   I++  + ++ + F  +D+ LN+F   + L+  Q+ ++++   AL  T      G+++  +     +  L  L    ++D+ + +R   E +I I VH RD    L    + +  DFEW KQ R+ +NE S +  +   D  F+Y NE+LGC+ RLVITPLTDRCY+T+  AL   +GG   GPAGTGKTETIKD+ + +G+  VVFNCSD++D   + ++  G+ Q GSW CFDEFNR+ L VLSV A QI  +   K  R + F+F + + + +NP  GIF+TMNP YAGR ELP+NL   FR V+MMVPD  +I  V L S GFI    L+ K   LY+LC +QLS Q HYDFGLR+I SVL  +G  +  R   S+T       E  I+ + +K  N  +LI +D  LF S++ DLF   +   E    LE +I+   +E G    P    K+  +    + RHG+M LGPS SGKT    IL KA+T
Sbjct:  953 LPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRILAVSSR--EKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDF-LNSFSAQVGLLGIQMIWTRDSEEAL--TNAHYDRGIMSKTN--QHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAK--RANPSDT-------ESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMT 1777          

HSP 2 Score: 27.335 bits (59), Expect = 4.856e-140
Identity = 18/70 (25.71%), Postives = 38/70 (54.29%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQN---VLNDQLSTDNFEKENSNQNDLQTL 5775
            +NPKA++   ++G ++  + +W +GI   + +K +  + K ++   VL+  +     E  NS  +D +TL
Sbjct: 1788 MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLK-AKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTL 1856          

HSP 3 Score: 456.447 bits (1173), Expect = 1.268e-127
Identity = 340/1296 (26.23%), Postives = 612/1296 (47.22%), Query Frame = 3
Query: 9234 CEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLS--------------VTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYN-NQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFL----TNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGH-LTDFQSINSFI-HSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHH-----EDQKTTDSNSALDML-KVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSIL---REYHKYL 13028
             EE L +  P LE +  AL ++  + I+ VR    PP L+   M+ V +LL               +T SW  +  L+   +FL +L  + KD IN++  + LQ Y    ++N E     S     +  W  A+  + ++N  ++P +  +   +  L ++   LE  Q +L   +  +  +  +Y+ ++ E+  L E  +    ++  A+ LI  +  EK+RW    K+    TK ++G  + + A+ +++GP+   +R +   +W   L  +SIP  +N    E    A T+  W+  GLP D     N  I+ K+ ++PLLIDPQ QGK +++    K+  ++ S   K +   LE ++ +G  + +ED+  ++DPVL  +L K F + G+   +K+G+ E++    FKLY+ + L NP     ++   +II+FTV + GLE+QLL  ++  EK E+E ER   L     +   ++ LED  L  L  +   +V+D  L   L  +K TA ++ ++L+     + Q+  AR+ Y P+A RG+ +YF++ ++ +VN MYQ SL  F  LF   +   +K      S +   +++ II+ +T++ Y+ A+ GL+  H+ LF  +L+  I     +     +  K++ T IK        G +L       +  +   ++ WL L        +E+    +FS + +      + W  W   E P +    N    S + L+ F +L+LI   C  + I  AR Y++  +GEK++  +  ++   + ES+ + P++  L   SDP + ++ L  +L+  T     VSMG+GQ   A  L+Q+T +  G W  LQNC L +++M  L   +    I  +  + +F+L ++T  H +FPI +LQ S+K   E P G+K  L +++     G + + + + + + Q + M++ +   ++ V ERR +G LG+++PY+FN +D   +++ I   L    T   V WN +  +IG I YGGR+TD+ D+R L    + + ++N       MF +      G+ +    S++ ++ +           + GL  NA+I     Q+K  +  I+  Q K       E ++   S  A DML K+  + IP  V             K  +++ PL                              P +  L QEI +   +++ +   +  L   + G   ++E+L   LD +    +P  W        +  W+S+       +GFW   +L   R++  +L
Sbjct: 2772 AEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSK------SSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKI-----DMQGKNVTHKEFLTLIK-------GGASLDLKTCPQKPAEWILDMSWLNL--------VELSKLWQFSEILDQISHHEKLWKSWFDKEAPEEEVLPN----SYQSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETR---YVSMGQGQEVHARKLLQQT-MANGGWALLQNCHLGLNFMDELMDTV----IETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTY-----GGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKN-------MFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEV-------------KRLQKMGPL-----------------------------KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARW--------MKSWASST------LGFWFTELLERNRQFQTWL 3961          

HSP 4 Score: 188.348 bits (477), Expect = 1.546e-46
Identity = 147/538 (27.32%), Postives = 267/538 (49.63%), Query Frame = 1
Query: 7216 IIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFD-NTSLQWTYVTDCSLIVAC--SPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQV-KIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDI--MFGKFF----------PLKGSSSSTKVYQQITDVEKLIRFFESSINTF-----DHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDP---NDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAH 8757
            +I KS     + +  +   + F+S T+     + + S + KR     GPP  KKM + IDD+N+P ++E+G Q T E+VRQ +E  GF++     ++T + D   + A       ++ I +RL + F +     PS+ +  +IF V   G +  Q+ F  E++  +  +V +   ++  T  +   +P K HYIFNLR L +I  G+L  + +++ +   +     HE  R I DR     D E F + L+  +    +L   H ++  C +   F  F           P +      KVY+ I   E L    +  +N F     D    N  + +FF+ ++ H+I+  RI+    G+ L++GV G GK S  +++S I G  IF++ +T  YN  +   D+K +   +  Q +      +D +++  +SF++ + N+++SG + +L+  +E++ ILS+L P  +  E    P    ++Y   + +++  LHV +  SP    +R+R    P+LI+ CT+DW+  W  ++L+ V+H
Sbjct: 2096 VIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQ--QLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESL----KDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTD-NEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPV-MKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSH 2625          

HSP 5 Score: 96.2857 bits (238), Expect = 9.777e-19
Identity = 45/110 (40.91%), Postives = 69/110 (62.73%), Query Frame = 1
Query: 5965 WIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKF 6294
            WIVLDGP+++ W+ENLN+VLDD++ L LANG+RI +  + K +FE  ++ N+SPATVSR  M+++    + W   ++ W+K + P        E L +LF  S     +F
Sbjct: 1831 WIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNE-----AEVLRQLFSSSFSELYRF 1935          

