Elongation factor Tu

Overview
NameElongation factor Tu
Smed IDSMED30006638
Length (bp)1376
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Elongation factor Tu (SMED30006638) t-SNE clustered cells

Violin plots show distribution of expression levels for Elongation factor Tu (SMED30006638) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Elongation factor Tu (SMED30006638) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Elongation factor Tu (SMED30006638) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006638

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006638SMESG000068535.1 SmedASXL_008351SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006638SMESG000068535.1 SmedASXL_008351SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30006638SMESG000068535.1 dd_Smed_v4_818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006638SMESG000068535.1 dd_Smed_v4_818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006638SMESG000068535.1 dd_Smed_v4_818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006638SMESG000068535.1 dd_Smed_v4_818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006638SMESG000068535.1 dd_Smed_v4_818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006638SMESG000068535.1 dd_Smed_v4_818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006638SMESG000068535.1 dd_Smed_v4_818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006638SMESG000068535.1 dd_Smed_v4_818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006638SMESG000068535.1 SMESG000022112.1 Contig8234newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006638SMESG000068535.1 SMESG000022112.1 Contig8234uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006638SMESG000068535.1 Contig52052newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006638SMESG000068535.1 Contig52052uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gamma neoblastSMED30006638SMESG000068535.1 dd_Smed_v6_818_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Elongation factor Tu vs. Ensembl Human
Match: TUFM (Tu translation elongation factor, mitochondrial [Source:HGNC Symbol;Acc:HGNC:12420])

HSP 1 Score: 452.595 bits (1163), Expect = 2.080e-156
Identity = 231/393 (58.78%), Postives = 301/393 (76.59%), Query Frame = 1
Query:  157 KKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAA-DSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAG-ITLGYGVVGKLL 1326
            KK ++RD+PH+NVGTIGHVDHGKTTLTAAITK+L+E   + FK+YEEID APEER RGITINAA V+YST  RHYAHTDCPGHADYVKNMITGT  ++  ILVVA  +G MPQTREHL+LARQIG+EH+V+++NKADA  DSEM+ELVELEIRELLT +GY G++TP +VGSALCALEGR+ E+G K + +LLD +D  IP+P R+ +KP  LP+E + S+ GRGTV TG +ERGI+  G   E+LG++ NI+T +TGIEMFH+ L++A  GD +G L+RG+K+E+LRRG+++  P S++     +AQ+Y+LS+ EGGR KP  + +   ++S +WD     +LP  K+L MPGED    +   + M LE GQRFT+R G  T+G G+V   L
Sbjct:   51 KKTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSVQKLLDAVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIKPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTL 443          
BLAST of Elongation factor Tu vs. Ensembl Human
Match: EEF1A2 (eukaryotic translation elongation factor 1 alpha 2 [Source:HGNC Symbol;Acc:HGNC:3192])

HSP 1 Score: 172.17 bits (435), Expect = 8.956e-48
Identity = 123/376 (32.71%), Postives = 184/376 (48.94%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN-----------------EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDC 1164
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    E    EI + ++ Y    GY+    PFV    +    G N                  + G    + LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE GI+ PG+ V       NI T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    KS   Q A    +Q+ +L+         ISA Y   I     DC
Sbjct:    3 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFV---PISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFA--PVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILN-----HPGQISAGYSPVI-----DC 363          
BLAST of Elongation factor Tu vs. Ensembl Human
Match: EEF1A2 (eukaryotic translation elongation factor 1 alpha 2 [Source:HGNC Symbol;Acc:HGNC:3192])

HSP 1 Score: 172.17 bits (435), Expect = 1.787e-47
Identity = 123/376 (32.71%), Postives = 184/376 (48.94%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN-----------------EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDC 1164
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    E    EI + ++ Y    GY+    PFV    +    G N                  + G    + LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE GI+ PG+ V       NI T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    KS   Q A    +Q+ +L+         ISA Y   I     DC
Sbjct:    3 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFV---PISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFA--PVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILN-----HPGQISAGYSPVI-----DC 363          
BLAST of Elongation factor Tu vs. Ensembl Human
Match: EEF1A1 (eukaryotic translation elongation factor 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:3189])

HSP 1 Score: 167.548 bits (423), Expect = 4.328e-46
Identity = 112/352 (31.82%), Postives = 178/352 (50.57%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN-----------------EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS---VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    +    EI + ++ Y    GY+ D   FV    +    G N                  + G      LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE G++ PG+ V       N+ T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    K+   ++ A +  AQ+ +L+
Sbjct:    3 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFV---PISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFA--PVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFT-AQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Human
Match: EEF1A1 (eukaryotic translation elongation factor 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:3189])

HSP 1 Score: 167.548 bits (423), Expect = 4.328e-46
Identity = 112/352 (31.82%), Postives = 178/352 (50.57%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN-----------------EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS---VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    +    EI + ++ Y    GY+ D   FV    +    G N                  + G      LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE G++ PG+ V       N+ T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    K+   ++ A +  AQ+ +L+
Sbjct:    3 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFV---PISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFA--PVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFT-AQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Celegans
Match: tufm-1 (Elongation factor Tu homologue; TU elongation Factor (EF-Tu), Mitochondrial [Source:UniProtKB/TrEMBL;Acc:G5ECM6])

HSP 1 Score: 385.185 bits (988), Expect = 7.287e-130
Identity = 206/426 (48.36%), Postives = 293/426 (68.78%), Query Frame = 1
Query:   79 KSSIVKNSKFSTSQCIFAQPIIQPGGKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGI--EHLVIFINKADAA-DSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRID-EIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNAN---IKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRG-MIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAGI-TLGYGVVGKLLP 1329
            K+  +   K      + A+ +  PGGK  F RD+PH+NVGTIGHVDHGKTTLT+AITK+L+ +  + +++YE+ID APEE+ RGITINA  ++Y T  RHYAH DCPGHADY+KNMITG  QME AILVVA T+G MPQTREHL+LARQ+G+  +++V+F+NK D   D+E  ELVE++IRE L  +GY GD  P + GSALCALEG+  EIG + + +LL+ +D +  +P R+ ++      E++ SI GRGTV TG++ERGI+  G  +EI+G   +   +K+ I+G+E F + +D+A PGDQ+GVLLRG+  +++RRG +++      ++ +   AQ+Y+L ESEGG   PI+  +   ++S +WD  A   +  GKD VMPGE + V++    +M +E  QRFT+R G  T+G GV   +LP
Sbjct:   15 KTVTLCEQKMQQVSLMQARHLAVPGGKAVFKRDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFHLEYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMPQTREHLLLARQVGVPLDNIVVFMNKVDEVPDAETRELVEMDIREQLNEFGYPGDTCPVIFGSALCALEGKQPEIGEEAVKQLLEVLDNKFVIPERKVNEEPMFAAEHVYSIVGRGTVITGKLERGILKRGDKIEIVGGTKDGTTVKSVISGLESFRKTVDQAEPGDQLGVLLRGLGPKDVRRGCVLLPQGHKHKVTDKVKAQLYVLKESEGGAKTPIANYFSEHVFSLTWDSGASVRII-GKDFVMPGESAEVELSLNSQMFIEPQQRFTIRKGAKTIGTGVFTDVLP 439          
BLAST of Elongation factor Tu vs. Ensembl Celegans
Match: tufm-1 (Elongation factor Tu homologue; TU elongation Factor (EF-Tu), Mitochondrial [Source:UniProtKB/TrEMBL;Acc:G5ECM6])

HSP 1 Score: 385.185 bits (988), Expect = 7.287e-130
Identity = 206/426 (48.36%), Postives = 293/426 (68.78%), Query Frame = 1
Query:   79 KSSIVKNSKFSTSQCIFAQPIIQPGGKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGI--EHLVIFINKADAA-DSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRID-EIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNAN---IKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRG-MIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAGI-TLGYGVVGKLLP 1329
            K+  +   K      + A+ +  PGGK  F RD+PH+NVGTIGHVDHGKTTLT+AITK+L+ +  + +++YE+ID APEE+ RGITINA  ++Y T  RHYAH DCPGHADY+KNMITG  QME AILVVA T+G MPQTREHL+LARQ+G+  +++V+F+NK D   D+E  ELVE++IRE L  +GY GD  P + GSALCALEG+  EIG + + +LL+ +D +  +P R+ ++      E++ SI GRGTV TG++ERGI+  G  +EI+G   +   +K+ I+G+E F + +D+A PGDQ+GVLLRG+  +++RRG +++      ++ +   AQ+Y+L ESEGG   PI+  +   ++S +WD  A   +  GKD VMPGE + V++    +M +E  QRFT+R G  T+G GV   +LP
Sbjct:   15 KTVTLCEQKMQQVSLMQARHLAVPGGKAVFKRDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFHLEYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMPQTREHLLLARQVGVPLDNIVVFMNKVDEVPDAETRELVEMDIREQLNEFGYPGDTCPVIFGSALCALEGKQPEIGEEAVKQLLEVLDNKFVIPERKVNEEPMFAAEHVYSIVGRGTVITGKLERGILKRGDKIEIVGGTKDGTTVKSVISGLESFRKTVDQAEPGDQLGVLLRGLGPKDVRRGCVLLPQGHKHKVTDKVKAQLYVLKESEGGAKTPIANYFSEHVFSLTWDSGASVRII-GKDFVMPGESAEVELSLNSQMFIEPQQRFTIRKGAKTIGTGVFTDVLP 439          
BLAST of Elongation factor Tu vs. Ensembl Celegans
Match: tufm-2 (Mitochondrial elongation factor Tu homologue; TU elongation Factor (EF-Tu), Mitochondrial [Source:UniProtKB/TrEMBL;Acc:G5EDF5])

HSP 1 Score: 318.161 bits (814), Expect = 1.992e-104
Identity = 168/383 (43.86%), Postives = 249/383 (65.01%), Query Frame = 1
Query:  184 HMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAG---ITLGYGVVGKL 1323
            ++NVGTIGH+DHGKTTLT+AIT+V ++   +   +++EIDK  EE+KRGITIN A + Y +  R Y+HTDCPGH+D++KNMI GT+QM+ A+LV+A T+G M QT+EHL+LA+Q+G++++ IFINKAD  + + ++LVE+E RELL+ +G++GD TP + GSAL ALEG++       I  L+D +D +P P R       +PI +  +ITGRGTV  G +ERG++  G  VEI G    ++TT + I++F + + +   GD  GVL RGVK + ++RGM    P +V + N    ++YLLSE+E GR   I   +  ++Y  +WD           +L+MPGE +   +  +K M L  G  FT+R G    T+  G++  L
Sbjct:   45 NVNVGTIGHIDHGKTTLTSAITRVQAKKGFAKHIKFDEIDKGKEEKKRGITINVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVMEQTKEHLILAKQVGVKNMAIFINKADLVEEDDLDLVEMEARELLSLHGFNGDATPVIRGSALSALEGQDISC----IERLIDALDSLPEPDRNEKDTFVMPIASKTAITGRGTVIVGTLERGVLKKGDKVEIKGDGQTLQTTASDIQVFGKSVKEVRAGDHCGVLCRGVKGDTVKRGMWAGHPGAVTITNRVKVELYLLSEAENGRKIGIRTGFTDKMYCSTWD--QVGRFDMSNELLMPGEHTSATVLLMKDMPLRKGMPFTLREGSSKTTIARGIISDL 421          
BLAST of Elongation factor Tu vs. Ensembl Celegans
Match: eef-1A.2 (Elongation factor 1-alpha [Source:UniProtKB/Swiss-Prot;Acc:P53013])

HSP 1 Score: 174.096 bits (440), Expect = 7.131e-49
Identity = 119/351 (33.90%), Postives = 177/351 (50.43%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSAL-----------------CALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K   E  +  FK    +DK   ER+RGITI+ A+  + T   +    D PGH D++KNMITGT+Q + A+LVVA   G          QTREH +LA+ +G++ L++  NK D+ +    E    EI   ++ +    GY+    PFV  S                    A+E +      K +LE LD I  IP P R  D+PL LP++++  I G GTV  GRVE GII PG+ V       N+ T +  +EM H+ L +AVPGD VG  ++ V  +++RRG + +  K    + A    AQ+ +++
Sbjct:    3 KEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERKEGNASGKTLLEALDSI--IP-PQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFA--PQNVTTEVKSVEMHHESLPEAVPGDNVGFNVKNVSVKDIRRGSVCSDSKQDPAKEARTFHAQVIIMN 348          
BLAST of Elongation factor Tu vs. Ensembl Celegans
Match: eef-1A.2 (Elongation factor 1-alpha [Source:UniProtKB/Swiss-Prot;Acc:P53013])

HSP 1 Score: 174.096 bits (440), Expect = 7.131e-49
Identity = 119/351 (33.90%), Postives = 177/351 (50.43%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSAL-----------------CALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K   E  +  FK    +DK   ER+RGITI+ A+  + T   +    D PGH D++KNMITGT+Q + A+LVVA   G          QTREH +LA+ +G++ L++  NK D+ +    E    EI   ++ +    GY+    PFV  S                    A+E +      K +LE LD I  IP P R  D+PL LP++++  I G GTV  GRVE GII PG+ V       N+ T +  +EM H+ L +AVPGD VG  ++ V  +++RRG + +  K    + A    AQ+ +++
Sbjct:    3 KEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERKEGNASGKTLLEALDSI--IP-PQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFA--PQNVTTEVKSVEMHHESLPEAVPGDNVGFNVKNVSVKDIRRGSVCSDSKQDPAKEARTFHAQVIIMN 348          
BLAST of Elongation factor Tu vs. Ensembl Fly
Match: mEFTu1 (gene:FBgn0024556 transcript:FBtr0087670)

