Glutamate receptor, ionotropic kainate 2-like protein

Overview
NameGlutamate receptor, ionotropic kainate 2-like protein
Smed IDSMED30006651
Length (bp)551
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006651

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30006651SMESG000080238.1 SmedASXL_039317SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30006651SMESG000080238.1 dd_Smed_v6_51569_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Human
Match: GRIK5 (glutamate ionotropic receptor kainate type subunit 5 [Source:HGNC Symbol;Acc:HGNC:4583])

HSP 1 Score: 67.3958 bits (163), Expect = 7.658e-13
Identity = 51/175 (29.14%), Postives = 87/175 (49.71%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPD--AEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  R+ P+  A    E   GF   ++  L++ L FR  +    DG +GA   N S +TG VGE+    A L    FT+TAER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   ++  + SP+  YN   C   R  ++
Sbjct:  414 NKTLVVTTILENPYVMRR-PNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHIL 586          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Human
Match: GRIK5 (glutamate ionotropic receptor kainate type subunit 5 [Source:HGNC Symbol;Acc:HGNC:4583])

HSP 1 Score: 67.0106 bits (162), Expect = 9.094e-13
Identity = 51/175 (29.14%), Postives = 87/175 (49.71%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPD--AEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  R+ P+  A    E   GF   ++  L++ L FR  +    DG +GA   N S +TG VGE+    A L    FT+TAER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   ++  + SP+  YN   C   R  ++
Sbjct:  414 NKTLVVTTILENPYVMRR-PNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHIL 586          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Human
Match: GRIK5 (glutamate ionotropic receptor kainate type subunit 5 [Source:HGNC Symbol;Acc:HGNC:4583])

HSP 1 Score: 67.0106 bits (162), Expect = 9.094e-13
Identity = 51/175 (29.14%), Postives = 87/175 (49.71%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPD--AEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  R+ P+  A    E   GF   ++  L++ L FR  +    DG +GA   N S +TG VGE+    A L    FT+TAER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   ++  + SP+  YN   C   R  ++
Sbjct:  414 NKTLVVTTILENPYVMRR-PNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHIL 586          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Human
Match: GRIK4 (glutamate ionotropic receptor kainate type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4582])

HSP 1 Score: 62.7734 bits (151), Expect = 3.503e-11
Identity = 44/172 (25.58%), Postives = 83/172 (48.26%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIR 510
             +N T+ + +++  PY   K    E    +   GF   ++  L++ L F  +I    DG +G   +N + +TG VGE+    A L     T+TAER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   +++ + +P+  Y+   C   R
Sbjct:  413 LFNTTLVVTTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGT-WTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGR 583          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Human
Match: GRIK4 (glutamate ionotropic receptor kainate type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4582])

HSP 1 Score: 62.7734 bits (151), Expect = 3.503e-11
Identity = 44/172 (25.58%), Postives = 83/172 (48.26%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIR 510
             +N T+ + +++  PY   K    E    +   GF   ++  L++ L F  +I    DG +G   +N + +TG VGE+    A L     T+TAER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   +++ + +P+  Y+   C   R
Sbjct:  413 LFNTTLVVTTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGT-WTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGR 583          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 67.0106 bits (162), Expect = 4.170e-13
Identity = 38/135 (28.15%), Postives = 69/135 (51.11%), Query Frame = 1
Query:   97 GFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEV---KWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLD 492
            GF   ++  +++ L F   I +  DG +G I   +  + G +G +QR+ A L  +  T+T  R +VVDF+ P +   + I+      E      W   + + + VW+++     ++S + +IL KFSP+  YNL+
Sbjct:  431 GFCIDLLNEMTQVLKFNYTIIEVQDGTYG-IEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLE 564          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 66.6254 bits (161), Expect = 5.673e-13
Identity = 38/135 (28.15%), Postives = 69/135 (51.11%), Query Frame = 1
Query:   97 GFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEV---KWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLD 492
            GF   ++  +++ L F   I +  DG +G I   +  + G +G +QR+ A L  +  T+T  R +VVDF+ P +   + I+      E      W   + + + VW+++     ++S + +IL KFSP+  YNL+
Sbjct:  431 GFCIDLLNEMTQVLKFNYTIIEVQDGTYG-IEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLE 564          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 59.3066 bits (142), Expect = 2.012e-10
Identity = 33/133 (24.81%), Postives = 65/133 (48.87%), Query Frame = 1
Query:   97 GFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLP-SEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLD 492
            G+   ++  ++  L F   I +  D  +G+  SN   ++G VGE+QR +A L     T++  R +V+DF+ P +   + I++      +  W+     +   VW+  F    ++S+  +I+ K SP+  +  D
Sbjct:  424 GYCIDLLHKIANILKFTYTIQKVRDNAYGSKESN-GKWSGMVGELQRGDADLAVASLTISYGRSEVIDFTVPYMHLGISILFKKPRIRDSDWFKFMDPLSTQVWIMTFASYFVVSVAIWIIAKISPYEQFERD 555          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Celegans
Match: glr-5 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:O01623])

HSP 1 Score: 54.6842 bits (130), Expect = 7.243e-9
Identity = 38/166 (22.89%), Postives = 74/166 (44.58%), Query Frame = 1
Query:   19 KICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVK--WWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFS-AYNLDLCFA 504
            ++ +++ +PY   K    E    +   GF   ++  LSK L F   I+   DG++G        + G +GEI R  A +     T+   R + VDF+ P LS  + I+Y  +P + +   ++    +   +W  +   ++ +++  Y +   +P+    N   C A
Sbjct:  440 RVTTIMERPYVMLKKNHYELDANSKFEGFCIDLLAELSKDLGFTYTIHAVKDGKYGNDKYGNGSWDGMMGEILRGEAEMAVAPLTVNYRRSEAVDFTKPFLSLGISILY-KVPDDQQPDLFSFLNPLSWQIWTAIATSIITVTLGMYFVANVTPYEWNLNFSCCTA 604          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 53.1434 bits (126), Expect = 2.197e-8
Identity = 42/160 (26.25%), Postives = 76/160 (47.50%), Query Frame = 1
Query:   19 KICSLVYQPYFDRKY-PDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRIL---VWLTVFGFLVLISITSYILCKFSPFSAYN 486
            ++ +L+  P+  R   PD  +      G+   +I  +  ++NF   IY+  DG FG +  N + + G +G +   +A +     ++ AER   VDF+ P     LV     +      +++FK +++L   VWL +    +  SI  +I  +FSP+S  N
Sbjct:  375 RVVTLIQPPFVQRTGDPDTPYE-----GYCIDLINMIQVEVNFTYTIYEVEDGSFGTMDDNGN-WNGLIGALVSGSADIALAPLSVMAERENDVDFTVPYYD--LVGTTILMKKADVEYSLFKFMKVLEWPVWLCIVAAYLFTSILLWIFDRFSPYSFTN 526          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 61.2326 bits (147), Expect = 4.619e-11
Identity = 45/185 (24.32%), Postives = 84/185 (45.41%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDN-LPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFS--AYNLDLCFAIRDEVVYFEHLWTAI 549
            N T+ + +++  PY  RK      S  +   G+   +I  +SK L F  +I    DG +G++   T  + G + E+    A L     T+T ER + VDF+ P ++  + I+Y   +      ++    + + VW+ +    + +S+  +IL KF+P+   AY       +  +      +W AI
Sbjct:  415 NKTLVVTTILSNPYCMRKESAIPLSGNDQFEGYAVDLIHEISKSLGFNYKIQLVPDGSYGSLNKLTGEWNGMIRELLEQRADLAIADLTITFEREQAVDFTTPFMNLGVSILYRKPIKQPPNLFSFLSPLSLDVWIYMATAYLGVSVLLFILAKFTPYEWPAYTDAHGEKVESQFTLLNCMWFAI 599          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Fly
Match: clumsy (gene:FBgn0026255 transcript:FBtr0081476)