HSP 6 Score: 59.6918 bits (143), Expect = 1.175e-7
Identity = 35/108 (32.41%), Postives = 55/108 (50.93%), Query Frame = 2
Query: 13397 PDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCEI 13720
            P  GV V+GLYL+ A W+  N  L  +     +  +P+I + A   E N  +D   + CP+Y+ P+R  I        N +  + LK+ + P  W+LRG A L  C++
Sbjct: 4018 PAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA---ENNVVKDPRLYSCPIYKKPTRTDI--------NCIASVGLKTTQPPEHWVLRGVALL--CDV 4112          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Medaka
Match: ENSORLT00000009068.2 (pep primary_assembly:ASM223467v1:16:15887645:15901792:-1 gene:ENSORLG00000007223.2 transcript:ENSORLT00000009068.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 474.937 bits (1221), Expect = 5.698e-136
Identity = 293/881 (33.26%), Postives = 471/881 (53.46%), Query Frame = 2
Query: 2798 DVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVD-IQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKL-FANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVI 5434
            D+++  R+I++   LW+    ++     + + K  +  V+ +   V + +  +  L+K     ++   ++  V   ++ L V+  L+N  ++ RHW        +S     + T+GEL++ K+  +++ I ++ E A  EM +E ++T++   +A  E     H      ++   +++   LE+  + + T+  SK+VD+   QV + + +LS    VL  W+  QK W YLE IF + D I + LP + + F EVD E++ LM  +     V++      + + L     KL   +++L DYLE KRI FPR +F+S+  LL+ILS+   P  +   ++ L FA   ++     +   +S       E E  P        G  E WL +LE+ + + V+ Q+   +   E +Q   W L+   Q  L  +Q+ +S ++    +   +  S  L          I  L LL   +  D+    R  +  +  I VH RD   SL+   V +   F+W  Q+R+ W+E    C V   D+ F Y  EYLG +PRLVITPLTD CY+T+T +L+ N+ G   GPAGTGKTET KDL + MG    +FNCS+++D  ++  +  G+ Q G+W CFDEFNR++++VLSV+A Q+ +I+ A  S+ E F+F ++ I L P  GIFITMNP YAGR ELP+NL  LF P AM+VPD  LICE++L +EGF  AK+L+ K T+LY  C + LS Q HYD+GLR++KSVL+L G LR                E  +L+ A++  N  +++T+DLP+F  ++GDLF   +   + D   E++   S  ELG +     I K+  L   +  RH V ++G + +GK+ +
Sbjct:  951 DIKQCRREITILRDLWDKVLFFQERVNTWSIIKWRQINVDQIDAEVRKFD--LQKLDKDARAWDVYTGLELHVRNMQTLLRVVSQLQNLAVRERHW--------ISFNVTDSTTLGELLALKLHMFEEEICKVVEQAVKEMAIEKIVTEIGQTWASKELLYEEHDQNSIPLLKCDEELIEMLEDHQVRLQTVVQSKHVDNFVVQVRELQNQLSVAESVLIIWMEVQKTWAYLESIFKSCDDICQHLPADLQRFQEVDNEFQVLMVNSARTKNVIEATNIPHLFEKLDNLQ-KLALCEQALADYLEAKRIAFPRFYFISSANLLDILSKGSHPRGLFDSMSDLEFAQTEQMLNPKQAVGMYSK------EREYVPFTTECWCYGPVETWLVSLEESMKKSVRDQLFNAVSVYEDRQREQWILDFPAQVALTGSQIWWSNDMELVFRKLEEGFSFALKDYNK--KQQISQLNLLIGMLLGDLSPGDRQKITTVCTIDVHARDIVASLIAQKVTTSQAFQWLSQLRHRWDEQEHHCYVNICDAQFLYSYEYLGNTPRLVITPLTD-CYITLTQSLHLNMSGAPAGPAGTGKTETTKDLGRAMGVMVYIFNCSEQMDYKSIGNIYKGLAQSGAWGCFDEFNRISVDVLSVVAVQVKTIQDAIRSKKE-FLFLDQHITLKPSVGIFITMNPGYAGRAELPENLKALF-PCAMVVPDTQLICEIMLVAEGFCAAKLLARKFTSLYNFCKELLSKQHHYDWGLRAVKSVLVLAGALRRSD---------KKRPEEQVLMHALRDFNMAKIVTEDLPIFLGLLGDLFPGLEVERKRDSEFEKASRQSALELGLQPEDTFILKVMQLEELMAVRHSVFVVGNAGTGKSQV 1800          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 442.58 bits (1137), Expect = 3.292e-127
Identity = 270/818 (33.01%), Postives = 456/818 (55.75%), Query Frame = 2
Query: 3014 VNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKN-KNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTF 5464
            + E + SL +++ L+N  L+  HW+K+ +  G S   N + FT+  L S ++ +Y   I EI   A  E+++E    + K     ++ +L  +  R  +++  VD+I V+L+   M +  + GS++       ++ WE+ L+  ++ ++ W+  Q  W+ LE IF   DI  QLP E +   ++  ++  +M+ T+ +P + KCCT  G L  L    + LE+IQK+L ++L+ KR  FPR F +S+DELL +L    DP  +Q H+ K++ N+  L++   SS    +  +VS EGE     + + +    E W+  + Q +     ++  R + +     +VDW  +     +L + +V ++  V  A+K     +   L      I    + ++ L   +        R  +  ++V  VH RD   + +   +K   DFEW+ Q+R+ W +      V Q ++   YG EY+G + RL ITPLT R Y+T+T AL+  LGG   GPAG GKTET+KDL+K +G  CVV +C++ +D  T+ K++SG+ + G W CFDEFNR+   VLSV+++QI +I+ A  S F+ F FE ++I L+ + GI+ITMNPSY  R ELP+++   FRPV ++ PD   ICE++LFS+GF+ AK L+ K+T LY+    QLS Q HYDFGL S KSVL + G ++ + + +SE V         +L++A++  N P+L+++D+P+F  ++ D+F   D           ++E   ++  Y + PDQ++K+  +   + ++   M++G +  GK+V+ + L +A T 
Sbjct: 1157 LKEFRVSLSLLLDLKNTALR-DHWNKLMERTGKSFDMNLQRFTLETLFSLELHKYANDIDEIVTSALKELSIEMTWKRTK---FNMQPQLKVNQER-VFLLGAVDNILVNLDNDVMKLQCMAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERIQKNLANHLDSKRNEFPRFFLISDDELLNVLGSV-DPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPVPLEARVEDWIMAVLQEM-----KRTSRLITKEAVYHYVDWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIH---RQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQFEGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLELSEDV---------VLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQTL 1951          