HSP 1 Score: 480.33 bits (1235), Expect = 3.572e-167
Identity = 236/393 (60.05%), Postives = 308/393 (78.37%), Query Frame = 1
Query:  157 KKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAG-ITLGYGVVGKLLP 1329
            KK F R +PH NVGTIGHVDHGKTTLTAAITKVL++   +  K+Y EID APEE+ RGITIN A V+Y T+ RHY HTDCPGHADY+KNMITGT QM+ AILVVA T+G+MPQTREH++LA+QIGI+H+V+FINK DAAD EM++LVE+EIRELLT  GYDGDK P V GSALCALE ++ EIG + IL+LL  +D  IP P RE DKP  LP+EN+ SI GRGTV TGR+ERG++  G+  E +GYN  +K+T+TG+EMFHQ+L++A  GDQ+G L+RGVK+++++RGM++  P SV+  +  +AQ+Y+LS+ EGGR+KP  +  Q Q++S++WDC     +P+ K++VMPGED+ + +  ++ M LE GQRFT+R G +TLG GVV   LP
Sbjct:   73 KKVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVVFINKVDAADEEMVDLVEMEIRELLTEMGYDGDKIPVVKGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVVTGRLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWDCAVQVQIPD-KEMVMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGVVTSTLP 464          
BLAST of Elongation factor Tu vs. Ensembl Fly
Match: mEFTu1 (gene:FBgn0024556 transcript:FBtr0301389)

HSP 1 Score: 480.33 bits (1235), Expect = 3.572e-167
Identity = 236/393 (60.05%), Postives = 308/393 (78.37%), Query Frame = 1
Query:  157 KKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAG-ITLGYGVVGKLLP 1329
            KK F R +PH NVGTIGHVDHGKTTLTAAITKVL++   +  K+Y EID APEE+ RGITIN A V+Y T+ RHY HTDCPGHADY+KNMITGT QM+ AILVVA T+G+MPQTREH++LA+QIGI+H+V+FINK DAAD EM++LVE+EIRELLT  GYDGDK P V GSALCALE ++ EIG + IL+LL  +D  IP P RE DKP  LP+EN+ SI GRGTV TGR+ERG++  G+  E +GYN  +K+T+TG+EMFHQ+L++A  GDQ+G L+RGVK+++++RGM++  P SV+  +  +AQ+Y+LS+ EGGR+KP  +  Q Q++S++WDC     +P+ K++VMPGED+ + +  ++ M LE GQRFT+R G +TLG GVV   LP
Sbjct:   73 KKVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVVFINKVDAADEEMVDLVEMEIRELLTEMGYDGDKIPVVKGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVVTGRLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWDCAVQVQIPD-KEMVMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGVVTSTLP 464          
BLAST of Elongation factor Tu vs. Ensembl Fly
Match: mEFTu2 (gene:FBgn0033184 transcript:FBtr0088981)

HSP 1 Score: 379.793 bits (974), Expect = 3.154e-128
Identity = 191/389 (49.10%), Postives = 274/389 (70.44%), Query Frame = 1
Query:  169 LRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRA-GITLGYGVVGKLLP 1329
            LR+ PH NVGTIGHVDHGKTTLTAAIT++ S+   + +  Y++ID+APEE+ RGITINA  + YST  R YAHTDCPGHADY+KNMI+G +QM+ AILVVA T+G MPQTREHL+LA+Q+GI+ +++FINKAD  D E++ELVE+E+RE+L+ +G+DG  +P + GSAL AL     E G   I +LL++ D  IP P R+   P  LPI+N  ++ GRGTV  G ++RG I      ++LG+N N+KT+I+ I++F + + +A  G+ VG LLRG+K   + RGM++    S  ++N+ +  +YLLS +EGGR KP+ + Y  Q++S++W+ PA   +   + ++MPGE   V++  L+KM +  GQ FT+R  G T+  G+V + LP
Sbjct:   52 LRELPHCNVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQIDRAPEEKARGITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMPQTREHLLLAKQVGIQRIIVFINKADLVDQEVLELVEIEMREMLSDFGFDGVNSPVICGSALLALREDKSEFGVPSIEKLLEQCDSYIPTPQRDISSPFILPIDNAFTVPGRGTVVVGTIKRGTIPRNADADLLGFNQNLKTSISDIQIFRKSVPQAQAGENVGALLRGIKISAVERGMLLCATGSEDISNHFEGSMYLLSRAEGGRVKPMLSKYIQQLFSQTWNVPARIDIVPSEAMLMPGEHGQVRVTLLRKMVMTPGQAFTIRENGATVATGMVTQRLP 440          
BLAST of Elongation factor Tu vs. Ensembl Fly
Match: eEF1alpha2 (gene:FBgn0000557 transcript:FBtr0085835)

HSP 1 Score: 171.4 bits (433), Expect = 7.414e-48
Identity = 114/332 (34.34%), Postives = 172/332 (51.81%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY-----------------GYDGD-------KTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPP-READKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMI 1026
            +++ H+N+  IGHVD GK+T T  +                K   E  +  FK    +DK   ER+RGITI+ A+  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    E    EI++ ++ Y                 G+ GD       K P+  G ++   EG+ E    K +++ LD I    LPP R  DKPL LP++++  I G GTV  GRVE G++ PG+ V       N+ T +  +EM H+ L +A+PGD VG  ++ V  +ELRRG +
Sbjct:    3 KEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAE---GKCLIDALDAI----LPPQRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVNFA--PVNLVTEVKSVEMHHEALTEAMPGDNVGFNVKNVSVKELRRGYV 325          
BLAST of Elongation factor Tu vs. Ensembl Fly
Match: eEF1alpha2 (gene:FBgn0000557 transcript:FBtr0085834)

HSP 1 Score: 171.4 bits (433), Expect = 7.414e-48
Identity = 114/332 (34.34%), Postives = 172/332 (51.81%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY-----------------GYDGD-------KTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPP-READKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMI 1026
            +++ H+N+  IGHVD GK+T T  +                K   E  +  FK    +DK   ER+RGITI+ A+  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    E    EI++ ++ Y                 G+ GD       K P+  G ++   EG+ E    K +++ LD I    LPP R  DKPL LP++++  I G GTV  GRVE G++ PG+ V       N+ T +  +EM H+ L +A+PGD VG  ++ V  +ELRRG +
Sbjct:    3 KEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAE---GKCLIDALDAI----LPPQRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVNFA--PVNLVTEVKSVEMHHEALTEAMPGDNVGFNVKNVSVKELRRGYV 325          
BLAST of Elongation factor Tu vs. Ensembl Zebrafish
Match: tufm (Tu translation elongation factor, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-050320-73])

HSP 1 Score: 454.907 bits (1169), Expect = 1.035e-157
Identity = 224/394 (56.85%), Postives = 291/394 (73.86%), Query Frame = 1
Query:  154 GKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXX-XXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRID-EIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAG-ITLGYGVVGKLL 1326
             KK F RD+PH+N+GTIGHVDHGKTTLTAAITKVL+E   + +K YE+ID APEE+ RGITINA+ V+Y+T NRHYAHTDCPGHADYVKNMITGT QM+  ILVVA T+G MPQTREHL+LARQIG++H+V++INKADA D + +  +     RELLT +GYDG+ TP VVGSALCALE +  E+G   I++LL+ ID  IPLP R+ DKP  +P++ + SI GRGTV +G +ERG+I  G   E LG+N   K+ ITGIEMFH+ LD+A  GD +G L+RG+K+E++RRGM++  P S+Q      AQ+Y+LS+ EGGR KP    +   ++S +WD      L  GK++VMPGED+ V +   + MAL+ GQRFT+R G  T+G G+V  +L
Sbjct:   42 AKKVFARDKPHLNIGTIGHVDHGKTTLTAAITKVLAEAGGANYKSYEDIDNAPEEKARGITINASHVEYTTANRHYAHTDCPGHADYVKNMITGTAQMDGCILVVAATDGQMPQTREHLLLARQIGVQHVVVYINKADAVDDKEMLDLVELEIRELLTEFGYDGENTPVVVGSALCALENKKPELGVNSIMKLLEVIDGHIPLPSRDLDKPFLMPVDGVYSIPGRGTVVSGTLERGVIKKGDECEFLGHNRCFKSIITGIEMFHKSLDRAEAGDNMGALIRGLKREDVRRGMVMIKPGSIQPHQKIRAQVYILSKEEGGRHKPFFTNFTPIMFSLTWDMACIVELLPGKEMVMPGEDTAVNLILRQPMALDKGQRFTLRDGNQTIGTGLVTDIL 435          
BLAST of Elongation factor Tu vs. Ensembl Zebrafish
Match: eef1a1l1 (eukaryotic translation elongation factor 1 alpha 1, like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-188])

HSP 1 Score: 176.407 bits (446), Expect = 1.279e-49
Identity = 117/349 (33.52%), Postives = 181/349 (51.86%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFV------------VGSALCALEGRNEEI--GAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS---VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ A+  + T   +    D PGH D++KNMITGT+Q + A+L+VAG  G          QTREH +LA  +G++ L++ +NK D+ +    +    EI + ++ Y    GY+     FV              S +   +G   E   G      LLD +D I  P R  DKPL LP++++  I G GTV  GRVE G++ PG+ V      AN+ T +  +EM H+ L +A PGD VG  ++ V  +++RRG +    K+   ++ AN+ +AQ+ +L+
Sbjct:    3 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKKIGYNPASVAFVPISGWHGDNMLEASSNMGWFKGWKIERKEGNASGTTLLDALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFA--PANVTTEVKSVEMHHESLTEATPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPMEAANF-NAQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Zebrafish
Match: eef1a1l1 (eukaryotic translation elongation factor 1 alpha 1, like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-188])

HSP 1 Score: 176.407 bits (446), Expect = 1.279e-49
Identity = 117/349 (33.52%), Postives = 181/349 (51.86%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFV------------VGSALCALEGRNEEI--GAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS---VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ A+  + T   +    D PGH D++KNMITGT+Q + A+L+VAG  G          QTREH +LA  +G++ L++ +NK D+ +    +    EI + ++ Y    GY+     FV              S +   +G   E   G      LLD +D I  P R  DKPL LP++++  I G GTV  GRVE G++ PG+ V      AN+ T +  +EM H+ L +A PGD VG  ++ V  +++RRG +    K+   ++ AN+ +AQ+ +L+
Sbjct:    3 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKKIGYNPASVAFVPISGWHGDNMLEASSNMGWFKGWKIERKEGNASGTTLLDALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFA--PANVTTEVKSVEMHHESLTEATPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPMEAANF-NAQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Zebrafish
Match: eef1a1b (eukaryotic translation elongation factor 1 alpha 1b [Source:ZFIN;Acc:ZDB-GENE-050417-327])

HSP 1 Score: 173.326 bits (438), Expect = 2.233e-48
Identity = 115/351 (32.76%), Postives = 177/351 (50.43%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN-----------------EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    +    EI + ++ Y    GY+ D   FV    +    G N                  + G+     LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE GI+ PGL V       N+ T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    K+   Q A    AQ+ +L+
Sbjct:    3 KEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKKIGYNPDTVAFV---PISGWNGDNMLEASPNMTWFKGWKITRKDGSSSGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGLVVTFA--PVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAASFTAQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Zebrafish
Match: eef1a1l2 (eukaryotic translation elongation factor 1 alpha 1, like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-188])

HSP 1 Score: 173.326 bits (438), Expect = 2.233e-48
Identity = 115/351 (32.76%), Postives = 177/351 (50.43%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN-----------------EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    +    EI + ++ Y    GY+ D   FV    +    G N                  + G+     LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE GI+ PGL V       N+ T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    K+   Q A    AQ+ +L+
Sbjct:    3 KEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKKIGYNPDTVAFV---PISGWNGDNMLEASPNMTWFKGWKITRKDGSSSGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGLVVTFA--PVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAASFTAQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Xenopus
Match: tubb4a (tubulin beta 4A class IVa [Source:NCBI gene;Acc:394927])

HSP 1 Score: 404.06 bits (1037), Expect = 2.806e-138
Identity = 201/361 (55.68%), Postives = 269/361 (74.52%), Query Frame = 1
Query:  253 VLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXX-XXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAGI-TLGYGVVGKLL 1326
            VL+E   + FK+YEEID APEE+ RGITINA+ V+Y+T NRHYAHTDCPGHADYVKNMITGT+QM+  ILVVA T+G MPQTREHL+LA+QIG+ ++ ++INKADA D + +  + ELE+RELLT +GYDG+ TP + GSALCALE RN +IG   I+ LLD +D  IP+PPRE DKP  LP+E + SI GRGTV TG +ERGII  G   E +G N +IK+ +TGIEMFHQ LD+A  GD +G L+RG+K+E+++RGM+++ P S++      AQ+Y+LS+ EGGR KP  + +   ++S +WD      LP  K++VMPGED+ + +   + M LE+GQRFT+R G  T+G G+V ++L
Sbjct:   23 VLAEAGGAQFKKYEEIDNAPEEKARGITINASHVEYATANRHYAHTDCPGHADYVKNMITGTSQMDGCILVVAATDGQMPQTREHLLLAKQIGVTNIEVYINKADAVDDKEMLDLGELEVRELLTEFGYDGENTPIITGSALCALENRNPDIGLNSIMTLLDAVDTYIPVPPRELDKPFLLPVEAVYSIPGRGTVVTGTLERGIIKKGDECEFVGRNKHIKSVVTGIEMFHQNLDRAEAGDNLGALVRGLKREDVKRGMVMSKPGSIRPHQKIQAQVYILSKEEGGRHKPFVSNFLPVMFSLTWDMSCRVTLPANKEMVMPGEDTALTLTLRQPMVLEIGQRFTLRDGNRTIGTGLVTEIL 383          
BLAST of Elongation factor Tu vs. Ensembl Xenopus
Match: tubb4a (tubulin beta 4A class IVa [Source:NCBI gene;Acc:394927])