HSP 1 Score: 60.077 bits (144), Expect = 1.250e-10
Identity = 45/183 (24.59%), Postives = 83/183 (45.36%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFSLENMS---GFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPS-EVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVVYFEHLWT 543
            N T  + S +  P+   + P     L   S   G+   +I  ++K LNF+ E     DG++GA+   T  + G V ++   NA LG    T+T+ R + VDF+ P ++  + I++   P+     ++      + VW+ +    + IS+  + L + +P    N   C     E    E++W+
Sbjct:  342 NKTFIVSSRLGAPFLTLREPQEGEILTGNSRYEGYSIDLINEIAKMLNFKFEFRMSPDGKYGALNKVTQTWDGIVRQLIDGNADLGICDLTMTSSRRQAVDFTPPFMTLGISILFSKPPTPPTDLFSFLSPFSLDVWIYMGSAYLFISLLLFALARMAPDDWENPHPC----KEPEEVENIWS 520          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Fly
Match: clumsy (gene:FBgn0026255 transcript:FBtr0110895)

HSP 1 Score: 59.6918 bits (143), Expect = 1.723e-10
Identity = 45/183 (24.59%), Postives = 83/183 (45.36%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFSLENMS---GFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPS-EVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVVYFEHLWT 543
            N T  + S +  P+   + P     L   S   G+   +I  ++K LNF+ E     DG++GA+   T  + G V ++   NA LG    T+T+ R + VDF+ P ++  + I++   P+     ++      + VW+ +    + IS+  + L + +P    N   C     E    E++W+
Sbjct:  414 NKTFIVSSRLGAPFLTLREPQEGEILTGNSRYEGYSIDLINEIAKMLNFKFEFRMSPDGKYGALNKVTQTWDGIVRQLIDGNADLGICDLTMTSSRRQAVDFTPPFMTLGISILFSKPPTPPTDLFSFLSPFSLDVWIYMGSAYLFISLLLFALARMAPDDWENPHPC----KEPEEVENIWS 592          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Fly
Match: Ir8a (gene:FBgn0052704 transcript:FBtr0071333)

HSP 1 Score: 59.3066 bits (142), Expect = 2.359e-10
Identity = 40/134 (29.85%), Postives = 65/134 (48.51%), Query Frame = 1
Query:   94 SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFK---SIRILVWLTVFGFLVLISITSYILCKFSPFSAYN 486
             G+    I  LS+KLNF  EI  P  G  G + +    + G VG++ R           + +ER +V+DF  P      + I    P  V+  ++FK    +R+ VWL++   LV  +I  + + K+SP+S+ N
Sbjct:  419 EGYCIDFIIRLSQKLNFEFEIVAPEVGHMGEL-NELGEWDGVVGDLVRGETDFAIAALKMYSEREEVIDFLPPYYEQTGISIAIRKP--VRRTSLFKFMTVLRLEVWLSIVAALVGTAIMIWFMDKYSPYSSRN 549          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0089194)

HSP 1 Score: 58.151 bits (139), Expect = 6.082e-10
Identity = 41/177 (23.16%), Postives = 80/177 (45.20%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKY----PDAEFSLE-NMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSE-VKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRD 513
            FY++ I   +LV     +R Y     D   +      GF   ++  ++ ++ F+ +I    D  +G  I  T+ + G V E+    A L     T+   R  V+DF+ P ++  + I++    S+  + ++    + I +WL V    +L+S   +++ +FSP+   N   C+   D
Sbjct:  417 FYDSNIANITLVVMTREERPYVMVKEDKNLTGNLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETD 593          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Zebrafish
Match: grik5 (glutamate receptor, ionotropic, kainate 5 [Source:ZFIN;Acc:ZDB-GENE-070821-6])

HSP 1 Score: 72.7886 bits (177), Expect = 7.024e-15
Identity = 52/174 (29.89%), Postives = 85/174 (48.85%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFSL-ENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N ++ I +++  PY  RK    EF   E   GF   ++  LS  L F   I    DG +GA   N S +TG VGE+    A L    FT+T+ER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   ++  + SP+  YN   C   R +++
Sbjct:  146 NKSLIITTILENPYVMRKINYQEFEGNEQYEGFCVDMLRELSDILKFTYRIKLVDDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTLGISILYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLSARLSPYEWYNPHPCLRERRDLL 318          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Zebrafish
Match: grik5 (glutamate receptor, ionotropic, kainate 5 [Source:ZFIN;Acc:ZDB-GENE-070821-6])

HSP 1 Score: 71.633 bits (174), Expect = 1.572e-14
Identity = 52/174 (29.89%), Postives = 85/174 (48.85%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFSL-ENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N ++ I +++  PY  RK    EF   E   GF   ++  LS  L F   I    DG +GA   N S +TG VGE+    A L    FT+T+ER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   ++  + SP+  YN   C   R +++
Sbjct:  427 NKSLIITTILENPYVMRKINYQEFEGNEQYEGFCVDMLRELSDILKFTYRIKLVDDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTLGISILYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLSARLSPYEWYNPHPCLRERRDLL 599          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Zebrafish
Match: grik5 (glutamate receptor, ionotropic, kainate 5 [Source:ZFIN;Acc:ZDB-GENE-070821-6])

HSP 1 Score: 71.633 bits (174), Expect = 1.651e-14
Identity = 52/174 (29.89%), Postives = 85/174 (48.85%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFSL-ENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N ++ I +++  PY  RK    EF   E   GF   ++  LS  L F   I    DG +GA   N S +TG VGE+    A L    FT+T+ER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   ++  + SP+  YN   C   R +++
Sbjct:  427 NKSLIITTILENPYVMRKINYQEFEGNEQYEGFCVDMLRELSDILKFTYRIKLVDDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTLGISILYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLSARLSPYEWYNPHPCLRERRDLL 599          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Zebrafish
Match: grid1b (glutamate receptor, ionotropic, delta 1b [Source:ZFIN;Acc:ZDB-GENE-121214-84])

HSP 1 Score: 63.1586 bits (152), Expect = 1.555e-11
Identity = 40/165 (24.24%), Postives = 79/165 (47.88%), Query Frame = 1
Query:   13 TIKICSLVYQPYFDRKYPDAEFSLENM-------SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYN 486
            T+K+ +L+  P+            EN+        GF   ++  L+K L F+ +IYQ  D ++G+ +SN S + G +GE+    A L  +  T+T ER  VVDFS   +   + I++     ++  +++F    + VW  +   + ++ +  ++L +     + N
Sbjct:  439 TVKVVTLLEDPFV--------MVAENILGQPKRYKGFSIDVLEALAKILGFKYDIYQVADSKYGSQLSNGS-WNGMIGELINKRADLAVSAITITPERENVVDFSKRYMDYSVGILHRKPEEKINIFSLFAPFDLAVWACIAAAIPVVGVLIFLLTRMQMLRSQN 594          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Zebrafish
Match: grid1b (glutamate receptor, ionotropic, delta 1b [Source:ZFIN;Acc:ZDB-GENE-121214-84])

