Calcium-transporting ATPase

Overview
NameCalcium-transporting ATPase
Smed IDSMED30006630
Length (bp)3367
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-transporting ATPase (SMED30006630) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30006630) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium-transporting ATPase (SMED30006630) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30006630) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006630

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30006630SMESG000039058.1 SmedASXL_013854SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30006630SMESG000039058.1 dd_Smed_v4_9529_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006630SMESG000039058.1 dd_Smed_v4_9529_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006630SMESG000051522.1 SMESG000039058.1 Contig15729newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006630SMESG000051522.1 SMESG000039058.1 Contig15729uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006630SMESG000039058.1 Contig38320uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006630SMESG000039058.1 Contig38320newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006630SMESG000039058.1 Contig39275uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006630SMESG000039058.1 Contig39275newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30006630SMESG000039058.1 dd_Smed_v6_9529_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30006630SMESG000039058.1 dd_Smed_v4_9529_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:HGNC Symbol;Acc:HGNC:811])

HSP 1 Score: 1288.48 bits (3333), Expect = 0.000e+0
Identity = 680/995 (68.34%), Postives = 798/995 (80.20%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEIT-TQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDD 3146
            MEA H +T  E L Y+ ++E TGL+ D +K   +KYG NELP E+ K+L  LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANA+VGVWQERNAE+AIEALKEYE +  KV R+  + +Q+IKAR++VPGD+VE+++GDKVPADIRI +I STT+RVDQSILTGES+SVIKHT+ + D RAVNQDKKN+LFSGTNIA+GK  G+V   G+ TEIGKIR Q+ ++E DKTPLQQKLDEFGEQLSKVIS+ICVAVW INIGHFNDP HGGSW RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V K+F++ +   G+I     F ITGS YAPEGE+    K V+   +  LVEL+ ICA+CNDS++D+NE KG YEKVGEATETAL  LVEK+N +N     LSK + A   N  ++    K+FTLEFSRDRKSMS +  P  S     G +MFVKGAPEGVIDRC +VRV      +T  +K +I+  I  +GTGRDTLRCLALAT D P K EEM L DS +F+ YET +T VGVVGMLDPPR EV  SI+ C  AGIRVI+ITGDNK TA AICRRIG+F ENE    +++TGREFD+L    Q +ACR+A  FARVEP+HKSKI+EYLQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDR PR   +PLIS WLFFRYM IG YVG ATVG+AAWWF++   GP +NY QLTH  QC      F+ +DC +F  P+PM+MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL VD L  IF++  L L +W  V+KIS+PVI +DE +KF++R  ++D
Sbjct:    1 MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILAIKSTTLRVDQSILTGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVGTEIGKIRDQMAATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFII-DKVDGDICLLNEFSITGSTYAPEGEVLKNDKPVRPGQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMKKEFTLEFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIGGYVGAATVGAAAWWFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARNYLED 994          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A2 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 [Source:HGNC Symbol;Acc:HGNC:812])

HSP 1 Score: 1286.55 bits (3328), Expect = 0.000e+0
Identity = 674/993 (67.88%), Postives = 807/993 (81.27%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H +TV EVL ++ + E TGLS + +K+ ++++G NELP E+ K+LL LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLIL+ANA+VGVWQERNAE+AIEALKEYE +  KV R   + +Q+IKA+++VPGD+VEI++GDKVPADIR+TSI STT+RVDQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTNIA+GK  GVV+A G+ TEIGKIR ++ ++E ++TPLQQKLDEFGEQLSKVIS+IC+AVW INIGHFNDP HGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++F++        +   F ITGS YAP GE++ + K V    +  LVEL+ ICA+CNDSA+DYNE KG YEKVGEATETAL CLVEK+N ++    GLSK + A   N  ++    K+FTLEFSRDRKSMS +  P +     +  +MFVKGAPEGVIDRCT +RV      MT  +K +I+  I  +G+G DTLRCLALAT DNP + EEM L DS  F+ YET +T VG VGMLDPPR EV  S+K C +AGIRVI+ITGDNK TA AICRRIG+F ++E    K+FTGREFDEL+P  Q DAC  A+ FARVEP+HKSKI+E+LQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR+  +PLIS WLFFRY+ IG YVG ATVG+AAWWF+    GP++++YQL+H  QC      F+ +DCAIF  P PM+MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL + +W  V+KIS+PVI++DET+KF++R  ++
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTP-NKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGVKQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELNPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQWLMVLKISLPVILMDETLKFVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:HGNC Symbol;Acc:HGNC:811])