HSP 1 Score: 399.053 bits (1024), Expect = 9.706e-136
Identity = 198/352 (56.25%), Postives = 264/352 (75.00%), Query Frame = 1
Query:  280 FKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXX-XXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAGI-TLGYGVVGKLL 1326
            FK+YEEID APEE+ RGITINA+ V+Y+T NRHYAHTDCPGHADYVKNMITGT+QM+  ILVVA T+G MPQTREHL+LA+QIG+ ++ ++INKADA D + +  + ELE+RELLT +GYDG+ TP + GSALCALE RN +IG   I+ LLD +D  IP+PPRE DKP  LP+E + SI GRGTV TG +ERGII  G   E +G N +IK+ +TGIEMFHQ LD+A  GD +G L+RG+K+E+++RGM+++ P S++      AQ+Y+LS+ EGGR KP  + +   ++S +WD      LP  K++VMPGED+ + +   + M LE+GQRFT+R G  T+G G+V ++L
Sbjct:   77 FKKYEEIDNAPEEKARGITINASHVEYATANRHYAHTDCPGHADYVKNMITGTSQMDGCILVVAATDGQMPQTREHLLLAKQIGVTNIEVYINKADAVDDKEMLDLGELEVRELLTEFGYDGENTPIITGSALCALENRNPDIGLNSIMTLLDAVDTYIPVPPRELDKPFLLPVEAVYSIPGRGTVVTGTLERGIIKKGDECEFVGRNKHIKSVVTGIEMFHQNLDRAEAGDNLGALVRGLKREDVKRGMVMSKPGSIRPHQKIQAQVYILSKEEGGRHKPFVSNFLPVMFSLTWDMSCRVTLPANKEMVMPGEDTALTLTLRQPMVLEIGQRFTLRDGNRTIGTGLVTEIL 428          
BLAST of Elongation factor Tu vs. Ensembl Xenopus
Match: eef1a2 (eukaryotic translation elongation factor 1 alpha 2 [Source:NCBI gene;Acc:496898])

HSP 1 Score: 172.17 bits (435), Expect = 7.249e-48
Identity = 124/376 (32.98%), Postives = 184/376 (48.94%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN-----------------EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDC 1164
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ INK D+ +    E    EI + ++ Y    GY+    PFV    +    G N                  + G    + LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE GI+ PG+ V       NI T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    KS   Q A    +Q+ +L+         ISA Y   I     DC
Sbjct:    3 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETNKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPYSEKRYDEIVKEVSAYIKKIGYNPATVPFV---PISGWHGDNMLEPSPNMPWFKGWKVERKEGNANGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFA--PVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAGFTSQVIILN-----HPGQISAGYSPVI-----DC 363          
BLAST of Elongation factor Tu vs. Ensembl Xenopus
Match: anp32b (acidic nuclear phosphoprotein 32 family member B [Source:Xenbase;Acc:XB-GENE-988727])

HSP 1 Score: 169.474 bits (428), Expect = 8.244e-47
Identity = 113/349 (32.38%), Postives = 181/349 (51.86%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFV------------VGSALCALEGRNEEI--GAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS---VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VAG  G          QTREH +LA  +G++ L+I +NK D+ +    +    EI + ++ Y    GY+    PFV              + +   +G   E   G    + LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE G++ PG+ V      +N+ T +  +EM H+ L +A+PGD VG  ++ +  +++RRG +    K+   +Q   +  AQ+ +L+
Sbjct:    3 KEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETGKFYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIIGVNKMDSTEPPFSQKRFEEITKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEASTNMPWFKGWKIERKEGNASGVTLLEALDCIIPPQRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFA--PSNVTTEVKSVEMHHEALQEALPGDNVGFNVKNISVKDIRRGNVAGDSKNDPPMQAGTFT-AQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Xenopus
Match: eef1a1 (eukaryotic translation elongation factor 1 alpha 1 [Source:NCBI gene;Acc:549446])

HSP 1 Score: 167.548 bits (423), Expect = 3.689e-46
Identity = 107/328 (32.62%), Postives = 167/328 (50.91%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN-----------------EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMI 1026
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    +    EI + ++ Y    GY+ D   FV    +    G N                  + G+     LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE G++ PG+ V       N+ T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +
Sbjct:    3 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFV---PISGWNGDNMLEPSANMPWFKGWKISRKEGSGSGTTLLEALDCILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFA--PVNVTTEVKSVEMHHEALSEAMPGDNVGFNVKNVSVKDVRRGNV 325          
BLAST of Elongation factor Tu vs. Ensembl Mouse
Match: Tufm (Tu translation elongation factor, mitochondrial [Source:MGI Symbol;Acc:MGI:1923686])

HSP 1 Score: 459.144 bits (1180), Expect = 3.362e-159
Identity = 233/390 (59.74%), Postives = 302/390 (77.44%), Query Frame = 1
Query:  154 GKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAA-DSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAG-ITLGYGVV 1314
             KK ++RD+PH+NVGTIGHVDHGKTTLTAAITK+L+E   + FK+YEEID APEER RGITINAA V+YST  RHYAHTDCPGHADYVKNMITGT  ++  ILVVA  +G MPQTREHL+LA+QIG+EH+V+++NKADA  DSEM+ELVELEIRELLT +GY G++TP +VGSALCALE R+ E+G K + +LLD +D  IP+P R+ DKP  LP+E++ SI GRGTV TG +ERGI+  G   E+LG+N NI+T +TGIEMFH+ L++A  GD +G L+RG+K+E+LRRG+++  P S+Q     +AQ+Y+LS+ EGGR KP  + +   ++S +WD     +LP GK+L MPGED  + +   + M LE GQRFT+R G  T+G G+V
Sbjct:   47 AKKTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVVVYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEQRDPELGVKSVQKLLDAVDTYIPVPTRDLDKPFLLPVESVYSIPGRGTVVTGTLERGILKKGDECELLGHNKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIQPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRVILPPGKELAMPGEDLKLSLILRQPMILEKGQRFTLRDGNKTIGTGLV 436          
BLAST of Elongation factor Tu vs. Ensembl Mouse
Match: Tufm (Tu translation elongation factor, mitochondrial [Source:MGI Symbol;Acc:MGI:1923686])

HSP 1 Score: 387.497 bits (994), Expect = 1.963e-131
Identity = 197/309 (63.75%), Postives = 251/309 (81.23%), Query Frame = 1
Query:  157 KKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAA-DSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQI 1077
            KK ++RD+PH+NVGTIGHVDHGKTTLTAAITK+L+E   + FK+YEEID APEER RGITINAA V+YST  RHYAHTDCPGHADYVKNMITGT  ++  ILVVA  +G MPQTREHL+LA+QIG+EH+V+++NKADA  DSEM+ELVELEIRELLT +GY G++TP +VGSALCALE R+ E+G K + +LLD +D  IP+P R+ DKP  LP+E++ SI GRGTV TG +ERGI+  G   E+LG+N NI+T +TGIEMFH+ L++A  GD +G L+RG+K+E+LRRG+++  P S+Q     +AQ+
Sbjct:   48 KKTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVVVYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEQRDPELGVKSVQKLLDAVDTYIPVPTRDLDKPFLLPVESVYSIPGRGTVVTGTLERGILKKGDECELLGHNKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIQPHQKVEAQV 356          
BLAST of Elongation factor Tu vs. Ensembl Mouse
Match: Eef1a2 (eukaryotic translation elongation factor 1 alpha 2 [Source:MGI Symbol;Acc:MGI:1096317])

HSP 1 Score: 171.014 bits (432), Expect = 1.553e-47
Identity = 122/376 (32.45%), Postives = 184/376 (48.94%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN-----------------EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDC 1164
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    E    EI + ++ Y    GY+    PFV    +    G N                  + G    + LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE GI+ PG+ V       NI T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    K+   Q A    +Q+ +L+         ISA Y   I     DC
Sbjct:    3 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFV---PISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFA--PVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKADPPQEAAQFTSQVIILN-----HPGQISAGYSPVI-----DC 363          
BLAST of Elongation factor Tu vs. Ensembl Mouse
Match: Eef1a1 (eukaryotic translation elongation factor 1 alpha 1 [Source:MGI Symbol;Acc:MGI:1096881])

HSP 1 Score: 168.703 bits (426), Expect = 1.109e-46
Identity = 112/352 (31.82%), Postives = 179/352 (50.85%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN-----------------EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS---VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    +    EI + ++ Y    GY+ D   FV    +    G N                  + G+     LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE G++ PG+ V       N+ T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    K+   ++ A +  AQ+ +L+
Sbjct:    3 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFV---PISGWNGDNMLEPSANMPWFKGWKVTRKDGSASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFA--PVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFT-AQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Mouse
Match: Tufm (Tu translation elongation factor, mitochondrial [Source:MGI Symbol;Acc:MGI:1923686])

HSP 1 Score: 121.324 bits (303), Expect = 9.096e-33
Identity = 77/134 (57.46%), Postives = 96/134 (71.64%), Query Frame = 1
Query:  457 ILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERG 855
            ILVVA  +G MPQTREHL+LA+Q                DSEM+ELVELEIRELLT +GY G++TP +VGSALCALE R+ E+G K + +LLD +D  IP+P R+ DKP  LP+E++ SI GRGTV TG +ERG
Sbjct:    1 ILVVAANDGPMPQTREHLLLAKQ----------------DSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEQRDPELGVKSVQKLLDAVDTYIPVPTRDLDKPFLLPVESVYSIPGRGTVVTGTLERG 118          
BLAST of Elongation factor Tu vs. UniProt/SwissProt
Match: sp|Q8BFR5|EFTU_MOUSE (Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 2.351e-158
Identity = 233/390 (59.74%), Postives = 302/390 (77.44%), Query Frame = 1
Query:  154 GKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAA-DSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAG-ITLGYGVV 1314
             KK ++RD+PH+NVGTIGHVDHGKTTLTAAITK+L+E   + FK+YEEID APEER RGITINAA V+YST  RHYAHTDCPGHADYVKNMITGT  ++  ILVVA  +G MPQTREHL+LA+QIG+EH+V+++NKADA  DSEM+ELVELEIRELLT +GY G++TP +VGSALCALE R+ E+G K + +LLD +D  IP+P R+ DKP  LP+E++ SI GRGTV TG +ERGI+  G   E+LG+N NI+T +TGIEMFH+ L++A  GD +G L+RG+K+E+LRRG+++  P S+Q     +AQ+Y+LS+ EGGR KP  + +   ++S +WD     +LP GK+L MPGED  + +   + M LE GQRFT+R G  T+G G+V
Sbjct:   47 AKKTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVVVYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEQRDPELGVKSVQKLLDAVDTYIPVPTRDLDKPFLLPVESVYSIPGRGTVVTGTLERGILKKGDECELLGHNKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIQPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRVILPPGKELAMPGEDLKLSLILRQPMILEKGQRFTLRDGNKTIGTGLV 436          
BLAST of Elongation factor Tu vs. UniProt/SwissProt
Match: sp|P85834|EFTU_RAT (Elongation factor Tu, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tufm PE=1 SV=1)

HSP 1 Score: 457.218 bits (1175), Expect = 1.374e-157
Identity = 232/390 (59.49%), Postives = 302/390 (77.44%), Query Frame = 1
Query:  154 GKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAA-DSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAG-ITLGYGVV 1314
             KK ++RD+PH+NVGTIGHVDHGKTTLTAAITK+L+E   + FK+YEEID APEER RGITINAA V+YST  RHYAHTDCPGHADYVKNMITGT  ++  ILVVA  +G MPQTREHL+LA+QIG+EH+V+++NKADA  DSEM+ELVELEIRELLT +GY G++TP +VGSALCALE R+ E+G K + +LLD +D  IP+P R+ +KP  LP+E++ SI GRGTV TG +ERGI+  G   E+LG+N NI+T +TGIEMFH+ L++A  GD +G L+RG+K+E+LRRG+++  P S+Q     +AQ+Y+LS+ EGGR KP  + +   ++S +WD     +LP GK+L MPGED  + +   + M LE GQRFT+R G  T+G G+V
Sbjct:   47 AKKTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVVVYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEQRDPELGVKSVQKLLDAVDTYIPVPTRDLEKPFLLPVESVYSIPGRGTVVTGTLERGILKKGDECELLGHNKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIQPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRVILPPGKELAMPGEDLKLSLILRQPMILEKGQRFTLRDGNKTIGTGLV 436          
BLAST of Elongation factor Tu vs. UniProt/SwissProt
Match: sp|P49410|EFTU_BOVIN (Elongation factor Tu, mitochondrial OS=Bos taurus OX=9913 GN=TUFM PE=1 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 6.049e-157
Identity = 232/389 (59.64%), Postives = 301/389 (77.38%), Query Frame = 1
Query:  157 KKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAA-DSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAG-ITLGYGVV 1314
            KK ++RD+PH+NVGTIGHVDHGKTTLTAAITK+L+E   + FK+YEEID APEER RGITINAA V+YST  RHYAHTDCPGHADYVKNMITGT  ++  ILVVA  +G MPQTREHL+LARQIG+EH+V+++NKADA  DSEM+ELVELEIRELLT +GY G++TP +VGSALCALE R+ E+G K + +LLD +D  IP+P R+ +KP  LP+E++ SI GRGTV TG +ERGI+  G   E LG++ NI+T +TGIEMFH+ LD+A  GD +G L+RG+K+E+LRRG+++  P S+Q     +AQ+Y+L++ EGGR KP  + +   ++S +WD     +LP GK+L MPGED  + +   + M LE GQRFT+R G  T+G G+V
Sbjct:   48 KKTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPIIVGSALCALEQRDPELGLKSVQKLLDAVDTYIPVPTRDLEKPFLLPVESVYSIPGRGTVVTGTLERGILKKGDECEFLGHSKNIRTVVTGIEMFHKSLDRAEAGDNLGALVRGLKREDLRRGLVMAKPGSIQPHQKVEAQVYILTKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPGKELAMPGEDLKLTLILRQPMILEKGQRFTLRDGNRTIGTGLV 436          
BLAST of Elongation factor Tu vs. UniProt/SwissProt
Match: sp|P49411|EFTU_HUMAN (Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2)