HSP 1 Score: 61.6178 bits (148), Expect = 1.584e-11
Identity = 40/165 (24.24%), Postives = 79/165 (47.88%), Query Frame = 1
Query:   13 TIKICSLVYQPYFDRKYPDAEFSLENM-------SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYN 486
            T+K+ +L+  P+            EN+        GF   ++  L+K L F+ +IYQ  D ++G+ +SN S + G +GE+    A L  +  T+T ER  VVDFS   +   + I++     ++  +++F    + VW  +   + ++ +  ++L +     + N
Sbjct:    5 TVKVVTLLEDPFV--------MVAENILGQPKRYKGFSIDVLEALAKILGFKYDIYQVADSKYGSQLSNGS-WNGMIGELINKRADLAVSAITITPERENVVDFSKRYMDYSVGILHRKPEEKINIFSLFAPFDLAVWACIAAAIPVVGVLIFLLTRMQMLRSQN 160          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 74.7146 bits (182), Expect = 1.726e-15
Identity = 50/174 (28.74%), Postives = 84/174 (48.28%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFS-LENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  RK      S  +   GF  +++  L+  L F  +I    DG +GA   N S +TG VGE+    A L    FT+TAER KV+DFS P ++  + I+Y   +  +  +++        VWL +    + +S   ++  + SP+  YN   C   R  ++
Sbjct:  129 NKTLVVTTILENPYMMRKSNYRSLSGNDQYEGFCAEMLMELAALLRFNYKIKLVEDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHIL 301          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 74.7146 bits (182), Expect = 1.918e-15
Identity = 50/174 (28.74%), Postives = 84/174 (48.28%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFS-LENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  RK      S  +   GF  +++  L+  L F  +I    DG +GA   N S +TG VGE+    A L    FT+TAER KV+DFS P ++  + I+Y   +  +  +++        VWL +    + +S   ++  + SP+  YN   C   R  ++
Sbjct:  364 NKTLVVTTILENPYMMRKSNYRSLSGNDQYEGFCAEMLMELAALLRFNYKIKLVEDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHIL 536          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 73.1738 bits (178), Expect = 6.628e-15
Identity = 50/174 (28.74%), Postives = 84/174 (48.28%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  RK      S  +   GF  +++  L+  L F  +I    DG +GA   N S +TG VGE+    A L    FT+TAER KV+DFS P ++  + I+Y   +  +  +++        VWL +    + +S   ++  + SP+  YN   C   R  ++
Sbjct:  410 NKTLVVTTILENPYMMRKSNYRSLSGNDQYEGFCAEMLMELAALLRFNYKIKLVEDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHIL 582          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 73.1738 bits (178), Expect = 7.487e-15
Identity = 50/174 (28.74%), Postives = 84/174 (48.28%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  RK      S  +   GF  +++  L+  L F  +I    DG +GA   N S +TG VGE+    A L    FT+TAER KV+DFS P ++  + I+Y   +  +  +++        VWL +    + +S   ++  + SP+  YN   C   R  ++
Sbjct:  408 NKTLVVTTILENPYMMRKSNYRSLSGNDQYEGFCAEMLMELAALLRFNYKIKLVEDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHIL 580          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 73.1738 bits (178), Expect = 8.179e-15
Identity = 50/174 (28.74%), Postives = 84/174 (48.28%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  RK      S  +   GF  +++  L+  L F  +I    DG +GA   N S +TG VGE+    A L    FT+TAER KV+DFS P ++  + I+Y   +  +  +++        VWL +    + +S   ++  + SP+  YN   C   R  ++
Sbjct:  410 NKTLVVTTILENPYMMRKSNYRSLSGNDQYEGFCAEMLMELAALLRFNYKIKLVEDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHIL 582          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Mouse
Match: Grik5 (glutamate receptor, ionotropic, kainate 5 (gamma 2) [Source:MGI Symbol;Acc:MGI:95818])

HSP 1 Score: 67.0106 bits (162), Expect = 6.611e-13
Identity = 51/175 (29.14%), Postives = 87/175 (49.71%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPD--AEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  R+ P+  A    E   GF   ++  L++ L FR  +    DG +GA   N S +TG VGE+    A L    FT+TAER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   ++  + SP+  YN   C   R  ++
Sbjct:  414 NKTLVVTTILENPYVMRR-PNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHIL 586          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Mouse
Match: Grik4 (glutamate receptor, ionotropic, kainate 4 [Source:MGI Symbol;Acc:MGI:95817])

HSP 1 Score: 62.003 bits (149), Expect = 3.389e-11
Identity = 44/172 (25.58%), Postives = 82/172 (47.67%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIR 510
             +N T+ + +++  PY   K    E    +   GF   ++  L++ L F  +I    DG +G   +N + +TG VGE+    A L     T+TAER KV+DFS P ++  + I+Y  ++     +++        VWL +    + +S   +++ + +P+  Y+   C   R
Sbjct:  413 LFNTTLVVTTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGT-WTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGR 583          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Mouse
Match: Grik4 (glutamate receptor, ionotropic, kainate 4 [Source:MGI Symbol;Acc:MGI:95817])

HSP 1 Score: 62.003 bits (149), Expect = 3.389e-11
Identity = 44/172 (25.58%), Postives = 82/172 (47.67%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIR 510
             +N T+ + +++  PY   K    E    +   GF   ++  L++ L F  +I    DG +G   +N + +TG VGE+    A L     T+TAER KV+DFS P ++  + I+Y  ++     +++        VWL +    + +S   +++ + +P+  Y+   C   R
Sbjct:  413 LFNTTLVVTTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGT-WTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGR 583          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Mouse
Match: Grid1 (glutamate receptor, ionotropic, delta 1 [Source:MGI Symbol;Acc:MGI:95812])

HSP 1 Score: 60.077 bits (144), Expect = 1.550e-10
Identity = 35/123 (28.46%), Postives = 62/123 (50.41%), Query Frame = 1
Query:   97 GFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKF 465
            GF   ++  L+K L F+ EIYQ  DG +G  + NTS + G +GE+    A L  +  T+T ER  VVDFS   +   + I+      ++  +++F      VW  +   + ++ +  ++L + 
Sbjct:  465 GFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTS-WNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRI 586          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Mouse
Match: Gria3 (glutamate receptor, ionotropic, AMPA3 (alpha 3) [Source:MGI Symbol;Acc:MGI:95810])