HSP 2 Score: 36.5798 bits (83), Expect = 3.292e-127
Identity = 22/76 (28.95%), Postives = 40/76 (52.63%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQ----NDLQTLLNNEQ 5790
            +NPKA S++ LYG  +P + +W +GI   + +++   ++K +  +      D+   EN N     N L TL N ++
Sbjct: 1960 LNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDR 2035          

HSP 3 Score: 395.971 bits (1016), Expect = 2.265e-109
Identity = 283/1003 (28.22%), Postives = 504/1003 (50.25%), Query Frame = 3
Query: 9330 YRNPPRLVEIVMNAVCVLLSVTP-SWANAKLLLGDANFLQKLLNYEKDAINK------KMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYRE-MAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTTFKDS--FRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLA--RKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKY---LNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLT------NNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNY 12275
            +  PP+ V++V   + VL      +W  AK ++ +A FL  L+  + D+I+       K  K+LQ          E +  +S A   I ++V +   Y  +   + PK+  V   +K    SK +LE  +N L  ++    +L  KY+++  E++   +  +L   RL  A  L+  + SE++ W   +++  +  + ++G C+ +AA+ ++ G +   +R  M   KW   +  K IP+   +K   F  +   I +W + GLP D    +N  +  K  ++PL IDPQ+Q   +++   KD+   +V S    D++  LE +I+ G    L+D+   IDP++  +L +        T+I LG+ E+ Y P+FKL+L ++L+NPQ   SV     +IN++  L GLE+QLLS+     +   + +    +   + +   L++L D  L  L  ST  +++++EL Q LEK+K  A +  K+L  ++   K ++ A  R+ Y P+A RGA ++F L+D+ +VN MYQYSL  + +LF   + E           + + +L+ II+++TY  ++     LF  H+ LF+  ++  I     E+++  + QK+    IK          NL      G  +++P   EW+  + W     L     ++FS L +  +     W  W      +D+ +     F ++Y   L++F+KL+L+  L + +L  +   YV + +G      L  N   ++  S A  PIVFI+ + SDP   ++K       + +   ++++G+GQ      L++K  +  G W+ LQNC L++ W+  L+K +E +     + + NF++ ++T+   DFPIGILQ S K+  E P  IK  +  +++        +T+ + Q      +++ L  F+AVV ER  YG  G+S+P +FNDSD   S++ + T+LT      ++ + W +L  +IG + YGGR  D+ DRR L   +  Y
Sbjct: 2875 FAKPPKQVQVVCECILVLRGKKELNWLTAKKMMSEAGFLHSLMQMDCDSISNSHISTIKFLKNLQTSV-------EEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSERE-WTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLEI-SWGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKL--SVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQE------SLAHPNLQQRLENIINTLTYNVHNY----LFGKHKLLFSMNMTVKI-----EQTEGGVPQKELDFLIK----------NLSG---DGTKVQKPH--EWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSW------WDLRAPEQAPFPLQYSESLSAFQKLLLLRCLRADRLHRAMADYVTVTMGNCVHPPL-INFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFA---EKSGTKFTLIAVGQGQEQVVLKLLEKA-VSIGSWLILQNCHLLVKWLKDLEKALEKI----TNPNINFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATYSKIS----QQTLSSCQHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYLTKCHEQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEY 3816          

HSP 4 Score: 189.504 bits (480), Expect = 7.305e-47
Identity = 185/805 (22.98%), Postives = 345/805 (42.86%), Query Frame = 1
Query: 6688 GFSIYEAAD-EFDLFVKSLF------DNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTS-LQWTYVTDCSLIVAC--SPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGL-LNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQIT--DVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQ--NDYVKNNSNRSRLSKGLNQLMETRSLITKM 9057
            G ++ E+   +FD  VKSL       D  +  G        T+Y +  D  +  + PW  LVP   +                N   +  +I+ ++D+ R  ++   ++    PVLL G+ G  K+ +I                                QNLL +                           TD+ I  +I F+S+T+     +++ + + KR +D  GPP  KK+L+F DD+N+P +D+FG+Q  + ++R  ++  G +D    L +  + D   I A   +   ++ +  R    F V  +P P++ +   I+   I    H + F   I+    +I +  + ++   I     +P K HY F+ R L +I  GL L   D   +  E   +   +E +R  HDRL  + D+ +    +   +    + +   + +    I+FG +   +      +VY+ I   DV K I                   F  F+ +++H+ R  RIL    GH L+IG +G    +  K+++    C++F + +   YN ++FR D+K +  K  ++NR  V   +D   +V + F++ + N++ S  +P L+ +DE E+I+  +  E L   + S    V+   + K    LH+ + LS      ++R RN P + N   IDWY+ WS ++L +VA            +E  T  +     + +    ++ +  +   Q  ++ +R  + +S  F++F++++  +L+  N++V        L   LN+L E R  I ++
Sbjct: 2150 GATLVESGRLKFDKLVKSLSCLSTVDDEKAAAGPGEIPYLPTLYDFHFDETQEKWVPWSSLVPEYIH----------------NPAMKFADILPTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAII--------------------------------QNLLKNTS-------------------------TDSSISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKG--HTRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETD--SEAVLADPILFGDYRAAR-EECEQRVYEDIGDYDVSKAI-------------------FQLFEDAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDA-HIVEEGFLEQINNMLIS-MVPTLFADDEKESIIKQINSEALQEGAGSSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFPLMSN-TVIDWYLPWSAQALHAVAQ---------CVLENPTIPKAHFGAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLEEKNEHVLQCKC---LEGSLNRLREAREQIDEL 2842          