HSP 1 Score: 452.21 bits (1162), Expect = 1.051e-155
Identity = 231/393 (58.78%), Postives = 301/393 (76.59%), Query Frame = 1
Query:  157 KKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAA-DSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAG-ITLGYGVVGKLL 1326
            KK ++RD+PH+NVGTIGHVDHGKTTLTAAITK+L+E   + FK+YEEID APEER RGITINAA V+YST  RHYAHTDCPGHADYVKNMITGT  ++  ILVVA  +G MPQTREHL+LARQIG+EH+V+++NKADA  DSEM+ELVELEIRELLT +GY G++TP +VGSALCALEGR+ E+G K + +LLD +D  IP+P R+ +KP  LP+E + S+ GRGTV TG +ERGI+  G   E+LG++ NI+T +TGIEMFH+ L++A  GD +G L+RG+K+E+LRRG+++  P S++     +AQ+Y+LS+ EGGR KP  + +   ++S +WD     +LP  K+L MPGED    +   + M LE GQRFT+R G  T+G G+V   L
Sbjct:   48 KKTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSVQKLLDAVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIKPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTL 440          
BLAST of Elongation factor Tu vs. UniProt/SwissProt
Match: sp|A5DN78|EFTU_PICGU (Elongation factor Tu, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) OX=294746 GN=TUF1 PE=3 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 9.601e-143
Identity = 214/397 (53.90%), Postives = 290/397 (73.05%), Query Frame = 1
Query:  163 AFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADS-XXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILG-YNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGK-----DLVMPGEDSMVKMHFLKKMALEVGQRFTMR-AGITLGYGVVGKLL 1326
            AF R +PH+N+GTIGHVDHGKTTLTAAITKVLSE   + F  Y  ID+APEER RGITI+ A V+Y T  RHYAH DCPGHADY+KNMITG  QM+ AI+VVA T+G MPQTREHL+LARQ+G++HLV+F+NK D  D  EM+ELVE+E+RELL++YG+DGD TP ++GSALCALE +  EIG + I +LLD +DE IP P R+ ++P  LP+E++ SI+GRGTV TGRVERG +  G  +EI+G ++   KTT+TGIEMF + LD A+ GD  G+LLRGVK+++++RGM++  P +V       A +Y+LS+ EGGR  P    Y+ Q++ ++ D       P G+      +VMPG++  +++  ++K  LEV QRF +R  G T+G G+V +++
Sbjct:   29 AFDRSKPHVNIGTIGHVDHGKTTLTAAITKVLSEKGGANFLDYGSIDRAPEERARGITISTAHVEYQTDKRHYAHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHLVVFVNKVDTIDDPEMLELVEMEMRELLSQYGFDGDNTPVIMGSALCALESKQPEIGVQAIEKLLDAVDEHIPTPTRDLEQPFLLPVEDVFSISGRGTVVTGRVERGSLKKGEEIEIVGDFDKPFKTTVTGIEMFKKELDAAMAGDNAGILLRGVKRDDVKRGMVLAKPSTVTSHKKVLASLYILSKEEGGRHSPFGENYKPQLFIRTTDVTGTLRFPAGEGVDHSQMVMPGDNVEMEIELVRKTPLEVNQRFNIREGGKTVGTGLVTRII 425          
BLAST of Elongation factor Tu vs. TrEMBL
Match: A0A1S8WQH5 (Elongation factor Tu (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_07540 PE=3 SV=1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 284/409 (69.44%), Postives = 346/409 (84.60%), Query Frame = 1
Query:  130 AQPIIQPGGKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRA-GITLGYGVVGKLLPDPGPGKWE 1353
            A P + PG KKA++RDRPHMN+GTIGHVDHGKTTLTAAITK+LSE  Q++F+ YEEID APEE+KRGITINAA+VDY T NRHYAHTDCPGHADYVKNMITG NQME AILVVA T+G+MPQTREHL+LA+QIGIE LV+FINKADAAD EM+ELVELE+R+ L +YG+DGD TP V GSALCALEG++ ++G +KILELL+ IDE+PLP RE DKP  LP+E++ SITGRGTV TGR+ERG I+   PVEI+GYN ++K+T+TGIEMFHQLL +A  GDQVG+LLRG+K++E+RRG ++  PKS  + NY  AQ+Y+LS+ EGGR+KP    YQ Q++SKSWDCPAY +LPE K++VMPGED+ +++ F KKM LE GQRFT+RA G TLGYGVV K+LPDPG G W+
Sbjct:   23 AVPNVAPGAKKAYVRDRPHMNIGTIGHVDHGKTTLTAAITKILSEKKQTIFRSYEEIDAAPEEKKRGITINAAVVDYCTDNRHYAHTDCPGHADYVKNMITGANQMECAILVVAATDGTMPQTREHLLLAKQIGIEKLVVFINKADAADPEMLELVELEVRDTLKQYGFDGDNTPIVTGSALCALEGKDPQVGREKILELLNVIDEVPLPKREKDKPFLLPVEHVFSITGRGTVVTGRIERGTIALQAPVEIIGYNQSLKSTVTGIEMFHQLLSQAEAGDQVGLLLRGIKRDEIRRGQVVCEPKSQSMQNYIQAQVYMLSKKEGGRAKPFLNRYQLQVFSKSWDCPAYIILPENKEMVMPGEDATIELDFQKKMVLEPGQRFTLRASGNTLGYGVVSKILPDPGRGNWD 431          
BLAST of Elongation factor Tu vs. TrEMBL
Match: A0A075AGI1 (Elongation factor Tu OS=Opisthorchis viverrini OX=6198 GN=T265_04525 PE=3 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 284/409 (69.44%), Postives = 346/409 (84.60%), Query Frame = 1
Query:  130 AQPIIQPGGKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRA-GITLGYGVVGKLLPDPGPGKWE 1353
            A P + PG KKA++RDRPHMN+GTIGHVDHGKTTLTAAITK+LSE  Q++F+ YEEID APEE+KRGITINAA+VDY T NRHYAHTDCPGHADYVKNMITG NQME AILVVA T+G+MPQTREHL+LA+QIGIE LV+FINKADAAD EM+ELVELE+R+ L +YG+DGD TP V GSALCALEG++ ++G +KILELL+ IDE+PLP RE DKP  LP+E++ SITGRGTV TGR+ERG I+   PVEI+GYN ++K+T+TGIEMFHQLL +A  GDQVG+LLRG+K++E+RRG ++  PKS  + NY  AQ+Y+LS+ EGGR+KP    YQ Q++SKSWDCPAY +LPE K++VMPGED+ +++ F KKM LE GQRFT+RA G TLGYGVV K+LPDPG G W+
Sbjct:   37 AVPNVAPGAKKAYVRDRPHMNIGTIGHVDHGKTTLTAAITKILSEKKQTIFRSYEEIDAAPEEKKRGITINAAVVDYCTDNRHYAHTDCPGHADYVKNMITGANQMECAILVVAATDGTMPQTREHLLLAKQIGIEKLVVFINKADAADPEMLELVELEVRDTLKQYGFDGDNTPIVTGSALCALEGKDPQVGREKILELLNVIDEVPLPKREKDKPFLLPVEHVFSITGRGTVVTGRIERGTIALQAPVEIIGYNQSLKSTVTGIEMFHQLLSQAEAGDQVGLLLRGIKRDEIRRGQVVCEPKSQSMQNYIQAQVYMLSKKEGGRAKPFLNRYQLQVFSKSWDCPAYIILPENKEMVMPGEDATIELDFQKKMVLEPGQRFTLRASGNTLGYGVVSKILPDPGRGNWD 445          
BLAST of Elongation factor Tu vs. TrEMBL
Match: A0A4Z2D2Z8 (Elongation factor Tu OS=Schistosoma japonicum OX=6182 GN=EWB00_005114 PE=3 SV=1)

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 278/406 (68.47%), Postives = 340/406 (83.74%), Query Frame = 1
Query:  142 IQPGGKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMR-AGITLGYGVVGKLLPDPGPGKWEK 1356
            + PG K A++RD+PHMN+GTIGHVDHGKTTLTAAITKVL+E N SV++ YEEID APEER+RGITINAA+VDY+T NRHYAHTDCPGHADY+KNMITG NQME AILVVA T+G+MPQTREHL+LA+QIGIE LV+FINKADAAD EM+ELVELE+R+ L +YG+DGD T  V GSALCALE R+ ++G +KI ELLD ID +PLP RE DKP  LPIE + SITGRGTV TGR+ERG +    PVEI+GY+  +K+T+TGIEMFHQLLD+A PGDQVGVLLRGVK++E+RRG  +  PKS+ + +Y  +Q+Y+LS+ EGGR+KP +  +Q  I+SKSWDC A  +LPEG++++MPGED+ V +HF KKMALEVGQRFT+R +G TLGYGV+GK+L  PGPG W K
Sbjct:   22 VVPGIKTAYVRDKPHMNIGTIGHVDHGKTTLTAAITKVLAEKNSSVYRSYEEIDAAPEERRRGITINAAVVDYTTSNRHYAHTDCPGHADYIKNMITGANQMECAILVVAATDGTMPQTREHLLLAKQIGIEKLVVFINKADAADPEMLELVELEVRDTLKQYGFDGDNTSVVSGSALCALENRDHKLGKEKIEELLDVIDSVPLPKREKDKPFLLPIEQVFSITGRGTVVTGRIERGTLKLQSPVEIIGYSQTLKSTVTGIEMFHQLLDQAEPGDQVGVLLRGVKRDEVRRGQFVVEPKSISMHDYVQSQVYMLSKKEGGRTKPFTNNHQFHIFSKSWDCSALLVLPEGREMIMPGEDAAVNLHFQKKMALEVGQRFTIRCSGTTLGYGVIGKVLSGPGPGNWSK 427          
BLAST of Elongation factor Tu vs. TrEMBL
Match: A0A4Z2D3P3 (Elongation factor Tu OS=Schistosoma japonicum OX=6182 GN=EWB00_005114 PE=3 SV=1)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 285/439 (64.92%), Postives = 353/439 (80.41%), Query Frame = 1
Query:   43 IKFVYKLLAAPTKSSIVKNSKFSTSQCIFAQPIIQPGGKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMR-AGITLGYGVVGKLLPDPGPGKWEK 1356
            ++FVY L  +   +S  +       Q I  +  + PG K A++RD+PHMN+GTIGHVDHGKTTLTAAITKVL+E N SV++ YEEID APEER+RGITINAA+VDY+T NRHYAHTDCPGHADY+KNMITG NQME AILVVA T+G+MPQTREHL+LA+QIGIE LV+FINKADAAD EM+ELVELE+R+ L +YG+DGD T  V GSALCALE R+ ++G +KI ELLD ID +PLP RE DKP  LPIE + SITGRGTV TGR+ERG +    PVEI+GY+  +K+T+TGIEMFHQLLD+A PGDQVGVLLRGVK++E+RRG  +  PKS+ + +Y  +Q+Y+LS+ EGGR+KP +  +Q  I+SKSWDC A  +LPEG++++MPGED+ V +HF KKMALEVGQRFT+R +G TLGYGV+GK+L  PGPG W K
Sbjct:    7 LRFVYSLPLSRAVTS--RTWPLQVVQNI--RSYVVPGIKTAYVRDKPHMNIGTIGHVDHGKTTLTAAITKVLAEKNSSVYRSYEEIDAAPEERRRGITINAAVVDYTTSNRHYAHTDCPGHADYIKNMITGANQMECAILVVAATDGTMPQTREHLLLAKQIGIEKLVVFINKADAADPEMLELVELEVRDTLKQYGFDGDNTSVVSGSALCALENRDHKLGKEKIEELLDVIDSVPLPKREKDKPFLLPIEQVFSITGRGTVVTGRIERGTLKLQSPVEIIGYSQTLKSTVTGIEMFHQLLDQAEPGDQVGVLLRGVKRDEVRRGQFVVEPKSISMHDYVQSQVYMLSKKEGGRTKPFTNNHQFHIFSKSWDCSALLVLPEGREMIMPGEDAAVNLHFQKKMALEVGQRFTIRCSGTTLGYGVIGKVLSGPGPGNWSK 441          
BLAST of Elongation factor Tu vs. TrEMBL
Match: C1LF71 (Elongation factor Tu OS=Schistosoma japonicum OX=6182 GN=EfTuM PE=2 SV=1)