HSP 1 Score: 55.8398 bits (133), Expect = 4.265e-9
Identity = 35/159 (22.01%), Postives = 80/159 (50.31%), Query Frame = 1
Query:    7 NATIKICSLVYQPY--FDRKYPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPL-VIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPF 474
            N TI + +++  PY  + + +   E + E   G+   + + ++K +  + ++    DG++GA    T ++ G VGE+    A +     T+T  R +V+DFS P +S  + ++I     S+   ++    +   +W+ +    + +S+  +++ +FSP+
Sbjct:  416 NRTIVVTTILESPYVMYKKNHEQLEGN-ERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPY 573          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. UniProt/SwissProt
Match: sp|Q16478|GRIK5_HUMAN (Glutamate receptor ionotropic, kainate 5 OS=Homo sapiens OX=9606 GN=GRIK5 PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 4.367e-12
Identity = 51/175 (29.14%), Postives = 87/175 (49.71%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPD--AEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  R+ P+  A    E   GF   ++  L++ L FR  +    DG +GA   N S +TG VGE+    A L    FT+TAER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   ++  + SP+  YN   C   R  ++
Sbjct:  414 NKTLVVTTILENPYVMRR-PNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHIL 586          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. UniProt/SwissProt
Match: sp|Q63273|GRIK5_RAT (Glutamate receptor ionotropic, kainate 5 OS=Rattus norvegicus OX=10116 GN=Grik5 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 4.624e-12
Identity = 51/175 (29.14%), Postives = 87/175 (49.71%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPD--AEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  R+ P+  A    E   GF   ++  L++ L FR  +    DG +GA   N S +TG VGE+    A L    FT+TAER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   ++  + SP+  YN   C   R  ++
Sbjct:  414 NKTLVVTTILENPYVMRR-PNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHIL 586          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. UniProt/SwissProt
Match: sp|Q61626|GRIK5_MOUSE (Glutamate receptor ionotropic, kainate 5 OS=Mus musculus OX=10090 GN=Grik5 PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 4.624e-12
Identity = 51/175 (29.14%), Postives = 87/175 (49.71%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPD--AEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  R+ P+  A    E   GF   ++  L++ L FR  +    DG +GA   N S +TG VGE+    A L    FT+TAER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   ++  + SP+  YN   C   R  ++
Sbjct:  414 NKTLVVTTILENPYVMRR-PNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHIL 586          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. UniProt/SwissProt
Match: sp|Q5IS46|GRIK4_PANTR (Glutamate receptor ionotropic, kainate 4 OS=Pan troglodytes OX=9598 GN=GRIK4 PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.635e-10
Identity = 44/172 (25.58%), Postives = 83/172 (48.26%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIR 510
             +N T+ + +++  PY   K    E    +   GF   ++  L++ L F  +I    DG +G   +N + +TG VGE+    A L     T+TAER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   +++ + +P+  Y+   C   R
Sbjct:  413 LFNTTLVVTTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGT-WTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGR 583          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. UniProt/SwissProt
Match: sp|Q16099|GRIK4_HUMAN (Glutamate receptor ionotropic, kainate 4 OS=Homo sapiens OX=9606 GN=GRIK4 PE=2 SV=2)

HSP 1 Score: 62.7734 bits (151), Expect = 1.682e-10
Identity = 44/172 (25.58%), Postives = 83/172 (48.26%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIR 510
             +N T+ + +++  PY   K    E    +   GF   ++  L++ L F  +I    DG +G   +N + +TG VGE+    A L     T+TAER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   +++ + +P+  Y+   C   R
Sbjct:  413 LFNTTLVVTTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGT-WTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGR 583          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. TrEMBL
Match: A0A267FSX5 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g2 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.837e-31
Identity = 69/185 (37.30%), Postives = 107/185 (57.84%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPY--FDRKYPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVVYFEHLWTAI 549
            F N TI+ICS    P+  + + +P+    +    G +  ++  L+ +L+FR  +  P DG++G   +  S F+GCVGE+QR   S+G + FT TA R  VVDFS P+  +   I+    P E K WNV+   +  VW+ V  F+ + +  +++L  FSPFSAYNL L FAI DE+   E++W+ +
Sbjct:  152 FKNETIRICSTEILPFTIYRQTFPNKTVIV---GGMLKDVLDILAARLDFRYSVKVPDDGQWGGPQAGKSYFSGCVGEVQRGIVSIGGSTFTKTAIRDSVVDFSTPLFQEANGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVCAAVTWVLAYFSPFSAYNLRLEFAIADEIWLQEYIWSIV 333          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. TrEMBL
Match: A0A267H134 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g1 PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.241e-30
Identity = 68/185 (36.76%), Postives = 107/185 (57.84%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPY--FDRKYPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVVYFEHLWTAI 549
            F N TI+ICS    P+  + + +P+    +    G +  ++  L+ +L+FR  +  P DG++G   +  S F+GCVGE+QR   S+G + FT TA R  VVDFS P+  +   I+    P E K WNV+   +  VW+ V  F+ + +  +++L  FSPF+AYNL L FAI DE+   E++W+ +
Sbjct:  350 FKNETIRICSTEILPFTIYRQTFPNKTVIV---GGMLKDVLDILAARLDFRYSVKVPDDGQWGGPQAGKSYFSGCVGEVQRGIVSIGGSTFTKTAIRDSVVDFSTPLFQEANGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVCAAVTWVLAYFSPFTAYNLRLEFAIADEIWLQEYIWSIV 531          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. TrEMBL
Match: A0A1I8HDV7 (Lig_chan-Glu_bd domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 1.667e-29
Identity = 70/183 (38.25%), Postives = 100/183 (54.64%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKYPDAEFSLENM--SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVVYFEHLWT 543
            F NA+I  C+    P    K   AE    +   +G++  I+ +LSKKLNFR  + +P DG++G  +  +  F+GCVGE+QR    LGA  FT T  R  V+DFS  + ++   I+        K WNVF  +   +WL +   L + +   +I+  +SPFSA NL L  AI DEV Y E+LWT
Sbjct:  123 FNNASIVACAPPLHPVTTVK---AELGNRSFIGTGYVPDIVEYLSKKLNFRYVLKKPDDGQWGGPVPGSPYFSGCVGEVQRGIVQLGAGTFTKTTLRDSVIDFSADLFAEYNGILVPKPKPSTKMWNVFYPLSWQLWLCLAASLFVAAFCVWIMAYYSPFSAVNLQLECAITDEVNYLEYLWT 302          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. TrEMBL
Match: A0A1I8GRA3 (Lig_chan-Glu_bd domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 2.871e-29
Identity = 70/183 (38.25%), Postives = 100/183 (54.64%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKYPDAEFSLENM--SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVVYFEHLWT 543
            F NA+I  C+    P    K   AE    +   +G++  I+ +LSKKLNFR  + +P DG++G  +  +  F+GCVGE+QR    LGA  FT T  R  V+DFS  + ++   I+        K WNVF  +   +WL +   L + +   +I+  +SPFSA NL L  AI DEV Y E+LWT
Sbjct:  123 FNNASIVACAPPLHPVTTVK---AELGNRSFIGTGYVPDIVEYLSKKLNFRYVLKKPDDGQWGGPVPGSPYFSGCVGEVQRGIVQLGAGTFTKTTLRDSVIDFSADLFAEYNGILVPKPKPSTKMWNVFYPLSWQLWLCLAASLFVAAFCVWIMAYYSPFSAVNLQLECAITDEVNYLEYLWT 302          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. TrEMBL
Match: A0A267EAB3 (Lig_chan-Glu_bd domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031664g1 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 3.872e-29
Identity = 64/183 (34.97%), Postives = 104/183 (56.83%), Query Frame = 1
Query:    7 NATIKICSLVYQPY--FDRKYPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVVYFEHLWTAI 549
            N T+ ICS  Y P+  +  ++P+   S  ++SG I +++  LS ++ FR  +    DG++GA ++ +   TGCVGE+QR  A +G N+FT T+ R + V FS P+  D    +    P E K WN        VW+ +   L+  S  ++++  F+PFS +NL L +A+ DEV Y E++W+ I
Sbjct:   82 NRTLVICSPEYPPFTKYQHEHPN---STVHVSGMIVEVLSFLSSRMKFRYSVKNSFDGQWGAPVAGSRFLTGCVGEVQRGIADIGVNIFTQTSARIQAVQFSVPLFEDVSSALLPMPPIEEKLWNFVGPFSAQVWILLLVALLFGSSLTWLIAYFNPFSLWNLGLNYALIDEVSYKEYIWSFI 261          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Cavefish
Match: si:ch211-264f5.8 (si:ch211-264f5.8 [Source:ZFIN;Acc:ZDB-GENE-081104-209])