HSP 5 Score: 99.3673 bits (246), Expect = 1.302e-19
Identity = 56/167 (33.53%), Postives = 99/167 (59.28%), Query Frame = 1
Query: 5914 FTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFL-YKLFEKSIKP--GMKFLSK-CSKIQIIPNTSKQSQLFTLCCILEALILYLSAN 6402
            F+K  + ++  + K  ++I+ DG ++S W+EN+N+VLDD+++L LANG+RI + +    LFEV DL+++SPATVSRCA++++  + + +    + WMKN+L + F +     +   L  ++I P   +  +S+ C  + ++  +   S     C  LEAL   L A 
Sbjct: 1986 FSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKNRLNRLFEKYVPSCIDVTLNSETIVPRTDVNMVSQLCLMLDVLLESKNSSAEVLECYFLEALYCSLGAT 2152          
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 452.981 bits (1164), Expect = 5.108e-127
Identity = 341/1296 (26.31%), Postives = 612/1296 (47.22%), Query Frame = 3
Query: 9234 CEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLS--------------VTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKKKWIDILGNKSIPIEDNYKFVEFEFSAYTILNWHNNGLPRDSSMAENVAIIEKSKKWPLLIDPQKQGKRFLQTT-FKDSFRVISCKQKDYIVMLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYN-NQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFL----TNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGH-LTDFQSINSFI-HSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHH-----EDQKTTDSNSALDML-KVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSIL---REYHKYL 13028
             EE L +  P LE +  AL ++  + I+ VR    PP L+   M+ V +LL               +T SW  +  L+   +FL +L  + KD IN++  + LQ Y    ++N E     S     +  W  A+  + ++N  ++P +  +   +  L ++   LE  Q +L   +  +  +  +Y+ ++ E+  L E  +    ++  A+ LI  +  EK+RW    K+    TK ++G  + + A+ +++GP+   +R +   +W   L  +SIP  +N    E    A T+  W+  GLP D     N  I+ K+ ++PLLIDPQ QGK +++    K+  ++ S   K +   LE ++ +G  + +ED+  ++DPVL  +L K F + G+   +K+G+ E++    FKLY+ + L NP     ++   +II+FTV + GLE+QLL  ++  EK E+E ER   L     +   ++ LED  L  L  +   +V+D  L   L  +K TA ++ ++L+     + Q+  AR+ Y P+A RG+ +YF++ ++ +VN MYQ SL  F  LF   +   +K      S +   +++ II+ +T++ Y+ A+ GL+  H+ LF  +L+  I     +     +  K++ T IK        G +L       +  +   ++ WL L        +E+    +FS + +      + W  W   E P +    N    S + L+ F +L+LI   C  + I  AR Y++  +GEK++  +  ++   + ES+ + P++  L   SDP + ++ L  +L+  T     VSMG+GQ   A  L+Q+T +  G W  LQNC L +++M  L   +    I  +  + +F+L ++T  H +FPI +LQ S+K   E P G+K  L +++     G + + + + + + Q + M++ +   ++ V ERR +G LG+++PY+FN +D   +++ I   L    T   V WN +  +IG I YGGR+TD+ D+R L    + + ++N       MF +      G+ +    S++ ++ +           + GL  NA+I     Q+K  +  I+  Q K       E ++   S  A DML K+  + IP  V             K  +++ PL                              P +  L QEI +   +++ +   +  L   + G   ++E+L   LD +    +P  W   S       W+S+       +GFW   +L   R++  +L
Sbjct: 1337 AEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSK------SSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKI-----DMQGKNVTHKEFLTLIK-------GGASLDLKTCPQKPAEWILDMSWLNL--------VELSKLWQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPN----SYQSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETR---YVSMGQGQEVHARKLLQQT-MANGGWALLQNCHLGLNFMDELMDTV----IETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTY-----GGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKN-------MFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEV-------------KRLQKMGPL-----------------------------KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKES-------WASST------LGFWFTELLERNRQFQTWL 2527          

HSP 2 Score: 265.774 bits (678), Expect = 2.222e-71
Identity = 151/334 (45.21%), Postives = 199/334 (59.58%), Query Frame = 2
Query: 4463 TPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKE-IKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALT 5461
            T L   CY+T+  AL   +GG   GPAGTGKTETIKD+ + +G+  VVFNCSD++D   + ++  G+ Q GSW CFDEFNR+ L VLSV A QI  +   K  R + F+F + + + +NP  GIF+TMNP YAGR ELP+NL   FR V+MMVPD  +I  V L S GFI    L+ K   LY+LC +QLS Q HYDFGLR+I SVL  +G  +  R   S+T       E  I+ + +K  N  +LI +D  LF S++ DLF   +   E    LE +I+   +E G    P    K+  +    + RHG+M LGPS SGKT    IL KA+T
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAK--RANPSDT-------ESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMT 337          

HSP 3 Score: 27.335 bits (59), Expect = 2.222e-71
Identity = 18/70 (25.71%), Postives = 38/70 (54.29%), Query Frame = 1
Query: 5575 VNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQN---VLNDQLSTDNFEKENSNQNDLQTL 5775
            +NPKA++   ++G ++  + +W +GI   + +K +  + K ++   VL+  +     E  NS  +D +TL
Sbjct:  348 MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLK-AKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTL 416          

HSP 4 Score: 173.711 bits (439), Expect = 3.316e-42
Identity = 160/654 (24.46%), Postives = 306/654 (46.79%), Query Frame = 1
Query: 7216 IIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFD-NTSLQWTYVTDCSLIVAC--SPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQV-KIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLL--NADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDI--MFGKFF----------PLKGSSSSTKVYQQITDVEKLIRFFESSINTF-----DHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDP---NDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEK 9099
            +I KS     + +  +   + F+S T+     + + S + KR     GPP  KKM + IDD+N+P ++E+G Q T E+VRQ +E  GF++     ++T + D   + A       ++ I +RL + F +     PS+ +  +IF V   G +  Q+ F  E++  +  +V +   ++  T  +   +P K HYIFNLR L +I  G+L  N   + ++ +  +  +  HE  R I DR     D E F + L+  +    +L   H ++  C +   F  F           P +      KVY+ I   E L    +  +N F     D    N  + +FF+ ++ H+I+  RI+    G+ L++GV G GK S  +++S I G  IF++ +T           +K +   +  Q +      +D +++  +SF++ + N+++SG + +L+  +E++ ILS+L P  +  E    P    ++Y   + +++  LHV +  SP    +R+R    P+LI+ CT+DW+  W  ++L+ V+H  +     +   ++++     M +  +          E    + +  RR   ++   ++ F+  +  I      +     +R++ GL +L E    +  + ++L     ++KEK
Sbjct:  654 VIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNHSSRNIIFQVLLALW-KHECKRVIADRFTMPDDVEWFDQTLAKLVEQ--QLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESL----KDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTD-NEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPV-MKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDC-------VAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKEL-----EVKEK 1286          