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 286/439 (65.15%), Postives = 354/439 (80.64%), Query Frame = 1
Query:   43 IKFVYKLLAAPTKSSIVKNSKFSTSQCIFAQPIIQPGGKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMR-AGITLGYGVVGKLLPDPGPGKWEK 1356
            ++FVY L   P   ++   S+    Q I  +  + PG K A++RD+PHMN+GTIGHVDHGKTTLTAAITKVL+E N SV++ YEEID APEER+RGITINAA+VDY+T NRHYAHTDCPGHADY+KNMITG NQME AILVVA T+G+MPQTREHL+LA+QIGIE LV+FINKADAAD EM+ELVELE+R+ L +YG+DGD T  V GSALCALE R+ ++G +KI ELLD ID +PLP RE DKP  LPIE + SITGRGTV TGR+ERG +    PVEI+GY+  +K+T+TGIEMFHQLLD+A PGDQVGVLLRGVK++E+RRG  +  PKS+ + +Y  +Q+Y+LS+ EGGR+KP +  +Q  I+SKSWDC A  +LPEG++++MPGED+ V +HF KKMALEVGQRFT+R +G TLGYGV+GK+L  PGPG W K
Sbjct:    7 LRFVYSL---PLSRAV--TSRTWPLQNI--RSYVVPGIKTAYVRDKPHMNIGTIGHVDHGKTTLTAAITKVLAEKNSSVYRSYEEIDAAPEERRRGITINAAVVDYTTSNRHYAHTDCPGHADYIKNMITGANQMECAILVVAATDGTMPQTREHLLLAKQIGIEKLVVFINKADAADPEMLELVELEVRDTLKQYGFDGDNTSVVSGSALCALENRDHKLGKEKIEELLDVIDSVPLPKREKDKPFLLPIEQVFSITGRGTVVTGRIERGTLKLQSPVEIIGYSQTLKSTVTGIEMFHQLLDQAEPGDQVGVLLRGVKRDEVRRGQFVVEPKSISMHDYVQSQVYMLSKKEGGRTKPFTNNHQFHIFSKSWDCSALLVLPEGREMIMPGEDAAVNLHFQKKMALEVGQRFTIRCSGTTLGYGVIGKVLSGPGPGNWSK 438          
BLAST of Elongation factor Tu vs. Ensembl Cavefish
Match: eef1a1l2 (elongation factor 1-alpha 1-like [Source:NCBI gene;Acc:103029695])

HSP 1 Score: 171.785 bits (434), Expect = 6.383e-48
Identity = 115/348 (33.05%), Postives = 179/348 (51.44%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSA------------LCALEGR--NEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    +    EI + ++ Y    GY+ +   FV  S             +   +G   N + G+     LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE GI+ PGL V       N+ T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    K+   Q A    AQ+ +L+
Sbjct:    3 KEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKKIGYNPETVAFVPISGWNGDNMLEASPNMTWFKGWKINRKDGSVSGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGLVVTFA--PVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAATFTAQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Cavefish
Match: eef1a2 (elongation factor 1-alpha 2 [Source:NCBI gene;Acc:103045590])

HSP 1 Score: 169.088 bits (427), Expect = 5.764e-47
Identity = 116/349 (33.24%), Postives = 180/349 (51.58%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFV------------VGSALCALEGRN---EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    E    EI + ++ Y    GY     PFV              S +   +G     +E+ A  +  LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE G++ PG+ V       NI T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    +S   Q A+   AQ+ +L+
Sbjct:    3 KEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVAVNKMDSTEPPYSEKRYDEIVKEVSAYIKKIGYSPAAVPFVPISGWHGDNMLESSSNMPWFKGWKLDRKELHATGVT-LLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLRPGMVVTFA--PVNITTEVKSVEMHHESLTEALPGDNVGFNVKNVSVKDIRRGNVCGDSRSDPPQEASGFTAQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Cavefish
Match: EEF1A1 (elongation factor 1-alpha 1 [Source:NCBI gene;Acc:103021740])

HSP 1 Score: 168.318 bits (425), Expect = 6.677e-47
Identity = 114/351 (32.48%), Postives = 176/351 (50.14%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN-----------------EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ INK D+ +    +    EI + ++ Y    GY+ +   FV    +    G N                  + G      LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE GI+ PG+ V       N+ T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    K+   Q A    AQ+ +L+
Sbjct:    3 KEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKKIGYNPETVAFV---PISGWNGDNMLEASPNMTWFKGWKITRKEGNVSGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFA--PVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAAVFTAQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Cavefish
Match: ENSAMXT00000052370.1 (elongation factor 1-alpha [Source:NCBI gene;Acc:103044018])

HSP 1 Score: 168.703 bits (426), Expect = 9.355e-47
Identity = 114/349 (32.66%), Postives = 178/349 (51.00%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFV------------VGSALCALEGRNEEI--GAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS---VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ A+  + T   +    D PGH D++KNMITGT+Q + A+L+VAG  G          QTREH +LA  +G++ L++ +NK D+ +    +    EI + ++ Y    GY+     FV              S +   +G   E   G      LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE G++ PG+ V        + T +  +EM H+ L +A+PGD VG  ++ V  +E+RRG +    K+   ++  N+  AQ+ +L+
Sbjct:    3 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKKIGYNPATVAFVPISGWHGDNMLEPSSNMGWFKGWKIERKEGGSSGTTLLEALDSILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFA--PVAVTTEVKSVEMHHESLAEALPGDNVGFNVKNVSVKEIRRGNVAGDSKNDPPMEAGNFT-AQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Cavefish
Match: EEF1A1 (elongation factor 1-alpha 1 [Source:NCBI gene;Acc:103021740])

HSP 1 Score: 168.703 bits (426), Expect = 9.748e-47
Identity = 114/351 (32.48%), Postives = 176/351 (50.14%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN-----------------EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ INK D+ +    +    EI + ++ Y    GY+ +   FV    +    G N                  + G      LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE GI+ PG+ V       N+ T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    K+   Q A    AQ+ +L+
Sbjct:    3 KEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKKIGYNPETVAFV---PISGWNGDNMLEASPNMTWFKGWKITRKEGNVSGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFA--PVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAAVFTAQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011427.1 (pep scaffold:Pmarinus_7.0:GL499053:103:1494:1 gene:ENSPMAG00000010399.1 transcript:ENSPMAT00000011427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.236 bits (417), Expect = 3.055e-46
Identity = 110/332 (33.13%), Postives = 167/332 (50.30%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY-----------------GYDGD-------KTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPP-READKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMI 1026
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T+  +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ INK D+ +         EI + +  Y                 G+ GD         P+  G     +E ++       +LE LD I    LPP R  DKPL LP++++  I G GTV  GRVE G++ PG+ V       N+ T +  +EM H+ L +AVPGD VG  ++ V  +++RRG +
Sbjct:    3 KEKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETQKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPYSSDRYNEIVKEVGTYIKKIGYNPAAVGFVPISGWHGDNMLEASTNMPWFKG---WKVERKDGNASGTTLLEALDAI----LPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFA--PVNVTTEVKSVEMHHEALTEAVPGDNVGFNVKNVSVKDVRRGNV 325          
BLAST of Elongation factor Tu vs. Ensembl Sea Lamprey
Match: hbs1l (HBS1-like translational GTPase [Source:ZFIN;Acc:ZDB-GENE-030131-2987])

HSP 1 Score: 129.413 bits (324), Expect = 1.599e-32
Identity = 109/429 (25.41%), Postives = 196/429 (45.69%), Query Frame = 1
Query:  187 MNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEE---------------IDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXX--XXXTRYGYDGDKTPFVVGSALC----ALEGRNEEIGAKKILE-LLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS-VQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAY-------------ALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQ------RFTMR-AGITLGYGVVGKL 1323
            +N+  IGHVD GK+TL   +  +L   N+    +YE+               +D+  EER+RG+T++  +  + +K +     D PGH D++ NMITG  Q + A+LVV    G          QTREH +L R +G+  L + INK D  +       E+  +  + L + G+      ++  S L     A+  ++E++ +      LLD ID    P R  DKP  L + ++    G G    G+VE G +  G  + ++   AN   T+ GI +  + +D A  GD V + + G+   ++  G ++  PK  ++ +    A+I + +        PI+  +   ++ ++   PA               ++      +  G+++MV++   + + LE  +      RF +R +G T+  GVV ++
Sbjct:  261 INLVVIGHVDAGKSTLMGHLLYLLGNVNKRAMHKYEQESKKAGKASFAYAWVLDETGEERERGVTMDVGLTKFESKTKLVTLMDAPGHKDFIPNMITGAAQADVALLVVDSITGEFEAGFEAGGQTREHALLVRSLGVTQLAVAINKMDMLNWSKERFEEITSKLGQFLKQAGFKESDVTYIPTSGLSGENLAMRSKDEKLTSWYSGPCLLDCIDSFRPPQRPVDKPCRLCVSDVFKDVGAGFSVAGKVEAGYVQTGDRLVVM--PANEMCTVKGITLHDEPMDWAAAGDHVTLNVTGMDMIKVGVGSVVCDPKEPIRASTRVRARILIFN-----IDLPITRGFPVLLHYQTVSEPAVIKKLISVLHKSTGEVVKTKPRCLQKGQNAMVELQMQRPVCLERYKDFRELGRFMLRYSGSTIAAGVVTEI 682          
BLAST of Elongation factor Tu vs. Ensembl Sea Lamprey
Match: eefsec (eukaryotic elongation factor, selenocysteine-tRNA-specific [Source:ZFIN;Acc:ZDB-GENE-051120-72])

HSP 1 Score: 96.6709 bits (239), Expect = 7.938e-22
Identity = 84/317 (26.50%), Postives = 141/317 (44.48%), Query Frame = 1
Query:  157 KKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYST---------------KNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADA------ADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALC----ALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIIT 1032
            +KAF     + NVG +GHVD GKT+L  A++   S             DK P+ R+RGIT++     +                 +       DCPGHA  ++ +I G   ++  +LV+  T+G   Q+ E L++  +I    +++ +NK D       A        ++      TR+       P +  +A      A E +  E G   ++ELL  + +  LP R+   PL + +++   I G+GTV TG V  G +S    VEI       K  +  ++MF + +  A  GD+VG+ +     + L RG++ +
Sbjct:    3 RKAF-----NFNVGVLGHVDSGKTSLARALSSTASTA---------AFDKNPQSRERGITLDLGFSAFGAPLPAHLRDDPRAGGYEALQVTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKGMQTQSAECLLIG-EITCPRMMVVLNKTDMLPEAKRATLIEKMTKKMHKTLENTRF----KGAPIISVAAKPGGPDAPEAQEAE-GIAGLIELL--LSQTYLPQRDPAGPLLMAVDHCFCIRGQGTVMTGTVLSGSVSVNDTVEIPALKVTKK--VKSMQMFRKPVTSAAQGDRVGLCVTQFDPKLLERGLVCS 295          
BLAST of Elongation factor Tu vs. Ensembl Yeast
Match: TUF1 (Mitochondrial translation elongation factor Tu (EF-Tu); involved in fundamental pathway of mtDNA homeostasis; comprises both GTPase and guanine nucleotide exchange factor activities, while these activities are found in separate proteins in S. pombe and humans; rare mutations in human mitochondrial elongation factor Tu (EFTu) associated with severe lactic acidosis, rapidly progressive fatal encephalopathy, severe infantile macrocystic leukodystrophy with micropolygyria [Source:SGD;Acc:S000005713])

HSP 1 Score: 408.683 bits (1049), Expect = 1.359e-140
Identity = 218/438 (49.77%), Postives = 301/438 (68.72%), Query Frame = 1
Query:   37 MIIKFVYKLLAAPTKSSIVKNSKFSTSQCIFAQPIIQPGGKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADS-XXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNAN-IKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLP-EGKD---LVMPGEDSMVKMHFLKKMALEVGQRFTMR-AGITLGYGVVGKLL 1326
            ++ +  +K      + S V +  FS +   +A          AF R +PH+N+GTIGHVDHGKTTLTAAITK L+    + F  Y  IDKAPEER RGITI+ A V+Y T  RHY+H DCPGHADY+KNMITG  QM+ AI+VVA T+G MPQTREHL+LARQ+G++H+V+F+NK D  D  EM+ELVE+E+RELL  YG+DGD  P ++GSALCALEGR  EIG + I++LLD +DE IP P R+ +KP  +P+E+I SI+GRGTV TGRVERG +  G  +EI+G+N+  +KTT+TGIEMF + LD A+ GD  GVLLRG+++++L+RGM++  P +V+      A +Y+LS+ EGGR       Y+ Q++ ++ D       P E +D    VMPG++  ++   +    LEVGQRF +R  G T+G G++ +++
Sbjct:    8 LLTRTAFKASGKLLRLSSVISRTFSQTTTSYA---------AAFDRSKPHVNIGTIGHVDHGKTTLTAAITKTLAAKGGANFLDYAAIDKAPEERARGITISTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHIVVFVNKVDTIDDPEMLELVEMEMRELLNEYGFDGDNAPIIMGSALCALEGRQPEIGEQAIMKLLDAVDEYIPTPERDLNKPFLMPVEDIFSISGRGTVVTGRVERGNLKKGEELEIVGHNSTPLKTTVTGIEMFRKELDSAMAGDNAGVLLRGIRRDQLKRGMVLAKPGTVKAHTKILASLYILSKEEGGRHSGFGENYRPQMFIRTADVTVVMRFPKEVEDHSMQVMPGDNVEMECDLIHPTPLEVGQRFNIREGGRTVGTGLITRII 436          
BLAST of Elongation factor Tu vs. Ensembl Yeast
Match: TEF1 (Translational elongation factor EF-1 alpha; in the GTP-bound active form, binds to and delivers aminoacylated tRNA to the A-site of ribosomes for elongation of nascent polypeptides; associates with vacuolar Rho1p GTPase; may also have a role in tRNA re-export from the nucleus; TEF1 has a paralog, TEF2, that arose from the whole genome duplication [Source:SGD;Acc:S000006284])

HSP 1 Score: 177.948 bits (450), Expect = 4.197e-51
Identity = 115/329 (34.95%), Postives = 167/329 (50.76%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAA--DSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCA------------LEGRNEEI--GAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS 1044
            +++ H+NV  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ A+  + T        D PGH D++KNMITGT+Q + AIL++AG  G          QTREH +LA  +G+  L++ +NK D+   D    + +  E    + + GY+    PFV  S                 +G  +E   G  K   LL+ ID I  P R  DKPL LP++++  I G GTV  GRVE G+I PG+ V      A + T +  +EM H+ L++ VPGD VG  ++ V  +E+RRG +    K+
Sbjct:    3 KEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFA--PAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKN 329          
BLAST of Elongation factor Tu vs. Ensembl Yeast
Match: TEF2 (Translational elongation factor EF-1 alpha; in the GTP-bound active form, binds to and delivers aminoacylated tRNA to the A-site of ribosomes for elongation of nascent polypeptides; associates with vacuolar Rho1p GTPase; TEF2-RFP levels increase during replicative aging; may also have a role in tRNA re-export from the nucleus; TEF2 has a paralog, TEF1, that arose from the whole genome duplication [Source:SGD;Acc:S000000322])