HSP 1 Score: 71.633 bits (174), Expect = 1.250e-14
Identity = 52/175 (29.71%), Postives = 87/175 (49.71%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRK--YPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  RK  Y D E + +   GF   ++  LS  L F   I    DG +GA   N S +TG VGE+    A L    FT+T+ER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   ++  + SP+  YN   C   R +++
Sbjct:  378 NKTLTVTTILENPYVMRKENYQDFEGN-DQYEGFCVDMLRELSDILKFSFRIKLVDDGLYGAPEPNGS-WTGMVGELINRKADLAVAGFTITSEREKVIDFSKPFMTLGISILYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERRDLL 550          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Cavefish
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:103024859])

HSP 1 Score: 70.8626 bits (172), Expect = 3.098e-14
Identity = 52/175 (29.71%), Postives = 87/175 (49.71%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRK--YPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ I +++  PY  RK  Y + E + +   GF   ++  LS  L F   I    DG +GA   N S +TG VGE+    A L    FT+T+ER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   ++  + SP+  YN   C   R +++
Sbjct:  428 NKTLIITTILENPYVMRKVNYQELEGN-DQYEGFCVDMLKELSDILKFTFRIKLVDDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTLGISILYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERRDML 600          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Cavefish
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:103024859])

HSP 1 Score: 70.0922 bits (170), Expect = 4.360e-14
Identity = 52/175 (29.71%), Postives = 87/175 (49.71%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRK--YPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ I +++  PY  RK  Y + E + +   GF   ++  LS  L F   I    DG +GA   N S +TG VGE+    A L    FT+T+ER KV+DFS P ++  + I+Y  ++  +  +++        VWL +    + +S   ++  + SP+  YN   C   R +++
Sbjct:  428 NKTLIITTILENPYVMRKVNYQELEGN-DQYEGFCVDMLKELSDILKFTFRIKLVDDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTLGISILYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERRDML 600          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000004586.2 (glutamate receptor ionotropic, kainate 2-like [Source:NCBI gene;Acc:103044887])

HSP 1 Score: 65.855 bits (159), Expect = 1.617e-12
Identity = 46/175 (26.29%), Postives = 84/175 (48.00%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEF-SLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRIL---VWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEV 519
            N ++++ +++ +PY   K  D      +   G+   ++  L+  L FR EI    DG++GA+  +T  + G V E+  + A L      +T  R KV+DFS P ++  + I+Y   P+      VF  +  L   +W+ +    + +S   +++ +FSP+  YN   C    D V
Sbjct:  432 NKSLRVATILEEPYVMFKKSDKPLCGNDRFEGYCVDLLRELASILGFRYEIQLVEDGKYGALEESTGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRK-PNGTN-PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDMV 604          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Cavefish
Match: grik4 (glutamate receptor, ionotropic, kainate 4 [Source:ZFIN;Acc:ZDB-GENE-070821-5])

HSP 1 Score: 65.0846 bits (157), Expect = 2.173e-12
Identity = 47/173 (27.17%), Postives = 84/173 (48.55%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPY--FDRKYPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIR 510
             +N T+ I +++  PY      Y + E + E   GF   ++  L+  L F+  I   +DG +G   +N + +TG VGE+    A L     T+TAER KV+DFS P ++  + I+Y  ++     +++        VWL +    + +S   +++ + +P+  YN   C   R
Sbjct:  404 LFNTTLIITTILENPYVMLRSNYQELEGN-ERYEGFCVDMLKELADILKFKYRIKLVSDGVYGVSGANGT-WTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISIMYRVHMGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVRRLTPYEWYNPHPCLKGR 574          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 4.782e-9
Identity = 39/134 (29.10%), Postives = 64/134 (47.76%), Query Frame = 1
Query:   97 GFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLIS-ITSYILCKFSPFSAYNLDL 495
            GF   I+  LSK + F  ++Y  T+G+ G+ I+   ++ G +GE+    A +     T+  ER +VVDFS P +   + ++       V      +     VW+ +F   +L+S I  +I   FSP   YN  L
Sbjct:  398 GFCIDILKKLSKTVKFTYDLYLVTNGKHGSKIN--GVWNGMIGEVVNMRAHMAVGSLTINEERSEVVDFSVPFVETGISVMVPRSNGTVSPSAFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPV-GYNRQL 528          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000889.1 (pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1 gene:ENSPMAG00000000813.1 transcript:ENSPMAT00000000889.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 3.295e-8
Identity = 32/133 (24.06%), Postives = 61/133 (45.86%), Query Frame = 1
Query:   97 GFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDL 495
            GF   I+  LS  + F  ++Y   +G+ G  I    ++ G VGE+++  A +     T+  ER +VVDFS P +   + ++       V      +     VW+ +F   +++S  +  L ++     +N +L
Sbjct:   89 GFCIDILRKLSTTVRFTYDLYLVVNGKHGKKIQG--VWNGMVGEVEQKRAHMAVGSLTINEERSQVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSAAVWVMMFILCLMLSAIAVWLFEYLSPVGFNRNL 219          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010600.1 (pep scaffold:Pmarinus_7.0:GL477914:43885:60233:1 gene:ENSPMAG00000009599.1 transcript:ENSPMAT00000010600.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 5.350e-7
Identity = 32/130 (24.62%), Postives = 57/130 (43.85%), Query Frame = 1
Query:   97 GFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIR--ILVWLTVFGFLVLISITSYILCKFSPFSA 480
            GF   ++  LS+ L F  ++YQ  D  +G      S ++G +GEI    A +G    T+T ER  VVDF+   +   + I+        +  ++F  +     VW    G    + I + ++ + +   A
Sbjct:  212 GFAVDVLEELSRHLGFTYDLYQAPDNSYGRPGPGGS-WSGLLGEILHKRADVGIGAVTITPERESVVDFTKRFMDRGVAIMLREQHHHQRHADLFSCLAPFATVWA---GLAACVPIVALVVHRLNSIGA 337          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010601.1 (pep scaffold:Pmarinus_7.0:GL477914:44203:59941:1 gene:ENSPMAG00000009599.1 transcript:ENSPMAT00000010601.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 6.027e-7
Identity = 26/81 (32.10%), Postives = 41/81 (50.62%), Query Frame = 1
Query:   97 GFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVII 339
            GF   ++  LS+ L F  ++YQ  D  +G      S ++G +GEI    A +G    T+T ER  VVDF+   +   + I+
Sbjct:  208 GFAVDVLEELSRHLGFTYDLYQAPDNSYGRPGPGGS-WSGLLGEILHKRADVGIGAVTITPERESVVDFTKRFMDRGVAIM 287          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000621.1 (pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 gene:ENSPMAG00000000562.1 transcript:ENSPMAT00000000621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 6.918e-7
Identity = 24/74 (32.43%), Postives = 38/74 (51.35%), Query Frame = 1
Query:   85 ENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFS 306
            +   GF   ++  LSK L F  EI+ P D  +G +      ++G +GE+    A +  +  T+T ER  VVDF+
Sbjct:   18 KKFQGFSVDVMDALSKSLGFSYEIFMPADLSYG-LPQADGTWSGMIGELLNKRADVAISALTITPERESVVDFT 90          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 69.3218 bits (168), Expect = 3.151e-14
Identity = 42/163 (25.77%), Postives = 80/163 (49.08%), Query Frame = 1
Query:    7 NATIKICSLVYQPY-FDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKW-WNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYN 486
            N T+K+ ++   P+ F +   + +     +  G+  +++  LS+ L F+ E+Y   D  FGA    T  + G V E+    A L     T++ ER KV+DF+ P +   L ++    P+E K  + + +  R  +W+ + G ++++    ++   FSPF  Y 
Sbjct:  443 NRTLKVVTIAEAPFIFAQTQTNGQGETRVIIEGYCIELLRKLSEMLRFKFEVYLVPDNNFGAQDPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDLGLTVLIKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYG 605          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 65.855 bits (159), Expect = 3.828e-13
Identity = 41/126 (32.54%), Postives = 64/126 (50.79%), Query Frame = 1
Query:   97 GFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDN-LPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSP 471
            GF   ++  LS+KLNFR EI    +  +G+ +     + G +GE+ R  A +     T+TAER +V+DFS P L   + +I       EV  +         +WLT  G + L+S+  + L +FSP
Sbjct:   29 GFSKDLMELLSRKLNFRYEICISKESSYGSKVEG--QWQGLIGELVREEADIALGPITITAEREEVIDFSKPFLDFRIAMILQQPTGEEVNLFAFLLPFDEKLWLTTLGVVGLVSLIVWFLDRFSP 152          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Nematostella
Match: EDO48352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJC5])