HSP 5 Score: 95.9005 bits (237), Expect = 1.211e-18
Identity = 45/110 (40.91%), Postives = 69/110 (62.73%), Query Frame = 1
Query: 5965 WIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKF 6294
            WIVLDGP+++ W+ENLN+VLDD++ L LANG+RI +  + K +FE  ++ N+SPATVSR  M+++    + W   ++ W+K + P        E L +LF  S     +F
Sbjct:  391 WIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNE-----AEVLRQLFSSSFSELYRF 495          

HSP 6 Score: 59.3066 bits (142), Expect = 1.278e-7
Identity = 38/113 (33.63%), Postives = 58/113 (51.33%), Query Frame = 2
Query: 13397 PDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAV---ISEKNKK--EDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCEI 13720
            P  GV V+GLYL+ A W+  N  L  +     +  +P+I + A     SEK KK  +D   + CP+Y+ P+R  I        N +  + LK+ + P  W+LRG A L  C++
Sbjct: 2584 PAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRTDI--------NCIASVGLKTTQPPEHWVLRGVALL--CDV 2686          
BLAST of dynein heavy chain 6, axonemal vs. Planmine SMEST
Match: SMESG000004475.1 (SMESG000004475.1)

HSP 1 Score: 3290.36 bits (8530), Expect = 0.000e+0
Identity = 1650/1683 (98.04%), Postives = 1653/1683 (98.22%), Query Frame = 2
Query:  446 FQVVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDENSDENKKSKIKNIPIFIVDANLSFLSNEEVEKLSDENDTKLSSRLYFSADNQLQSSYKSRSLIKIENIDTSSYSSILSTETPRSNLTTPEDKIDESRNTIYPIMLPERLIINEEFYNEFYSFKIPGISVQISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINLSKEK 5494
             +VVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDENSDENKKSKIKNIPIFIVDANLSFLSNEEVEKLSDENDTKLSSRLYFSADNQLQSSYKSRSLIKIENIDTSSYSSILSTETPRSNLTTPEDKIDESRNTIYPIMLPERLIINEEFYNEFYSFKIPGISVQISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEAT HNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLEKKIEEIRIRIMEIK KARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEV+TVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLQIDSSSSQSHSIT VVSYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTI SIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLS                         FITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETV+LNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINLSKEK
Sbjct:  167 LKVVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDENSDENKKSKIKNIPIFIVDANLSFLSNEEVEKLSDENDTKLSSRLYFSADNQLQSSYKSRSLIKIENIDTSSYSSILSTETPRSNLTTPEDKIDESRNTIYPIMLPERLIINEEFYNEFYSFKIPGISVQISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATAHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLEKKIEEIRIRIMEIKGKARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVSTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLQIDSSSSQSHSITQVVSYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTISSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLS-------------------------FITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVQLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINLSKEK 1824          

HSP 2 Score: 2376.67 bits (6158), Expect = 0.000e+0
Identity = 1208/1222 (98.85%), Postives = 1212/1222 (99.18%), Query Frame = 1
Query: 5449 KSIDFFTINKFIQRKDDCEKDEMXXXXXXXXXXXXAKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            K++ F  +    + KDDCEKDEMSRNIQQSSSNRRAKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTT FQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVI KSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGLSPNNSLYRSRLRNNPSLINCCTIDWYMDWSTESLMSVAHFRIEEIINNFKIEIETSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE
Sbjct: 1810 KALTFLPLINLSKEKDDCEKDEMSRNIQQSSSNRRAKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTRFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIQKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGLSPNNSLYRSRLRNNPSLINCCTIDWYMDWSTESLMSVAHFRIEEIINNFKIEIETSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 3031          

HSP 3 Score: 501.516 bits (1290), Expect = 1.336e-141
Identity = 247/263 (93.92%), Postives = 249/263 (94.68%), Query Frame = 3
Query: 9198 METEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKK 9986
            METEAVE             T +LEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAK+
Sbjct: 3060 METEAVE-------------TILLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKR 3309          
BLAST of dynein heavy chain 6, axonemal vs. Planmine SMEST
Match: SMESG000004475.1 (SMESG000004475.1)

HSP 1 Score: 3290.36 bits (8530), Expect = 0.000e+0
Identity = 1650/1683 (98.04%), Postives = 1653/1683 (98.22%), Query Frame = 2
Query:  446 FQVVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDENSDENKKSKIKNIPIFIVDANLSFLSNEEVEKLSDENDTKLSSRLYFSADNQLQSSYKSRSLIKIENIDTSSYSSILSTETPRSNLTTPEDKIDESRNTIYPIMLPERLIINEEFYNEFYSFKIPGISVQISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINLSKEK 5494
             +VVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDENSDENKKSKIKNIPIFIVDANLSFLSNEEVEKLSDENDTKLSSRLYFSADNQLQSSYKSRSLIKIENIDTSSYSSILSTETPRSNLTTPEDKIDESRNTIYPIMLPERLIINEEFYNEFYSFKIPGISVQISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEAT HNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLEKKIEEIRIRIMEIK KARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEV+TVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLQIDSSSSQSHSIT VVSYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTI SIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLS                         FITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETV+LNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINLSKEK
Sbjct:  169 LKVVTAEEAKESKIFWTVSASSVTTVYQNKTNANENDISKITLSSCDSTPVPQWLHEKILFHQLTNMDTFNYFRYWKAFRTWRNNISTSKMVKHRNHLTLNLSRLDPIFQDCVNKVHRLSEDLLDRISINSEASEDNLTMFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDENSDENKKSKIKNIPIFIVDANLSFLSNEEVEKLSDENDTKLSSRLYFSADNQLQSSYKSRSLIKIENIDTSSYSSILSTETPRSNLTTPEDKIDESRNTIYPIMLPERLIINEEFYNEFYSFKIPGISVQISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATAHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLEKKIEEIRIRIMEIKGKARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVSTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLQIDSSSSQSHSITQVVSYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTISSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLS-------------------------FITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVQLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINLSKEK 1826          