HSP 1 Score: 177.948 bits (450), Expect = 4.197e-51
Identity = 115/329 (34.95%), Postives = 167/329 (50.76%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAA--DSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCA------------LEGRNEEI--GAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS 1044
            +++ H+NV  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ A+  + T        D PGH D++KNMITGT+Q + AIL++AG  G          QTREH +LA  +G+  L++ +NK D+   D    + +  E    + + GY+    PFV  S                 +G  +E   G  K   LL+ ID I  P R  DKPL LP++++  I G GTV  GRVE G+I PG+ V      A + T +  +EM H+ L++ VPGD VG  ++ V  +E+RRG +    K+
Sbjct:    3 KEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFA--PAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKN 329          
BLAST of Elongation factor Tu vs. Ensembl Yeast
Match: HBS1 (GTPase with similarity to translation release factors; together with binding partner Dom34p, facilitates ribosomal subunit dissociation and peptidyl-tRNA release when translation is stalled, particularly in 3' UTRs; genetically implicated in mRNA no-go decay; HBS1 has a paralog, SKI7, that arose from the whole genome duplication [Source:SGD;Acc:S000001792])

HSP 1 Score: 97.4413 bits (241), Expect = 3.540e-22
Identity = 92/372 (24.73%), Postives = 164/372 (44.09%), Query Frame = 1
Query:  145 QPGGKKAFLRDR-PHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEE---------------IDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXX--XTRYGYDGDKTPFV-----VGSALCALEGRNEEIGAKKILELLDRIDEIPLPPRE------ADKPLFLPIENIM---SITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEM--------FHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPI 1119
            +P    AF++   PH++   +GHVD GK+TL   +   L+  NQS  ++ +                +D+  EER+RG+T++     +ST   ++   D PGH D+V N I G +Q + AIL V  +  +         QT+EH++LA  +GI +L+I +NK D  D       E++ + L  L   G+  D   +V      G  +  +E  +E         L+  ++       +       D P    +  I+     +    + +G++E G I PG  + I  Y +     +  I++         H+  D A+ GD V + LR    E+++ G +     SV  ++   AQ ++L  +    ++P+
Sbjct:  153 KPHDISAFVKSALPHLSFVVLGHVDAGKSTLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEERERGVTVSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFESGFDLDGQTKEHMLLASSLGIHNLIIAMNKMDNVDWSQQRFEEIKSKLLPYLVDIGFFEDNINWVPISGFSGEGVYKIEYTDEVRQWYNGPNLMSTLENAAFKISKENEGINKDDPFLFSVLEIIPSKKTSNDLALVSGKLESGSIQPGESLTI--YPSEQSCIVDKIQVGSQQGQSTNHEETDVAIKGDFVTLKLRKAYPEDIQNGDLAA---SVDYSSIHSAQCFVLELTTFDMNRPL 519          
BLAST of Elongation factor Tu vs. Ensembl Yeast
Match: SUP35 (Translation termination factor eRF3; has a role in mRNA deadenylation and decay; altered protein conformation creates the [PSI(+)] prion that modifies cellular fitness, alters translational fidelity by affecting reading frame selection, and results in a nonsense suppressor phenotype; many stress-response genes are repressed in the presence of [PSI(+)] [Source:SGD;Acc:S000002579])

HSP 1 Score: 88.5817 bits (218), Expect = 3.468e-19
Identity = 85/328 (25.91%), Postives = 152/328 (46.34%), Query Frame = 1
Query:  178 RPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEE---------------IDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN--EEIGAKK--------ILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQL---LDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS 1044
            + H+++  +GHVD GK+T+   +  +    ++   ++YE                +D   EER  G TI      + T+ R Y   D PGH  YV  MI G +Q +  +LV++  +G          QTREH +LA+  G+  +V+ +NK D       +    +    ++ +    GY+  KT  VV   +    G N  + +  K+        +LE LD ++ +    R  + P  LPI   M     GT+  G++E G I  G    ++      KT +    ++++    +D A+ G+QV + ++GV++E++  G ++T+PK+
Sbjct:  258 KDHVSLIFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRQGWYLSWVMDTNKEERNDGKTIEVGKAYFETEKRRYTILDAPGHKMYVSEMIGGASQADVGVLVISARKGEYETGFERGGQTREHALLAKTQGVNKMVVVVNKMDDPTVNWSKERYDQCVSNVSNFLRAIGYN-IKTD-VVFMPVSGYSGANLKDHVDPKECPWYTGPTLLEYLDTMNHV---DRHINAPFMLPIAAKMK--DLGTIVEGKIESGHIKKGQSTLLMPN----KTAVEIQNIYNETENEVDMAMCGEQVKLRIKGVEEEDISPGFVLTSPKN 574          
BLAST of Elongation factor Tu vs. Ensembl Nematostella
Match: EDO39883 (Elongation factor Tu [Source:UniProtKB/TrEMBL;Acc:A7S8T2])

HSP 1 Score: 451.825 bits (1161), Expect = 1.341e-157
Identity = 228/397 (57.43%), Postives = 300/397 (75.57%), Query Frame = 1
Query:  160 KAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQ-----IGIEHLVIFINKADAADS-XXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRID-EIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAGI-TLGYGVVGKLL 1326
            K F RD+PH+N+GTIGHVDHGKTTLTAAITKVL++T  + FK Y +ID APEER RGITIN A V+Y T+ RHY H DCPGHADY+KNMITG  QM+ AILVVAGT+G MPQTREHL+LA Q     +G++ +V+++NKAD  D  E++ELVELE+RELL+ YGYDGD TP ++GSALCALEG+N+++G   I +LL+ +D  IP P R+ DKP  LPIE++ SI+GRGTV TGR+ERG+I  G  VE +G+ + IKTT+TGIEMFH++LD+   GD +G L+RGVK+E+++RGM++  P +V+  +  +AQ+Y+L + EGGR KP   +Y  Q+Y ++ D  A   LPEGK+ VMPGED+   +  L  + LE G RFT+R G  T+G GVV K+L
Sbjct:    7 KTFSRDKPHVNIGTIGHVDHGKTTLTAAITKVLADTGAANFKSYGDIDNAPEERARGITINTAHVEYQTEKRHYGHVDCPGHADYIKNMITGAAQMDGAILVVAGTDGQMPQTREHLLLANQASKCSVGVKDIVVYVNKADMIDDPELLELVELELRELLSEYGYDGDNTPIIIGSALCALEGKNDDLGINSIKKLLEAVDSHIPTPARDLDKPFLLPIEDVFSISGRGTVVTGRIERGVIKKGDEVEFVGHGSKIKTTVTGIEMFHKILDRGEAGDNLGALVRGVKREDVKRGMVLCQPGTVKSHSKFEAQVYILKKEEGGRHKPFVTSYTPQMYVRTGDVAATITLPEGKEFVMPGEDASFTVQLLFDVPLEQGLRFTLREGSKTVGTGVVTKIL 403          
BLAST of Elongation factor Tu vs. Ensembl Nematostella
Match: EF1ALPHA (Elongation factor 1-alpha [Source:UniProtKB/TrEMBL;Acc:A7SSW8])

HSP 1 Score: 152.14 bits (383), Expect = 3.973e-41
Identity = 122/429 (28.44%), Postives = 201/429 (46.85%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRN------------------------EEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLS---ESEGGRSKPISAAYQSQIYSK------SWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRF 1275
            +++ H+N+  IGHVD GK+T T  +                K  SE  +  FK    +DK   ER+RGITI+ A+  + T   +    D PGH D++KNMITGT+Q + A+L++A   G          QTREH +LA  +G++ +++  NK D+ +    E    EI++ +  +    G++    PF+    +    G N                        +E  A  +  L + +D I  P R +  PL LP++++  I G GTV  GRVE G++ PG  V      +NI T +  +EM H+ L +A+PGD VG  ++ V  ++++RG +    K+   +      AQ+ +++   E   G S P+   + + I  K        D  +   L +   ++  G+ +MV+M   K M +E    F
Sbjct:    3 KEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKESSEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETLKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIASGTGEFEAGISKNGQTREHALLAYTLGVKQMLVCANKMDSTEPPYSEARFKEIQKEVANFLKKVGFNPKAVPFI---PISGFHGDNMLEKSENMPWFKQWTIERVDPATKKEANASGVT-LFEGLDSILPPSRPSGLPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGTVVTF--SPSNITTEVKSVEMHHESLAEALPGDNVGFNVKNVSVKDIKRGNVAGDFKNNPPKPCKSFTAQVIVMNHPGEIHAGYS-PVLDCHTAHIACKFDKLLEKIDRRSGKKLEDNPKMIKTGDAAMVEMIPSKPMCVETFTEF 424          
BLAST of Elongation factor Tu vs. Ensembl Nematostella
Match: EDO48034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKR5])

HSP 1 Score: 120.553 bits (301), Expect = 7.165e-30
Identity = 95/339 (28.02%), Postives = 162/339 (47.79%), Query Frame = 1
Query:  184 HMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEE---------------IDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSALCALEGRNEEIGAKKILE-----------LLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSV-QLANYCDAQIYLL 1086
            H+N+  IGHVD GK+T+   +  +  + ++   ++YE                +D   EER +G T+      + T  +H+   D PGH  +V NMI+G  Q +  +LV++  +G          QTREH +LA+  G++HLVI +NK D    +  E    EI+  LT +    G++  KT  ++      L G N     K+ L+            L  ID++P   R  D P+ LPI +       GT+  G+VE G I+ G  + ++    N++  +T +    + +  A  GD V + L+GV++E++  G ++ +P ++       DAQ+ +L
Sbjct:   29 HVNIIFIGHVDAGKSTIGGHVMYLTGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAAFDTDTKHFTLLDAPGHKSFVPNMISGAAQADLGVLVISARKGEFETGFERGGQTREHAMLAKTAGVKHLVILVNKMDDPTVKWNEERYEEIKVKLTPFLKKVGFN-PKTD-IMYMPCSGLTGAN----LKEPLDPQVCPWYSGKPFLKYIDQLPSLTRSVDGPVRLPIAD--KYRDMGTIVLGKVESGTINKGQTLVLMPNKVNVE--LTTVIYDEEEMTSARAGDNVKLRLKGVEEEDVSPGFVLCSPHNLCHTVRTFDAQVVIL 357          
BLAST of Elongation factor Tu vs. Ensembl Nematostella
Match: EDO47521 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM15])

HSP 1 Score: 119.398 bits (298), Expect = 2.477e-29
Identity = 96/329 (29.18%), Postives = 142/329 (43.16%), Query Frame = 1
Query:  187 MNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRY----------------------------EEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRN-----EEIGAKKILE---LLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS 1044
            +N+  IGHVD GK+TL   +  +L + ++    +Y                              +D+  EER+RGIT++  +  + TKN+     D PGH D++ NMITG  Q + AILVV    G          QTREH +L R +G+  L++ INK D   S   E     + +L       G K   VV   +  L G N      E   KK  +   L+DRIDE   P R+ DKP    + ++    G G    G++E G I  G   + L   A  K  +  + +  +    A  GD V + L G+    +  G ++  P S
Sbjct:   39 LNLVIIGHVDAGKSTLMGHLLFLLGDVSKKAMHKYPFFFLIIIFNLKACTESKKAGKASFAYAWVLDETGEERERGITMDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQTREHAILVRSLGVTQLIVAINKLDMM-SWSEERYLHIVSKLKHFLKQVGFKDSDVVYVPVSGLSGENLVKPCTEEKLKKWYQGQCLVDRIDEFKSPKRDMDKPWRFCVSDVYKGLGTGINLAGKMEAGHIQTG--DKALAMPAGEKGLLKALNIHDEPTQWACAGDHVTLTLSGIDMMHVGVGTVLCDPAS 364          
BLAST of Elongation factor Tu vs. Ensembl Nematostella
Match: EDO41867 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2Z6])

HSP 1 Score: 107.071 bits (266), Expect = 5.637e-25
Identity = 88/310 (28.39%), Postives = 150/310 (48.39%), Query Frame = 1
Query:  184 HMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDY---------STKNRH----YAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGR--------NEEIGAKKILELLDRIDEIP-LPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSV 1047
            + N+G +GHVD GKT+L  A++   S  +          DK P+ ++RGIT++     +         S  + H        DCPGHA  +K +I G   ++  +LVV  T+G   QT E LV+  +I  + +V+ +NK D    E  +    ++ + LT+     + T F  GS + ++  +        +E IG   + +L++++ E+  +P R     L   +++  SI G+GT+ TG +  G +     VEI       K  +  ++MF + +DKA  GD+VG+ +       L RG I+ +P SV
Sbjct:   11 NFNIGVLGHVDSGKTSLAKALSTTASTAS---------FDKNPQSQERGITLDLGFSSFQVALPEHLRSAGSEHDLLQMTLVDCPGHASLIKTIIGGAQIIDMMMLVVDVTKGVQTQTAECLVIG-EILCQKMVVVLNKVDLLKPEKRDSFIEKMSKRLTK---TLENTRF-AGSPIISVAAKPGGPEAPVSESIG---VTQLINKLREMSYIPERTTSGSLLFAVDHCFSIRGQGTIMTGTILSGSVCVNDTVEIPSLKVTKK--VKSMQMFKKPVDKASQGDRVGICVTQFDPHLLERG-IVCSPSSV 300          
BLAST of Elongation factor Tu vs. Ensembl Medaka
Match: tufm (Tu translation elongation factor, mitochondrial [Source:NCBI gene;Acc:101156413])