HSP 1 Score: 63.1586 bits (152), Expect = 1.241e-12
Identity = 38/148 (25.68%), Postives = 70/148 (47.30%), Query Frame = 1
Query:   97 GFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFS-FPILSDPLVIIYDNLPSEVK--WWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVVYFE 531
            GF+  I+  L + L+F+ E+Y   DG++G    N+  + G +G++    A L      L+  R +V+D+S  P++    VI+     S     W+   K     +W+T     V++ I  +++ K+SP+   +    F +RD   Y  
Sbjct:   18 GFVIDILISLERDLDFKAEVYIVEDGKYGVYDRNSKRWCGMIGDLIDGKAELALTSLELSLAREEVIDYSNVPLMYHDRVIVMAVKSSYTSHDWFGFTKPFSTTLWITFGAASVILVIVVWLIDKYSPYGHKHHFQVFTLRDSFSYLS 165          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 63.5438 bits (153), Expect = 3.111e-12
Identity = 38/160 (23.75%), Postives = 76/160 (47.50%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYN 486
            + TI++ S    P F     +   S++   G +  ++  LS+ L+F   IY   DG  G     T  + G + E+ +  A L     T+T+ R KV+DF+ P ++  + ++     S   ++   +  +  +W+T+FG ++ + + +++    SPF  Y 
Sbjct:  379 DRTIRVVSFKGSP-FTMPVGNVSSSVDRFEGAVIDLLDRLSEILHFNYTIYMSPDGRVGVENPVTGNWDGVINELIQERADLAVGPITITSHRWKVIDFTQPFMTSGIGVVMGTENSPKPYFRFLEPFKSDLWITIFGAVLGMGVVNWLFSVVSPFGFYG 537          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Nematostella
Match: EDO27308 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9L6])

HSP 1 Score: 59.6918 bits (143), Expect = 6.285e-12
Identity = 34/129 (26.36%), Postives = 64/129 (49.61%), Query Frame = 1
Query:   97 GFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFS-FPILSDPLVIIYDNLPSEVK--WWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPF 474
            GF+  I+  L + L+F+ E+Y   DG++G    N+  + G +G++    A L      L+  R +V+D+S  P++    VI+     S     W+   K     +W+T     V++ I  +++ K+SP+
Sbjct:    2 GFVIDILISLERDLDFKAEVYIVEDGKYGVYDRNSKRWCGMIGDLIDGKAELALTSLELSLAREEVIDYSNVPLMYHDRVIVMAVKSSYTSHDWFGFTKPFSTTLWITFGAASVILVIVVWLIDKYSPY 130          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Medaka
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:101174774])

HSP 1 Score: 70.4774 bits (171), Expect = 3.838e-14
Identity = 50/174 (28.74%), Postives = 85/174 (48.85%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  RK    +F   +   GF   ++  L+  L F  +I    DG +GA   N S +TG VGE+    A L    FT+T+ER KV+DFS P ++  + I+Y   L  +  +++        VWL +    + +S   ++  + SP+  YN   C   R +++
Sbjct:  413 NKTLIVTTILENPYVMRKDNYQDFQGNDQYEGFCVDMLRELADILKFSFKIKLVDDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTLGISILYRVQLGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCMRERRDML 585          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Medaka
Match: ENSORLT00000001416.2 (glutamate receptor ionotropic, kainate 5 [Source:NCBI gene;Acc:101155942])

HSP 1 Score: 70.0922 bits (170), Expect = 4.830e-14
Identity = 51/175 (29.14%), Postives = 89/175 (50.86%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRK--YPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N ++ + +++  PY  RK  Y D + + +   GF   ++  L+  L F  +I    DG +GA   N S +TG VGE+    A L    FT+T+ER KV+DFS P ++  + I+Y  +L  +  +++        VWL +    + +S   ++  + SP+  YN   CF  R +++
Sbjct:  393 NKSLIVTTILENPYVMRKSNYQDYQGN-DQYEGFCVDMLRELAGILKFSFKIKLVDDGLYGAPEPNGS-WTGMVGELIDRKADLAVAGFTITSEREKVIDFSKPFMTLGISILYRVHLGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPYPCFRERRDIL 565          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Medaka
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:101174774])

HSP 1 Score: 70.0922 bits (170), Expect = 5.208e-14
Identity = 50/174 (28.74%), Postives = 85/174 (48.85%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N T+ + +++  PY  RK    +F   +   GF   ++  L+  L F  +I    DG +GA   N S +TG VGE+    A L    FT+T+ER KV+DFS P ++  + I+Y   L  +  +++        VWL +    + +S   ++  + SP+  YN   C   R +++
Sbjct:  423 NKTLIVTTILENPYVMRKDNYQDFQGNDQYEGFCVDMLRELADILKFSFKIKLVDDGLYGAPEPNGS-WTGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTLGISILYRVQLGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCMRERRDML 595          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Medaka
Match: ENSORLT00000026787.1 (glutamate receptor ionotropic, kainate 5 [Source:NCBI gene;Acc:101155942])

HSP 1 Score: 69.707 bits (169), Expect = 6.767e-14
Identity = 51/175 (29.14%), Postives = 89/175 (50.86%), Query Frame = 1
Query:    7 NATIKICSLVYQPYFDRK--YPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVV 522
            N ++ + +++  PY  RK  Y D + + +   GF   ++  L+  L F  +I    DG +GA   N S +TG VGE+    A L    FT+T+ER KV+DFS P ++  + I+Y  +L  +  +++        VWL +    + +S   ++  + SP+  YN   CF  R +++
Sbjct:  424 NKSLIVTTILENPYVMRKSNYQDYQGN-DQYEGFCVDMLRELAGILKFSFKIKLVDDGLYGAPEPNGS-WTGMVGELIDRKADLAVAGFTITSEREKVIDFSKPFMTLGISILYRVHLGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPYPCFRERRDIL 596          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Medaka
Match: grik4 (glutamate ionotropic receptor kainate type subunit 4 [Source:NCBI gene;Acc:101170037])