HSP 2 Score: 2376.67 bits (6158), Expect = 0.000e+0
Identity = 1208/1222 (98.85%), Postives = 1212/1222 (99.18%), Query Frame = 1
Query: 5449 KSIDFFTINKFIQRKDDCEKDEMXXXXXXXXXXXXAKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            K++ F  +    + KDDCEKDEMSRNIQQSSSNRRAKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTT FQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVI KSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGLSPNNSLYRSRLRNNPSLINCCTIDWYMDWSTESLMSVAHFRIEEIINNFKIEIETSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE
Sbjct: 1812 KALTFLPLINLSKEKDDCEKDEMSRNIQQSSSNRRAKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTRFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIQKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGLSPNNSLYRSRLRNNPSLINCCTIDWYMDWSTESLMSVAHFRIEEIINNFKIEIETSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 3033          

HSP 3 Score: 501.516 bits (1290), Expect = 1.396e-141
Identity = 247/263 (93.92%), Postives = 249/263 (94.68%), Query Frame = 3
Query: 9198 METEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKK 9986
            METEAVE             T +LEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAK+
Sbjct: 3062 METEAVE-------------TILLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKR 3311          
BLAST of dynein heavy chain 6, axonemal vs. Planmine SMEST
Match: SMESG000004475.1 (SMESG000004475.1)

HSP 1 Score: 2985.67 bits (7739), Expect = 0.000e+0
Identity = 1513/1544 (97.99%), Postives = 1515/1544 (98.12%), Query Frame = 2
Query:  863 MFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDENSDENKKSKIKNIPIFIVDANLSFLSNEEVEKLSDENDTKLSSRLYFSADNQLQSSYKSRSLIKIENIDTSSYSSILSTETPRSNLTTPEDKIDESRNTIYPIMLPERLIINEEFYNEFYSFKIPGISVQISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATVHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLXXXXXXXXXXXXXXXXXARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVNTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLXXXXXXXXXXXXXXXXXYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTIPSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLSFLFRPVAMMVPDYVLICEVILFSEGFITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVKLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINLSKEK 5494
            MFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDENSDENKKSKIKNIPIFIVDANLSFLSNEEVEKLSDENDTKLSSRLYFSADNQLQSSYKSRSLIKIENIDTSSYSSILSTETPRSNLTTPEDKIDESRNTIYPIMLPERLIINEEFYNEFYSFKIPGISVQISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEAT HNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLEKKIEEIRIRIMEIK KARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEV+TVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLQIDSSSSQSHSIT VVSYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTI SIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLS                         FITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETV+LNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINLSKEK
Sbjct:    1 MFFIDPSQTYNLTEFYQNQLNQVRLFKENLHKVYSTMLESVLKTCQNYTDKINLSSYLEEISKERNLDSSSSSFMHTERIRIRKSMKYIKEFLKLLDCQLVQLCHRILKRNISKFCQFIVESINYDENSDENKKSKIKNIPIFIVDANLSFLSNEEVEKLSDENDTKLSSRLYFSADNQLQSSYKSRSLIKIENIDTSSYSSILSTETPRSNLTTPEDKIDESRNTIYPIMLPERLIINEEFYNEFYSFKIPGISVQISLSPILENILFCLKDLIEEAELTICSVETFSSQKCLELFKEDQYNKINPKLSLINETLTEREPVLISPSIKLMLDTDMEYCENVKTILKMSTNSLIDLVHYLPILNFCCFYVDEALKEYERISEPEFQWDIDEFQKHLVQNTEKILDINKTIKTKRIGFISLQTKNLTQDSKPYIEKVIGIVNEKLSKEATAHNDEFINLMRTANKTLDTDPKTVEEFVEHLEFINKINAEMLSMDKEARSINQMFTIITNFKVPVALEQLALYKTLNHAIQKLKNNVVYYEAKKDENIRKFSADLEKKIEEIRIRIMEIKGKARNSSFLDQNQTQSIILDQLGTLKNEVCDLGNKIRNYSNYQERFGSSLSKAASKSRQRQQFDLFTGNTASNLQEDVEEVERDISMRYLLWETKSEWERWYENFIVKKLDETEVSTVRQTVSRTNHTVGVLEKSLPQNEILPAVKALVNECKSSLPVIIALRNPNLQLRHWHKIEKMIGLSLTKNKNFTIGELISSKILQYKQIIMEISEFANNEMTLEHMLTKVKDVYAVLEFRLVSHSNRDTWIITGVDDINVDLEESHMTISTIKGSKYVDHIRTQVEDWERKLSHTAKVLDEWINCQKHWLYLEQIFGTVDIQRQLPNEGRLFHEVDCEWRSLMQQTKEKPLVLKCCTKQGVLQILQTCNSKLEKIQKSLEDYLEMKRIIFPRLFFLSNDELLEILSRAQDPENVQRHLTKLFANVHKLQIDSSSSQSHSITQVVSYEGEAFPLPRNIRVRGLAEQWLATLEQGIFEGVKRQIKRCLIEMEQKQFVDWALNNFGQSILVSTQVKFSQNVSRALKGTPDPESTGLLTISSIISDLIQNLELLAVTVSEDIVSYKRFALEAMIVIKVHNRDSAQSLLENDVKSELDFEWKKQIRYLWNEFSSQCQVTQVDSYFEYGNEYLGCSPRLVITPLTDRCYMTMTGALNFNLGGCAKGPAGTGKTETIKDLSKVMGRQCVVFNCSDKLDNSTVAKLLSGVIQVGSWCCFDEFNRMNLEVLSVIAAQIYSIKAAKDSRFERFIFENKEIKLNPYCGIFITMNPSYAGRVELPDNLS-------------------------FITAKVLSSKITNLYRLCNDQLSYQQHYDFGLRSIKSVLILMGHLRLERVLISETVQLNVNEELNILIQAIKISNEPRLITDDLPLFKSIMGDLFGDFDEVLENDKLLERSIELSYKELGYEVWPDQIEKIKYLNSQLKSRHGVMLLGPSASGKTVIRSILQKALTFLPLINLSKEK 1519          