HSP 1 Score: 456.447 bits (1173), Expect = 2.301e-158
Identity = 231/414 (55.80%), Postives = 305/414 (73.67%), Query Frame = 1
Query:   97 NSKFSTSQCIFAQPIIQPGGKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAA-DSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAG-ITLGYGVVGKLLP 1329
            +S F       ++       KK + R++PH+N+GTIGHVDHGKTTLTAAITKVL++   + +K+YE+ID APEE+ RGITINA+ V+Y+T NRHYAHTDCPGHADYVKNMITGT QM+  I+VVA T+G MPQTREHL+LARQIG+EH+V+FINKADA  D EM++LVE+EIRELLT +GYDG+ TP V+GSALCALE +  E+G   +L+LL+ +D  +PLP RE +KP  LPIE + SI GRGTV TG +ERGII  G   E +G+N + K+ +TGIEMFH+ LD+A  GD +G L+RG+K+E++RRGM++  P S+       AQIY+LS+ EGGR KP    +   ++S +WD      LP  K++VMPGED+ + +   + M LE GQRFT+R G  T+G G+V ++LP
Sbjct:   23 HSSFKLCAVPLSRRTFAAEAKKTYSREKPHVNIGTIGHVDHGKTTLTAAITKVLADAGGANYKKYEDIDNAPEEKARGITINASHVEYTTSNRHYAHTDCPGHADYVKNMITGTAQMDGCIVVVAATDGQMPQTREHLLLARQIGVEHVVVFINKADAVEDKEMLDLVEIEIRELLTEFGYDGENTPVVIGSALCALENKQPELGVNAVLKLLEIVDSYVPLPKRELEKPFLLPIEGVYSIPGRGTVVTGTMERGIIKKGDDCEFVGHNRSFKSVVTGIEMFHKSLDRAEAGDNLGALVRGLKREDVRRGMVMCKPGSIMPHQKVKAQIYVLSKEEGGRHKPFVTNFMPVMFSLTWDMACRVTLPADKEMVMPGEDTSLTLTLRQPMVLEKGQRFTLRDGNRTIGTGLVTEILP 436          
BLAST of Elongation factor Tu vs. Ensembl Medaka
Match: eef1a (elongation factor 1 alpha [Source:NCBI gene;Acc:100049188])

HSP 1 Score: 169.474 bits (428), Expect = 4.974e-47
Identity = 116/352 (32.95%), Postives = 179/352 (50.85%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFVVGSAL-----------------CALEGRNEEIGAKKILELLDRIDEIPLPP-READKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS--VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ A+  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    +    EI++ ++ Y    GY+     FV  S                     +E ++       +LE LD I    LPP R  DKPL LP++++  I G GTV  GRVE G++ PG+ V       N+ T +  +EM H+ L +AVPGD VG  ++ V  +E+RRG +    K+   + A   +AQ+ +L+
Sbjct:    3 KEKIHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEIQKEVSTYIKKIGYNPAAVAFVPISGWHGDNMLEASDKMSWFKGWKIERKDGNASGTTLLEALDAI----LPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFA--PPNLTTEVKSVEMHHESLPEAVPGDNVGFNIKNVSVKEIRRGYVAGDSKNDPPKAAASFNAQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Medaka
Match: ENSORLT00000009507.2 (elongation factor 1-alpha [Source:NCBI gene;Acc:101170939])

HSP 1 Score: 168.318 bits (425), Expect = 1.052e-46
Identity = 115/350 (32.86%), Postives = 180/350 (51.43%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFV------------VGSALCALEG---RNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS---VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ A+  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QTREH +LA  +G++ L++ +NK D+ +    +    EI++ ++ Y    GY+     FV                +   +G     +E GA  +  LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE GI+ PG+ V       N+ T +  +EM H+ L +A+PGD VG  ++ V  +E+RRG +    K+   +   N+  AQ+ +L+
Sbjct:    3 KEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEIQKEVSAYIKKIGYNPATVAFVPISGWHGDNMLEASDKMSWFKGWKIERKEGGATGVT-LLEALDSILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFA--PPNLTTEVKSVEMHHESLTEALPGDNVGFNIKNVSVKEIRRGNVAGDSKNDPPLAAENFT-AQVIILN 348          
BLAST of Elongation factor Tu vs. Ensembl Medaka
Match: si:dkey-37o8.1 (42Sp50 [Source:NCBI gene;Acc:100049338])

HSP 1 Score: 161.384 bits (407), Expect = 3.850e-44
Identity = 102/323 (31.58%), Postives = 167/323 (51.70%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY----GYDGDKTPFV-----VGSALCALEGRNEEIGAKKILE---------LLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRG 1020
            +++ H+NV  IGHVD GK+T T  +                K  ++  +S FK    +DK   ER+RGITI+ +++ ++T+       D PGH D++KNMITGT+Q + A+L+V+  +G          QTREH +LA  +G++ +++ +NK D  +    +    E+   ++ +    GYD +  PFV      G  + ++  +       KI           LL+ +D I  P R  +KPL LP++++  I G GTV  G++E G++ PG+   ++   A +   +  IEM HQ L  A+PG  VG  ++ V  + LRRG
Sbjct:    3 KEKVHVNVVVIGHVDSGKSTTTGHLVYKCGGIDPRKLEKFEKAAAQLGKSSFKFAWVLDKLKAERERGITIDISLLKFNTQKYTMTIIDAPGHRDFIKNMITGTSQADVALLMVSAAKGEYEAGVSRSGQTREHALLAYTLGVKQIIVCVNKMDLTEPPYSQKRYEEVMRGVSGFLRKIGYDTNAVPFVPVSGWTGENMISVTQKMPWYQGWKIRRREGPSTGKTLLEVLDSIQPPVRTINKPLRLPLQDVYKIGGVGTVPVGKIETGVLKPGM--TLVFSPAKLTAEVKSIEMHHQGLQTALPGHNVGFNIKNVSVKNLRRG 323          
BLAST of Elongation factor Tu vs. Ensembl Medaka
Match: eef1a1a (elongation factor 1-alpha 1 [Source:NCBI gene;Acc:101166076])

HSP 1 Score: 141.354 bits (355), Expect = 6.794e-36
Identity = 104/346 (30.06%), Postives = 164/346 (47.40%), Query Frame = 1
Query:  172 RDRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLAR-QIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSA------------LCALEGR--NEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKS---VQLANYCDAQIYLLS 1089
            +++ H+N+  IGHVD GK+T T  +                K  +E  +  FK    +DK   ER+RGITI+ ++  + T   +    D PGH D++KNMITGT+Q + A+L+VA   G          QT+ +    R +  ++ +  +I K                       GY+ D   FV  S             +   +G   N + G      LL+ +D I  P R  DKPL LP++++  I G GTV  GRVE G++ PG+ V       N+ T +  +EM H+ L +A+PGD VG  ++ V  +++RRG +    K+    + AN+  AQ+ +L+
Sbjct:    3 KEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTQPNYSQKRYEEIVKEVSTYIKK----------------------IGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKEGNASGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFA--PVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAANF-TAQVIILN 323          
BLAST of Elongation factor Tu vs. Planmine SMEST
Match: SMESG000068535.1 (SMESG000068535.1)

HSP 1 Score: 877.856 bits (2267), Expect = 0.000e+0
Identity = 441/442 (99.77%), Postives = 442/442 (100.00%), Query Frame = 1
Query:   37 MIIKFVYKLLAAPTKSSIVKNSKFSTSQCIFAQPIIQPGGKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAGITLGYGVVGKLLPDPGPGKWEKNK 1362
            MIIKFVYKLLAAPTKSSIVKNSKFSTSQCIFAQPIIQPGGKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSEMIELVELEIRELLTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDS+VKMHFLKKMALEVGQRFTMRAGITLGYGVVGKLLPDPGPGKWEKNK
Sbjct:    1 MIIKFVYKLLAAPTKSSIVKNSKFSTSQCIFAQPIIQPGGKKAFLRDRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSEMIELVELEIRELLTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSIVKMHFLKKMALEVGQRFTMRAGITLGYGVVGKLLPDPGPGKWEKNK 442          
BLAST of Elongation factor Tu vs. Planmine SMEST
Match: SMESG000068535.1 (SMESG000068535.1)

HSP 1 Score: 773.467 bits (1996), Expect = 0.000e+0
Identity = 391/392 (99.74%), Postives = 392/392 (100.00%), Query Frame = 1
Query:  187 MNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAGITLGYGVVGKLLPDPGPGKWEKNK 1362
            MNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSEMIELVELEIRELLTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDS+VKMHFLKKMALEVGQRFTMRAGITLGYGVVGKLLPDPGPGKWEKNK
Sbjct:    1 MNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSEMIELVELEIRELLTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSIVKMHFLKKMALEVGQRFTMRAGITLGYGVVGKLLPDPGPGKWEKNK 392          
BLAST of Elongation factor Tu vs. Planmine SMEST
Match: SMESG000015363.1 (SMESG000015363.1)

HSP 1 Score: 370.933 bits (951), Expect = 4.724e-125
Identity = 188/388 (48.45%), Postives = 264/388 (68.04%), Query Frame = 1
Query:  175 DRPHMNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMPQTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRYGYDGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDE-IPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLLSESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMHFLKKMALEVGQRFTMRAG-ITLGYGVVGKLLPD 1332
            ++PH N+GT+GHVDHGKTTLT+AITKVLSE  ++ +  + +IDK  EE KRGITINA+ ++Y T+ RHYAHTDCPGH DY+KNMITG +QM+ AILVVA  +G+MPQT+EHL+LA+Q+GI+++VIF+NK D  DSE +ELV  E+R++++ YG+DG+  P + GSA  AL+G N++IG K IL+L++ ID  IP   R+ D P  +P+E+ +SI  +GTV  G V +G I  G  + + G+    KT  +   +F   ++K   GD  G+LL+G+  +++ RGM++    S  L  Y +A +YLLS +EGGRSKP+ + Y   +Y   WD  A   LPE  D+VMPG+    K+   K M   VG RFTMR   +T+  GV+ K L D
Sbjct:   27 NKPHSNIGTLGHVDHGKTTLTSAITKVLSEIGKTNYTEFSKIDKGKEEIKRGITINASHIEYETEKRHYAHTDCPGHIDYIKNMITGASQMDGAILVVAADDGAMPQTKEHLLLAQQLGIKNIVIFVNKCDIVDSETVELVIEEMRDIISLYGFDGNTVPVISGSASSALKGINDDIGKKSILKLMEVIDNYIPNVSRDEDSPFMMPVESGISIKDKGTVVIGTVRKGEIQKGALLTLAGFGKQFKTQASNFRIFENTVEKIKAGDNCGILLKGINVKDVHRGMVLAEKGSASLLLYMEAHMYLLSPNEGGRSKPLKSNYLQMMYCNLWDMSACIFLPEDMDMVMPGDHFTAKVLLRKSMYAVVGDRFTMRDNDMTVITGVITKHLVD 414          
BLAST of Elongation factor Tu vs. Planmine SMEST
Match: SMESG000061164.1 (SMESG000061164.1)

HSP 1 Score: 168.318 bits (425), Expect = 7.759e-47
Identity = 114/353 (32.29%), Postives = 175/353 (49.58%), Query Frame = 1
Query:  175 DRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY-----------------GYDGD-------KTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCD--AQIYLLS 1089
            D+ H+N+  IGHVD GK+T T  +                K   E  +  FK    +DK   ER+RGITI+ A+  + T   +    D PGH D++KNMITGT+Q + A+LVVA   G          QTREH +LA  +G++ +++ +NK D+ +    E    EI++ ++ Y                 G++GD         P+  G  +     + EE        LLD +D +  P R  +KPL LP++++  I G GTV  GRVE GI+ PG+ V        + T +  +EM H+ L +A+PGD VG  ++ V  +E+RRG + +  KS       D  AQ+ +++
Sbjct:    4 DKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTG-KTLLDALDALEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFA--PQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMN 353          
BLAST of Elongation factor Tu vs. Planmine SMEST
Match: SMESG000061099.1 (SMESG000061099.1)