HSP 1 Score: 66.2402 bits (160), Expect = 1.171e-12
Identity = 46/169 (27.22%), Postives = 82/169 (48.52%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKYPDAEFSLENM-SGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYD-NLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCF 501
             +N T+ + +++  PY   K    EF   +   GF   ++  L++ L F+  I    DG +G   +N + +TG VGE+    A L     T+TAER KV+DFS P ++  + I+Y  +L     +++        VWL +    + +S   +++ + +P+  YN   C 
Sbjct:  413 LFNTTLTVTTILESPYVMLKPNYQEFEGNDRYEGFCVDMLEELAELLKFKYRIRLVGDGLYGVPGANGT-WTGMVGELISRKADLAVAGLTITAEREKVIDFSKPFMTLGISIMYRVHLGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYNPHPCL 580          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Planmine SMEST
Match: SMESG000073231.1 (SMESG000073231.1)

HSP 1 Score: 193.741 bits (491), Expect = 5.234e-60
Identity = 88/183 (48.09%), Postives = 124/183 (67.76%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKYPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVVYFEHLWTAI 549
            F N T K+C++V  PY  +       S+EN+SGF T+I+  L +KLNF P +Y P DG +GA + N ++FTGCVG++Q   A   A  FT+  ER KVVDF++PI+SDP V+IY N  ++ +WWNVF S +  VW   F  L  +SI + I CK+SP+SA+NL L FAI+DE++Y EH+WT++
Sbjct:  176 FLNKTTKVCTIVKNPYITKVNTTGPLSMENVSGFFTRILSSLGEKLNFSPSLYLPRDGRYGAKVENQTLFTGCVGDVQSRKALFAAASFTINDERMKVVDFTYPIMSDPSVVIYQNPVAKSQWWNVFLSFKFEVWTLTFIALFCVSIFATIFCKYSPYSAWNLKLPFAIKDEILYKEHIWTSV 358          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Planmine SMEST
Match: SMESG000080411.1 (SMESG000080411.1)

HSP 1 Score: 193.356 bits (490), Expect = 8.298e-60
Identity = 86/183 (46.99%), Postives = 126/183 (68.85%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKYPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVVYFEHLWTAI 549
            F N T+ IC+L Y P+         F+++N+SGF+ KII HLS KL F P++YQP DG++G  I N +++TGCVGE+Q  NAS  A  FT   ER++VVD+S+P+++DP ++IY N   +V WWN F S +  VW+  F  + LI + + + CKF+PFSA+NL L F I+DE+++ EH+WT+I
Sbjct:  130 FQNKTLSICALEYIPFLKIINKSRSFNMDNISGFLVKIIKHLSLKLEFLPDVYQPHDGQYGVKIENKTIYTGCVGEVQVKNASFAAGCFTFNEERNQVVDYSYPLMTDPQIVIYKNPLPKVHWWNPFLSFKAPVWILTFLSMFLIGVITTLFCKFTPFSAWNLKLNFCIKDEIMFAEHIWTSI 312          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Planmine SMEST
Match: SMESG000073183.1 (SMESG000073183.1)

HSP 1 Score: 190.66 bits (483), Expect = 2.304e-59
Identity = 88/164 (53.66%), Postives = 122/164 (74.39%), Query Frame = 1
Query:   58 KYPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVVYFEHLWTAI 549
            K   + FS+EN+SGF++K++ HLSK LNF P IYQP DG++G  ++N ++++GCVGE+Q  NAS  A  FT   ER++VVD+S+PILSDPLV++Y N  S+V+WWN   S  I VW   F  ++ ISI + ILCK+SPFSA+NL L F+I+DE++  EHLWT+I
Sbjct:    2 KNKSSSFSIENISGFLSKVLKHLSKVLNFNPVIYQPVDGQYGVKLNNNTVYSGCVGELQTKNASFAAGSFTFNDERNQVVDYSYPILSDPLVVMYQNPSSKVRWWNFLLSFNINVWCLTFISMLAISIFTTILCKYSPFSAWNLCLPFSIKDEILLKEHLWTSI 165          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Planmine SMEST
Match: SMESG000080367.1 (SMESG000080367.1)

HSP 1 Score: 186.037 bits (471), Expect = 4.516e-55
Identity = 85/182 (46.70%), Postives = 121/182 (66.48%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKYPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVVYFEHLWTA 546
            F N TIKICS+ Y P+F +      +S +N+SGF+ KII HL+K+  F+ EIY+P DG+ G  I N ++F+GCVGE+Q  NAS  A+ FT   ER  V+D+S+P +S+  +II+ N   +  WWN F S ++ VW   FG L  +SI + + C++ PFSA+NL L FA+RDE+   EHLWT+
Sbjct:  357 FRNKTIKICSMEYVPFFTKYNKSLPYSKDNISGFLAKIIKHLAKEFQFQFEIYEPLDGQSGVRIKNKTIFSGCVGEVQTKNASFAASTFTFNDERMTVIDYSYPFMSESQIIIFQNPLPKSHWWNPFLSFKVSVWALTFGSLAFVSILAMVFCRWGPFSAWNLKLQFAVRDEIQLGEHLWTS 538          
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Planmine SMEST
Match: SMESG000073173.1 (SMESG000073173.1)