HSP 2 Score: 2377.82 bits (6161), Expect = 0.000e+0
Identity = 1208/1222 (98.85%), Postives = 1212/1222 (99.18%), Query Frame = 1
Query: 5449 KSIDFFTINKFIQRKDDCEKDEMXXXXXXXXXXXXAKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTPFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIHKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGXXXXXXXXXXXXXXXXXXINCCTIDWYMDWSTESLMSVAHFRXXXXXXXXXXXXXTSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 9114
            K++ F  +    + KDDCEKDEMSRNIQQSSSNRRAKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTT FQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVI KSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGLSPNNSLYRSRLRNNPSLINCCTIDWYMDWSTESLMSVAHFRIEEIINNFKIEIETSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE
Sbjct: 1505 KALTFLPLINLSKEKDDCEKDEMSRNIQQSSSNRRAKIDVQVVNPKALSINHLYGYVNPNSLEWIEGIIPMVTKKMISFSNKNQNVLNDQLSTDNFEKENSNQNDLQTLLNNEQGQRKERRRSSLLNMEIIKKLSVSQRFSVESQDVLQDSVKNQFTKDAKIVSHRSKKNWQWIVLDGPINSAWVENLNTVLDDSQILCLANGERINIPASLKFLFEVDDLKNSSPATVSRCAMIYVGKQSIHWKIQVKSWMKNQLPKSFPESGKEFLYKLFEKSIKPGMKFLSKCSKIQIIPNTSKQSQLFTLCCILEALILYLSANGGFDNLSLDILDASKADSSRKVNESTTRFQDTKQFPFIQKENSKVSFLQKNPKELNNLLGKLYVFAYTWSFGAAFARQEDLEIETNIDTASGKKSGFSIYEAADEFDLFVKSLFDNNSETGIRLPLDNKTIYSYFVDMDKGIFQPWDILVPSIKNLIDASGILSFSSGINANNQNRVNEIIVSLDSIRYSFLSALLMLNNHPVLLAGDSGIGKSILINDILKQICRKNGSSTSNSDSILGKIFMYNDKNQNLLSSIQNLSKFSNSADIEDDIIEKSLYVPMETDTYIYSSIKFNSQTSINKALQHMTSKMVKRGQDIIGPPKNKKMLLFIDDLNVPTIDEFGSQSTLEMVRQWIELNGFFDNTSLQWTYVTDCSLIVACSPNIQSPISERLTKHFCVLTLPQPSSNAFQRIFQVKIGRYFHQKDFSIEIKAHLTSIVDIPISVYFKTINQYKTSPLKSHYIFNLRVLHKIINGLLNADDKLVVNKEDVGKYVAHEIIREIHDRLISDPDREIFFKILSDELHMSLKLNWAHDELGKCDIMFGKFFPLKGSSSSTKVYQQITDVEKLIRFFESSINTFDHEHLNTNNFIFFKQSIQHMIRFMRILNQSSGHMLMIGVEGCGKYSNVKISSAIIGCDIFRLNMTSDYNNISFRGDIKKVIQKSILQNRPCVVYLSDMDDLVNDSFMDDLCNLINSGHIPDLYENDELENILSNLKPEDLGSESVSDPNDVYFLLIEKIQKYLHVCIGLSPNNSLYRSRLRNNPSLINCCTIDWYMDWSTESLMSVAHFRIEEIINNFKIEIETSKEDTMHNLTEASIFIYRTAIEVGNQFQMELRRPYFLSSGDFIEFLNNFFDILQNDYVKNNSNRSRLSKGLNQLMETRSLITKMKEDLIELTPKIKEKSEETE 2726          

HSP 3 Score: 502.286 bits (1292), Expect = 4.942e-142
Identity = 247/263 (93.92%), Postives = 249/263 (94.68%), Query Frame = 3
Query: 9198 METEAVENYSLKCEEDLLSVTPVLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKK 9986
            METEAVE             T +LEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAK+
Sbjct: 2755 METEAVE-------------TILLEASIKALDSLNKASISEVRVYRNPPRLVEIVMNAVCVLLSVTPSWANAKLLLGDANFLQKLLNYEKDAINKKMYKDLQQYTGQKDFNPESVGYVSLACRSICQWVLAIEHYHSVNNMIIPKRKTVNEAKKALEISKQKLEWKQNQLKKVEDHIKNLDNKYQNSVKEQKQLKERVRLTNERLYRAAALIEAIQSEKDRWHSSIKDCDKATKNIIGSCMTSAAYATFTGPWTLVYREMAKR 3004          
BLAST of dynein heavy chain 6, axonemal vs. Planmine SMEST
Match: SMESG000004477.1 (SMESG000004477.1)

HSP 1 Score: 2124.36 bits (5503), Expect = 0.000e+0
Identity = 1041/1043 (99.81%), Postives = 1042/1043 (99.90%), Query Frame = 3
Query: 10257 MLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLPRNLLGDLEEYFAQSELFDVTKTYSTSEIIPK 13385
            MLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHES+DMLTVSLEVLPRNLLGDLEEYFAQSELFDVTKTYSTSEII K
Sbjct:    1 MLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEDQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESVDMLTVSLEVLPRNLLGDLEEYFAQSELFDVTKTYSTSEIISK 1043          

HSP 2 Score: 244.588 bits (623), Expect = 8.191e-65
Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = 2
Query: 13379 SKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCEID 13723
            SKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCEID
Sbjct: 1042 SKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCEID 1156          
BLAST of dynein heavy chain 6, axonemal vs. Planmine SMEST
Match: SMESG000004477.1 (SMESG000004477.1)