HSP 1 Score: 168.318 bits (425), Expect = 7.759e-47
Identity = 114/353 (32.29%), Postives = 175/353 (49.58%), Query Frame = 1
Query:  175 DRPHMNVGTIGHVDHGKTTLTAAIT---------------KVLSETNQSVFKRYEEIDKAPEERKRGITINAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGSMP-------QTREHLVLARQIGIEHLVIFINKADAADSXXXXXXXXXXXXXXTRY-----------------GYDGD-------KTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLFLPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMFHQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCD--AQIYLLS 1089
            D+ H+N+  IGHVD GK+T T  +                K   E  +  FK    +DK   ER+RGITI+ A+  + T   +    D PGH D++KNMITGT+Q + A+LVVA   G          QTREH +LA  +G++ +++ +NK D+ +    E    EI++ ++ Y                 G++GD         P+  G  +     + EE        LLD +D +  P R  +KPL LP++++  I G GTV  GRVE GI+ PG+ V        + T +  +EM H+ L +A+PGD VG  ++ V  +E+RRG + +  KS       D  AQ+ +++
Sbjct:    4 DKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTG-KTLLDALDALEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFA--PQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMN 353          
The following BLAST results are available for this feature:
BLAST of Elongation factor Tu vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUFM2.080e-15658.78Tu translation elongation factor, mitochondrial [S... [more]
EEF1A28.956e-4832.71eukaryotic translation elongation factor 1 alpha 2... [more]
EEF1A21.787e-4732.71eukaryotic translation elongation factor 1 alpha 2... [more]
EEF1A14.328e-4631.82eukaryotic translation elongation factor 1 alpha 1... [more]
EEF1A14.328e-4631.82eukaryotic translation elongation factor 1 alpha 1... [more]
back to top
BLAST of Elongation factor Tu vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tufm-17.287e-13048.36Elongation factor Tu homologue; TU elongation Fact... [more]
tufm-17.287e-13048.36Elongation factor Tu homologue; TU elongation Fact... [more]
tufm-21.992e-10443.86Mitochondrial elongation factor Tu homologue; TU e... [more]
eef-1A.27.131e-4933.90Elongation factor 1-alpha [Source:UniProtKB/Swiss... [more]
eef-1A.27.131e-4933.90Elongation factor 1-alpha [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Elongation factor Tu vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mEFTu13.572e-16760.05gene:FBgn0024556 transcript:FBtr0087670[more]
mEFTu13.572e-16760.05gene:FBgn0024556 transcript:FBtr0301389[more]
mEFTu23.154e-12849.10gene:FBgn0033184 transcript:FBtr0088981[more]
eEF1alpha27.414e-4834.34gene:FBgn0000557 transcript:FBtr0085835[more]
eEF1alpha27.414e-4834.34gene:FBgn0000557 transcript:FBtr0085834[more]
back to top
BLAST of Elongation factor Tu vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tufm1.035e-15756.85Tu translation elongation factor, mitochondrial [S... [more]
eef1a1l11.279e-4933.52eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1l11.279e-4933.52eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1b2.233e-4832.76eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1l22.233e-4832.76eukaryotic translation elongation factor 1 alpha 1... [more]
back to top
BLAST of Elongation factor Tu vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb4a2.806e-13855.68tubulin beta 4A class IVa [Source:NCBI gene;Acc:39... [more]
tubb4a9.706e-13656.25tubulin beta 4A class IVa [Source:NCBI gene;Acc:39... [more]
eef1a27.249e-4832.98eukaryotic translation elongation factor 1 alpha 2... [more]
anp32b8.244e-4732.38acidic nuclear phosphoprotein 32 family member B [... [more]
eef1a13.689e-4632.62eukaryotic translation elongation factor 1 alpha 1... [more]
back to top
BLAST of Elongation factor Tu vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tufm3.362e-15959.74Tu translation elongation factor, mitochondrial [S... [more]
Tufm1.963e-13163.75Tu translation elongation factor, mitochondrial [S... [more]
Eef1a21.553e-4732.45eukaryotic translation elongation factor 1 alpha 2... [more]
Eef1a11.109e-4631.82eukaryotic translation elongation factor 1 alpha 1... [more]
Tufm9.096e-3357.46Tu translation elongation factor, mitochondrial [S... [more]
back to top
BLAST of Elongation factor Tu vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BFR5|EFTU_MOUSE2.351e-15859.74Elongation factor Tu, mitochondrial OS=Mus musculu... [more]
sp|P85834|EFTU_RAT1.374e-15759.49Elongation factor Tu, mitochondrial OS=Rattus norv... [more]
sp|P49410|EFTU_BOVIN6.049e-15759.64Elongation factor Tu, mitochondrial OS=Bos taurus ... [more]
sp|P49411|EFTU_HUMAN1.051e-15558.78Elongation factor Tu, mitochondrial OS=Homo sapien... [more]
sp|A5DN78|EFTU_PICGU9.601e-14353.90Elongation factor Tu, mitochondrial OS=Meyerozyma ... [more]
back to top
BLAST of Elongation factor Tu vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8WQH50.000e+069.44Elongation factor Tu (Fragment) OS=Opisthorchis vi... [more]
A0A075AGI10.000e+069.44Elongation factor Tu OS=Opisthorchis viverrini OX=... [more]
A0A4Z2D2Z80.000e+068.47Elongation factor Tu OS=Schistosoma japonicum OX=6... [more]
A0A4Z2D3P30.000e+064.92Elongation factor Tu OS=Schistosoma japonicum OX=6... [more]
C1LF710.000e+065.15Elongation factor Tu OS=Schistosoma japonicum OX=6... [more]
back to top
BLAST of Elongation factor Tu vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eef1a1l26.383e-4833.05elongation factor 1-alpha 1-like [Source:NCBI gene... [more]
eef1a25.764e-4733.24elongation factor 1-alpha 2 [Source:NCBI gene;Acc:... [more]
EEF1A16.677e-4732.48elongation factor 1-alpha 1 [Source:NCBI gene;Acc:... [more]
ENSAMXT00000052370.19.355e-4732.66elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
EEF1A19.748e-4732.48elongation factor 1-alpha 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Elongation factor Tu vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000011427.13.055e-4633.13pep scaffold:Pmarinus_7.0:GL499053:103:1494:1 gene... [more]
hbs1l1.599e-3225.41HBS1-like translational GTPase [Source:ZFIN;Acc:ZD... [more]
eefsec7.938e-2226.50eukaryotic elongation factor, selenocysteine-tRNA-... [more]
back to top
BLAST of Elongation factor Tu vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TUF11.359e-14049.77Mitochondrial translation elongation factor Tu (EF... [more]
TEF14.197e-5134.95Translational elongation factor EF-1 alpha; in the... [more]
TEF24.197e-5134.95Translational elongation factor EF-1 alpha; in the... [more]
HBS13.540e-2224.73GTPase with similarity to translation release fact... [more]
SUP353.468e-1925.91Translation termination factor eRF3; has a role in... [more]
back to top
BLAST of Elongation factor Tu vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398831.341e-15757.43Elongation factor Tu [Source:UniProtKB/TrEMBL;Acc... [more]
EF1ALPHA3.973e-4128.44Elongation factor 1-alpha [Source:UniProtKB/TrEMB... [more]
EDO480347.165e-3028.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475212.477e-2929.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418675.637e-2528.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Elongation factor Tu vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tufm2.301e-15855.80Tu translation elongation factor, mitochondrial [S... [more]
eef1a4.974e-4732.95elongation factor 1 alpha [Source:NCBI gene;Acc:10... [more]
ENSORLT00000009507.21.052e-4632.86elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
si:dkey-37o8.13.850e-4431.5842Sp50 [Source:NCBI gene;Acc:100049338][more]
eef1a1a6.794e-3630.06elongation factor 1-alpha 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Elongation factor Tu vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068535.10.000e+099.77SMESG000068535.1[more]
SMESG000068535.10.000e+099.74SMESG000068535.1[more]
SMESG000015363.14.724e-12548.45SMESG000015363.1[more]
SMESG000061164.17.759e-4732.29SMESG000061164.1[more]
SMESG000061099.17.759e-4732.29SMESG000061099.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006638 ID=SMED30006638|Name=Elongation factor Tu|organism=Schmidtea mediterranea sexual|type=transcript|length=1376bp
CTGATATTTACATAAGTGGTTTCCATTTAATAGAACATGATTATTAAATT
TGTATATAAACTTCTTGCAGCTCCTACTAAATCAAGTATTGTTAAGAATT
CAAAATTTTCTACATCCCAATGCATTTTTGCACAACCAATAATTCAACCT
GGCGGTAAAAAAGCTTTTCTCAGAGATCGACCACATATGAATGTTGGTAC
AATTGGTCATGTTGATCATGGAAAAACGACGCTAACTGCTGCCATAACCA
AAGTTTTATCAGAAACAAACCAATCCGTTTTTAAAAGGTATGAAGAAATT
GACAAAGCACCAGAAGAAAGAAAGCGTGGTATCACTATAAATGCAGCAAT
TGTTGATTATAGTACTAAAAATCGACATTATGCTCACACCGATTGCCCAG
GACATGCAGATTATGTAAAAAATATGATTACGGGAACTAATCAGATGGAA
GCAGCCATATTGGTTGTAGCGGGTACAGAAGGATCGATGCCTCAGACTCG
AGAGCATTTAGTATTAGCTAGACAAATTGGAATTGAGCATTTAGTCATTT
TTATTAACAAAGCCGATGCTGCAGATAGTGAAATGATTGAATTGGTGGAA
TTAGAAATCCGGGAATTACTCACGCGATACGGATATGATGGAGATAAAAC
CCCATTCGTCGTTGGATCAGCTTTATGCGCTTTGGAGGGACGAAATGAAG
AAATCGGTGCAAAAAAAATATTAGAATTACTTGACAGAATTGATGAAATT
CCATTGCCACCACGAGAAGCCGATAAACCATTATTTTTACCCATAGAAAA
TATAATGAGTATTACTGGACGAGGAACTGTATGTACCGGTCGCGTTGAAA
GAGGAATTATATCCCCTGGCCTTCCTGTCGAAATTCTAGGTTATAATGCA
AATATTAAAACCACTATTACTGGAATAGAGATGTTTCATCAGTTATTGGA
TAAAGCAGTCCCTGGTGACCAAGTTGGTGTCTTATTGCGTGGAGTTAAAA
AAGAGGAATTAAGACGCGGTATGATTATAACTACTCCAAAATCGGTACAG
TTGGCAAATTATTGCGATGCTCAAATTTATTTGCTGTCAGAAAGTGAAGG
AGGTCGTTCGAAACCAATTTCTGCTGCCTATCAAAGTCAAATTTACAGCA
AATCTTGGGATTGCCCAGCATATGCTCTTCTTCCTGAAGGCAAAGATTTA
GTAATGCCAGGAGAAGATAGCATGGTTAAAATGCATTTTCTGAAGAAAAT
GGCTTTAGAAGTTGGTCAACGATTTACTATGCGTGCCGGTATCACTTTGG
GCTATGGAGTAGTAGGTAAACTTTTGCCAGACCCAGGACCAGGAAAATGG
GAGAAAAATAAATAAATTGTGTAAAT
back to top

protein sequence of SMED30006638-orf-1

>SMED30006638-orf-1 ID=SMED30006638-orf-1|Name=SMED30006638-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=443bp
MIIKFVYKLLAAPTKSSIVKNSKFSTSQCIFAQPIIQPGGKKAFLRDRPH
MNVGTIGHVDHGKTTLTAAITKVLSETNQSVFKRYEEIDKAPEERKRGIT
INAAIVDYSTKNRHYAHTDCPGHADYVKNMITGTNQMEAAILVVAGTEGS
MPQTREHLVLARQIGIEHLVIFINKADAADSEMIELVELEIRELLTRYGY
DGDKTPFVVGSALCALEGRNEEIGAKKILELLDRIDEIPLPPREADKPLF
LPIENIMSITGRGTVCTGRVERGIISPGLPVEILGYNANIKTTITGIEMF
HQLLDKAVPGDQVGVLLRGVKKEELRRGMIITTPKSVQLANYCDAQIYLL
SESEGGRSKPISAAYQSQIYSKSWDCPAYALLPEGKDLVMPGEDSMVKMH
FLKKMALEVGQRFTMRAGITLGYGVVGKLLPDPGPGKWEKNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR033720EFTU_2
IPR041709EF-Tu_GTP-bd
IPR000795TF_GTP-bd_dom
IPR004160Transl_elong_EFTu/EF1A_C
IPR027417P-loop_NTPase
IPR004161EFTu-like_2
IPR031157G_TR_CS
IPR009001Transl_elong_EF1A/Init_IF2_C
IPR009000Transl_B-barrel_sf
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
GO:0000166nucleotide binding
GO:0003746translation elongation factor activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006414translational elongation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000795Transcription factor, GTP-binding domainPRINTSPR00315ELONGATNFCTcoord: 52..65
score: 73.94
coord: 169..178
score: 46.09
coord: 132..143
score: 50.75
coord: 96..104
score: 65.62
coord: 116..126
score: 60.79
IPR000795Transcription factor, GTP-binding domainPFAMPF00009GTP_EFTUcoord: 49..234
e-value: 3.2E-52
score: 176.9
IPR000795Transcription factor, GTP-binding domainPROSITEPS51722G_TR_2coord: 48..243
score: 50.675
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 41..241
e-value: 3.0E-63
score: 214.9
NoneNo IPR availableGENE3DG3DSA:2.40.30.10coord: 245..338
e-value: 3.7E-31
score: 109.2
NoneNo IPR availableGENE3DG3DSA:2.40.30.10coord: 343..433
e-value: 9.0E-23
score: 82.3
NoneNo IPR availablePANTHERPTHR43721FAMILY NOT NAMEDcoord: 39..430
NoneNo IPR availablePANTHERPTHR43721:SF22ELONGATION FACTOR TU, MITOCHONDRIALcoord: 39..430
NoneNo IPR availableCDDcd03706mtEFTU_IIIcoord: 338..429
e-value: 3.83209E-41
score: 139.674
IPR004160Translation elongation factor EFTu/EF1A, C-terminalPFAMPF03143GTP_EFTU_D3coord: 341..429
e-value: 9.8E-9
score: 35.5
IPR004161Translation elongation factor EFTu-like, domain 2PFAMPF03144GTP_EFTU_D2coord: 263..332
e-value: 4.3E-16
score: 59.1
IPR031157Tr-type G domain, conserved sitePROSITEPS00301G_TR_1coord: 89..104
IPR033720Elongation factor Tu, domain 2CDDcd03697EFTU_IIcoord: 251..334
e-value: 1.64223E-41
score: 140.346
IPR041709Elongation factor Tu (EF-Tu), GTP-binding domainCDDcd01884EF_Tucoord: 49..242
e-value: 1.93421E-130
score: 372.302
IPR009001Translation elongation factor EF1A/initiation factor IF2gamma, C-terminalSUPERFAMILYSSF50465EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domaincoord: 341..431
IPR009000Translation protein, beta-barrel domain superfamilySUPERFAMILYSSF50447Translation proteinscoord: 241..337
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 49..251