HSP 1 Score: 178.333 bits (451), Expect = 1.556e-52
Identity = 83/183 (45.36%), Postives = 120/183 (65.57%), Query Frame = 1
Query:    1 FYNATIKICSLVYQPYFDRKYPDAEFSLENMSGFITKIIWHLSKKLNFRPEIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVDFSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSYILCKFSPFSAYNLDLCFAIRDEVVYFEHLWTAI 549
            F N TIKIC++   P+  RK     F ++NMSGF+ KI+ HLSK L FR  IY   DG +G  I     F+GCVG++Q+  A + A++FT T++R  VVD+++PI+SDPL IIY       KW+NV  ++ + +WL +   ++L+S T+ ++CK SPFSA+NL L FAI DE+ + E+ WT I
Sbjct:  269 FSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVI 451          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK57.658e-1329.14glutamate ionotropic receptor kainate type subunit... [more]
GRIK59.094e-1329.14glutamate ionotropic receptor kainate type subunit... [more]
GRIK59.094e-1329.14glutamate ionotropic receptor kainate type subunit... [more]
GRIK43.503e-1125.58glutamate ionotropic receptor kainate type subunit... [more]
GRIK43.503e-1125.58glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-44.170e-1328.15GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-45.673e-1328.15GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-32.012e-1024.81GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-57.243e-922.89GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-72.197e-826.25GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KaiR1D4.619e-1124.32gene:FBgn0038837 transcript:FBtr0083987[more]
clumsy1.250e-1024.59gene:FBgn0026255 transcript:FBtr0081476[more]
clumsy1.723e-1024.59gene:FBgn0026255 transcript:FBtr0110895[more]
Ir8a2.359e-1029.85gene:FBgn0052704 transcript:FBtr0071333[more]
CG111556.082e-1023.16gene:FBgn0039927 transcript:FBtr0089194[more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grik57.024e-1529.89glutamate receptor, ionotropic, kainate 5 [Source:... [more]
grik51.572e-1429.89glutamate receptor, ionotropic, kainate 5 [Source:... [more]
grik51.651e-1429.89glutamate receptor, ionotropic, kainate 5 [Source:... [more]
grid1b1.555e-1124.24glutamate receptor, ionotropic, delta 1b [Source:Z... [more]
grid1b1.584e-1124.24glutamate receptor, ionotropic, delta 1b [Source:Z... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ogfr1.726e-1528.74opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr1.918e-1528.74opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr6.628e-1528.74opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr7.487e-1528.74opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr8.179e-1528.74opioid growth factor receptor [Source:Xenbase;Acc:... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grik56.611e-1329.14glutamate receptor, ionotropic, kainate 5 (gamma 2... [more]
Grik43.389e-1125.58glutamate receptor, ionotropic, kainate 4 [Source:... [more]
Grik43.389e-1125.58glutamate receptor, ionotropic, kainate 4 [Source:... [more]
Grid11.550e-1028.46glutamate receptor, ionotropic, delta 1 [Source:MG... [more]
Gria34.265e-922.01glutamate receptor, ionotropic, AMPA3 (alpha 3) [S... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16478|GRIK5_HUMAN4.367e-1229.14Glutamate receptor ionotropic, kainate 5 OS=Homo s... [more]
sp|Q63273|GRIK5_RAT4.624e-1229.14Glutamate receptor ionotropic, kainate 5 OS=Rattus... [more]
sp|Q61626|GRIK5_MOUSE4.624e-1229.14Glutamate receptor ionotropic, kainate 5 OS=Mus mu... [more]
sp|Q5IS46|GRIK4_PANTR1.635e-1025.58Glutamate receptor ionotropic, kainate 4 OS=Pan tr... [more]
sp|Q16099|GRIK4_HUMAN1.682e-1025.58Glutamate receptor ionotropic, kainate 4 OS=Homo s... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FSX52.837e-3137.30PBPe domain-containing protein (Fragment) OS=Macro... [more]
A0A267H1341.241e-3036.76PBPe domain-containing protein (Fragment) OS=Macro... [more]
A0A1I8HDV71.667e-2938.25Lig_chan-Glu_bd domain-containing protein OS=Macro... [more]
A0A1I8GRA32.871e-2938.25Lig_chan-Glu_bd domain-containing protein OS=Macro... [more]
A0A267EAB33.872e-2934.97Lig_chan-Glu_bd domain-containing protein (Fragmen... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-264f5.81.250e-1429.71si:ch211-264f5.8 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
grik53.098e-1429.71glutamate ionotropic receptor kainate type subunit... [more]
grik54.360e-1429.71glutamate ionotropic receptor kainate type subunit... [more]
ENSAMXT00000004586.21.617e-1226.29glutamate receptor ionotropic, kainate 2-like [Sou... [more]
grik42.173e-1227.17glutamate receptor, ionotropic, kainate 4 [Source:... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010716.14.782e-929.10pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
ENSPMAT00000000889.13.295e-824.06pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1... [more]
ENSPMAT00000010600.15.350e-724.62pep scaffold:Pmarinus_7.0:GL477914:43885:60233:1 g... [more]
ENSPMAT00000010601.16.027e-732.10pep scaffold:Pmarinus_7.0:GL477914:44203:59941:1 g... [more]
ENSPMAT00000000621.16.918e-732.43pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 ... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO302033.151e-1425.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412913.828e-1332.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483521.241e-1225.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466333.111e-1223.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273086.285e-1226.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grik53.838e-1428.74glutamate ionotropic receptor kainate type subunit... [more]
ENSORLT00000001416.24.830e-1429.14glutamate receptor ionotropic, kainate 5 [Source:N... [more]
grik55.208e-1428.74glutamate ionotropic receptor kainate type subunit... [more]
ENSORLT00000026787.16.767e-1429.14glutamate receptor ionotropic, kainate 5 [Source:N... [more]
grik41.171e-1227.22glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073231.15.234e-6048.09SMESG000073231.1[more]
SMESG000080411.18.298e-6046.99SMESG000080411.1[more]
SMESG000073183.12.304e-5953.66SMESG000073183.1[more]
SMESG000080367.14.516e-5546.70SMESG000080367.1[more]
SMESG000073173.11.556e-5245.36SMESG000073173.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006651 ID=SMED30006651|Name=Glutamate receptor, ionotropic kainate 2-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=551bp
TTTTACAATGCAACTATAAAAATATGTTCCCTTGTCTACCAACCCTATTT
TGATAGAAAATATCCAGATGCTGAATTTTCTCTAGAAAACATGTCCGGAT
TTATTACAAAAATTATTTGGCATTTATCTAAAAAGTTAAACTTTCGTCCG
GAAATTTATCAACCGACTGATGGGGAATTCGGGGCGATAATTAGCAACAC
TTCAATGTTTACAGGCTGCGTTGGAGAAATTCAGAGGAATAATGCGTCAT
TAGGAGCAAATTTGTTTACTTTGACCGCCGAAAGACATAAAGTTGTGGAT
TTCAGTTTCCCCATATTATCAGACCCTTTGGTGATAATATATGACAATCT
ACCCTCCGAAGTAAAGTGGTGGAATGTATTTAAGTCAATACGGATATTAG
TTTGGTTGACAGTGTTTGGATTTCTTGTTTTAATTTCTATAACCTCTTAT
ATTCTATGCAAATTTAGCCCATTTTCAGCATACAATTTAGATTTATGCTT
TGCAATTAGAGATGAAGTAGTATATTTTGAGCATTTGTGGACTGCTATTG
G
back to top

protein sequence of SMED30006651-orf-1

>SMED30006651-orf-1 ID=SMED30006651-orf-1|Name=SMED30006651-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=183bp
FYNATIKICSLVYQPYFDRKYPDAEFSLENMSGFITKIIWHLSKKLNFRP
EIYQPTDGEFGAIISNTSMFTGCVGEIQRNNASLGANLFTLTAERHKVVD
FSFPILSDPLVIIYDNLPSEVKWWNVFKSIRILVWLTVFGFLVLISITSY
ILCKFSPFSAYNLDLCFAIRDEVVYFEHLWTAI
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
GO:0005515protein binding
GO:0008066glutamate receptor activity
GO:0015277kainate selective glutamate receptor activity
GO:0017124SH3 domain binding
GO:0030165PDZ domain binding
GO:0042802identical protein binding
GO:0004872receptor activity
GO:0005216ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR019594Glu/Gly-bd
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005783endoplasmic reticulum
GO:0005886plasma membrane
GO:0008328ionotropic glutamate receptor complex
GO:0014069postsynaptic density
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030424axon
GO:0030425dendrite
GO:0032983kainate selective glutamate receptor complex
GO:0042734presynaptic membrane
GO:0043005neuron projection
GO:0043025neuronal cell body
GO:0043195terminal bouton
GO:0043204perikaryon
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0006621protein retention in ER lumen
GO:0006810transport
GO:0006811ion transport
GO:0007268chemical synaptic transmission
GO:0031630regulation of synaptic vesicle fusion to presynaptic active zone membrane
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0035249synaptic transmission, glutamatergic
GO:0035725sodium ion transmembrane transport
GO:0042391regulation of membrane potential
GO:0043113receptor clustering
GO:0043525positive regulation of neuron apoptotic process
GO:0051649establishment of localization in cell
GO:0060079excitatory postsynaptic potential
GO:0071333cellular response to glucose stimulus
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainSMARTSM00918Lig_chan_Glu_bd_2coord: 15..79
e-value: 0.0028
score: 26.9
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainPFAMPF10613Lig_chan-Glu_bdcoord: 5..114
e-value: 7.7E-18
score: 64.8
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 119..162
e-value: 1.6E-27
score: 98.2
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 30..108
e-value: 1.6E-27
score: 98.2
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 109..118
e-value: 1.6E-27
score: 98.2
NoneNo IPR availablePANTHERPTHR18966:SF354coord: 3..160
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 3..160
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 5..147
NoneNo IPR availableTMHMMTMhelixcoord: 132..151