HSP 1 Score: 2120.89 bits (5494), Expect = 0.000e+0
Identity = 1041/1044 (99.71%), Postives = 1042/1044 (99.81%), Query Frame = 3
Query: 10257 MLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHE-DQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESIDMLTVSLEVLPRNLLGDLEEYFAQSELFDVTKTYSTSEIIPK 13385
            MLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHE DQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHES+DMLTVSLEVLPRNLLGDLEEYFAQSELFDVTKTYSTSEII K
Sbjct:    1 MLERAIRVGDTICLEDIETQIDPVLGPLLRKEFFRRGNITMIKLGENELEYSPSFKLYLMSSLSNPQLVSSVNRLVTIINFTVNLVGLEEQLLSLIVSKEKPEIENERNRFLRTYANDLESLRNLEDKTLGLLQDSTDKIVNDSELAQNLEKSKITALDIKKRLEETIQAEKQLQLARKFYLPLAIRGAQIYFVLADLGVVNYMYQYSLAWFQNLFTECVDEINKEIGENVSISPETKLQKIIDSVTYQSYHMASHGLFSIHRPLFAFMLSTSIMRYSLEESDNRIGQKQWATFIKLHTTSSVYGENLKAFDSTGQIIKQPDNIEWLTLEVWNKCKFLEIELKDKFSGLCNSFKLTPETWIKWNLSENPFDMSSYNFKEFSVKYLNSFEKLILISILCSYKLIDSARLYVKLVLGEKFSTLLESNLLNLFTESHAKIPIVFILGANSDPINHVMKLVMELRGNTSNLDIVSMGRGQATKAESLIQKTHIHKGRWIFLQNCDLMISWMPSLQKLIENLQISKQDNDANFKLILSTHPHSDFPIGILQNSLKIAIESPIGIKNQLLKSFALDGTGNVTETIYNNQSEQIRKMIFNLCLFNAVVLERRNYGSLGFSLPYDFNDSDLEISIKQIPTFLTNNEVQWNALHNVIGNINYGGRITDNLDRRCLMHLLQNYASENNNGNGIEMFVKSPKVLIGHLTDFQSINSFIHSNDCAVEKLENLLGLGDNAEIVRLENQSKSFIIDIIVQQSKHHEADQKTTDSNSALDMLKVISNKIPRSVEQHIIDTYGKDFLKDFEQVIPLFGKLDEAIKDDFLRFNKYSNKEMIIRFFDSPFHNVLEQEIKQYNYLLIRIHKDIKLLVGYLSGNKNITESLETVLDYISINLVPPSWGLLSIGKSLSEWSSNVRIRIDFIGFWCYSILREYHKYLELVYSTASSICAMHNPGNDKINILNYEKESLEQIQNENLFQKLRKNIVCYWLPGFFSPQSLITAVMQNEARIIHESVDMLTVSLEVLPRNLLGDLEEYFAQSELFDVTKTYSTSEIISK 1044          

HSP 2 Score: 244.588 bits (623), Expect = 8.247e-65
Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = 2
Query: 13379 SKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCEID 13723
            SKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCEID
Sbjct: 1043 SKTMYNPDHGVLVFGLYLDNALWNLENSSLAINPIHRRYCKLPIIHLMAVISEKNKKEDSYTFLCPLYRTPSRFGILSSSGKSSNFLCFLTLKSDRIPSFWILRGTAALLQCEID 1157          
The following BLAST results are available for this feature:
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH140.000e+032.84dynein axonemal heavy chain 14 [Source:HGNC Symbol... [more]
DNAH140.000e+032.84dynein axonemal heavy chain 14 [Source:HGNC Symbol... [more]
DNAH68.247e-1136.34dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
DNAH21.582e-16228.41dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
DNAH21.582e-16228.41dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-18.936e-13433.53Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-19.703e-13433.53Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-19.703e-13433.53Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-38.255e-12332.64Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-33.426e-3230.67Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhc16F2.254e-15533.66gene:FBgn0283476 transcript:FBtr0074509[more]
Dnah36.324e-15526.67gene:FBgn0035581 transcript:FBtr0289982[more]
CG94921.621e-14627.02gene:FBgn0037726 transcript:FBtr0309029[more]
CG94922.417e-14627.02gene:FBgn0037726 transcript:FBtr0309027[more]
CG94922.169e-14626.94gene:FBgn0037726 transcript:FBtr0344344[more]
back to top
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah61.087e-835.48dynein, axonemal, heavy chain 6 [Source:ZFIN;Acc:Z... [more]
AL807739.18.597e-1035.41dynein, axonemal, heavy chain 6 [Source:NCBI gene;... [more]
dnah69.472e-935.16dynein, axonemal, heavy chain 6 [Source:ZFIN;Acc:Z... [more]
dnah25.097e-16329.29dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah23.243e-16429.29dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000008466.13.216e-9242.55dynein axonemal heavy chain 14 [Source:NCBI gene;A... [more]
asxl21.366e-5137.22ASXL transcriptional regulator 2 [Source:Xenbase;A... [more]
asxl21.569e-5137.22ASXL transcriptional regulator 2 [Source:Xenbase;A... [more]
asxl21.343e-5135.06ASXL transcriptional regulator 2 [Source:Xenbase;A... [more]
DNAH29.090e-17228.41dynein, axonemal, heavy chain 2 [Source:NCBI gene;... [more]
back to top
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah146.673e-1036.82dynein, axonemal, heavy chain 14 [Source:MGI Symbo... [more]
Dnah143.102e-1536.82dynein, axonemal, heavy chain 14 [Source:MGI Symbo... [more]
Dnah65.428e-1036.53dynein, axonemal, heavy chain 6 [Source:MGI Symbol... [more]
Dnah65.428e-1036.53dynein, axonemal, heavy chain 6 [Source:MGI Symbol... [more]
Dnah65.200e-1034.60dynein, axonemal, heavy chain 6 [Source:MGI Symbol... [more]
back to top
BLAST of dynein heavy chain 6, axonemal vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9C0G6|DYH6_HUMAN3.960e-1036.34Dynein heavy chain 6, axonemal OS=Homo sapiens OX=... [more]
sp|P0C6F1|DYH2_MOUSE2.429e-16529.17Dynein heavy chain 2, axonemal OS=Mus musculus OX=... [more]
sp|Q9P225|DYH2_HUMAN7.049e-16228.41Dynein heavy chain 2, axonemal OS=Homo sapiens OX=... [more]
sp|Q8WXX0|DYH7_HUMAN3.297e-16328.92Dynein heavy chain 7, axonemal OS=Homo sapiens OX=... [more]
sp|Q63170|DYH7_RAT1.533e-16027.55Dynein heavy chain 7, axonemal OS=Rattus norvegicu... [more]
back to top
BLAST of dynein heavy chain 6, axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9M9G54.695e-1045.10Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2T7NYR12.526e-945.78Uncharacterized protein OS=Pomacea canaliculata OX... [more]
W4ZJR48.426e-17843.13Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A2R2MJL37.230e-1044.32dynein heavy chain 6, axonemal OS=Lingula unguis O... [more]
A0A267FX735.059e-2244.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah22.069e-17129.15dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah129.659e-16529.06dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
ENSAMXT00000016172.25.669e-14427.03pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
si:dkeyp-86b9.12.631e-14937.20dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DYNC1H16.885e-13833.41dynein cytoplasmic 1 heavy chain 1 [Source:HGNC Sy... [more]
back to top
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH68.425e-1035.83dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000001140.11.946e-16737.80pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
ENSPMAT00000003955.14.258e-16439.78pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 g... [more]
ENSPMAT00000003959.11.100e-16339.68pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 g... [more]
ENSPMAT00000006497.11.845e-14433.19pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 ge... [more]
back to top
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN11.053e-8027.87Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of dynein heavy chain 6, axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5