HSP 1 Score: 1285.78 bits (3326), Expect = 0.000e+0
Identity = 679/994 (68.31%), Postives = 797/994 (80.18%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEIT-TQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            MEA H +T  E L Y+ ++E TGL+ D +K   +KYG NELP E+ K+L  LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANA+VGVWQERNAE+AIEALKEYE +  KV R+  + +Q+IKAR++VPGD+VE+++GDKVPADIRI +I STT+RVDQSILTGES+SVIKHT+ + D RAVNQDKKN+LFSGTNIA+GK  G+V   G+ TEIGKIR Q+ ++E DKTPLQQKLDEFGEQLSKVIS+ICVAVW INIGHFNDP HGGSW RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V K+F++ +   G+I     F ITGS YAPEGE+    K V+   +  LVEL+ ICA+CNDS++D+NE KG YEKVGEATETAL  LVEK+N +N     LSK + A   N  ++    K+FTLEFSRDRKSMS +  P  S     G +MFVKGAPEGVIDRC +VRV      +T  +K +I+  I  +GTGRDTLRCLALAT D P K EEM L DS +F+ YET +T VGVVGMLDPPR EV  SI+ C  AGIRVI+ITGDNK TA AICRRIG+F ENE    +++TGREFD+L    Q +ACR+A  FARVEP+HKSKI+EYLQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDR PR   +PLIS WLFFRYM IG YVG ATVG+AAWWF++   GP +NY QLTH  QC      F+ +DC +F  P+PM+MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL VD L  IF++  L L +W  V+KIS+PVI +DE +KF++R  ++
Sbjct:    1 MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILAIKSTTLRVDQSILTGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVGTEIGKIRDQMAATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFII-DKVDGDICLLNEFSITGSTYAPEGEVLKNDKPVRPGQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMKKEFTLEFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIGGYVGAATVGAAAWWFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARNYLE 993          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A2 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 [Source:HGNC Symbol;Acc:HGNC:812])

HSP 1 Score: 1285.01 bits (3324), Expect = 0.000e+0
Identity = 674/993 (67.88%), Postives = 806/993 (81.17%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H +TV EVL ++ + E TGLS + +K+ ++++G NELP E+ K+LL LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLIL+ANA+VGVWQERNAE+AIEALKEYE +  KV R   + +Q+IKA+++VPGD+VEI++GDKVPADIR+TSI STT+RVDQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTNIA+GK  GVV+A G+ TEIGKIR ++ ++E ++TPLQQKLDEFGEQLSKVIS+IC+AVW INIGHFNDP HGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++F++        +   F ITGS YAP GE++ + K V    +  LVEL+ ICA+CNDSA+DYNE KG YEKVGEATETAL CLVEK+N ++    GLSK + A   N  ++    K+FTLEFSRDRKSMS +  P       +  +MFVKGAPEGVIDRCT +RV      MT  +K +I+  I  +G+G DTLRCLALAT DNP + EEM L DS  F+ YET +T VG VGMLDPPR EV  S+K C +AGIRVI+ITGDNK TA AICRRIG+F ++E    K+FTGREFDEL+P  Q DAC  A+ FARVEP+HKSKI+E+LQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR+  +PLIS WLFFRY+ IG YVG ATVG+AAWWF+    GP++++YQL+H  QC      F+ +DCAIF  P PM+MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL + +W  V+KIS+PVI++DET+KF++R  ++
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKP-SRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGVKQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELNPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQWLMVLKISLPVILMDETLKFVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:813])

HSP 1 Score: 1270.37 bits (3286), Expect = 0.000e+0
Identity = 650/995 (65.33%), Postives = 789/995 (79.30%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDE 3149
            MEA H    A+VL+++ +T E GLS   +  AR++YG NELP E+ KSL  LVLEQF+DLLV+ILLLAA++SF+LA FE+ E+ T AFVEP VI+LIL+ANA+VGVWQERNAESAIEALKEYE +  KV RS  +G+Q+I+AR++VPGD+VE+++GDKVPAD+R+  I STT+RVDQSILTGES+SV KHT+AI D RAVNQDKKN+LFSGTNI SGK  GV +A GL TE+GKIR+Q+ + E ++TPLQ+KLDEFG QLS  IS+ICVAVW INIGHF DPAHGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA+KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++FV+A +  G      F I+G+ Y PEGE+    + V+      LVEL+ ICA+CNDSA+DYNE KG YEKVGEATETAL CLVEK+N ++     LS+ + A   N  ++    K+FTLEFSRDRKSMS +  P        G +MFVKGAPE VI+RC+ VRV   +  +TP  + +IL  I  +G+G DTLRCLALAT D P + E+M+L D +KFV YET +T VG VGMLDPPR EV   I +CY+AGIRV++ITGDNK TA AICRR+G+F + E   GK++TGREFD+LSPE Q  ACR A+ FARVEPAHKS+I+E LQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVLSDDNF+SIV+AVEEGRAIY+NMKQFIRYLISSN+GEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR   + LIS WLFFRY+ IG+YVG ATV +A WWF++ + GP +N+YQL +  +C     LF  +DC +F    P +MALSVLV IEM NA+NS+SENQSL  MPPW N WL+ A+ +S  LHF+IL V  L  IFQ+TPL+  +W  V++IS+PVI++DE +K++SR  M +E
Sbjct:    1 MEAAHLLPAADVLRHFSVTAEGGLSPAQVTGARERYGPNELPSEEGKSLWELVLEQFEDLLVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALKEYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSILTGESVSVTKHTEAIPDPRAVNQDKKNMLFSGTNITSGKAVGVAVATGLHTELGKIRSQMAAVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVAEADAGSCLLHEFTISGTTYTPEGEVRQGDQPVRCGQFDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLQALSRVERAGACNTVIKQLMRKEFTLEFSRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVAGKAYTGREFDDLSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYSNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRSPREALISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCSEDNPLFAGIDCEVFESRFPTTMALSVLVTIEMCNALNSVSENQSLLRMPPWMNPWLLVAVAMSMALHFLILLVPPLPLIFQVTPLSGRQWVVVLQISLPVILLDEALKYLSRNHMHEE 995          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1355.12 bits (3506), Expect = 0.000e+0
Identity = 698/1006 (69.38%), Postives = 816/1006 (81.11%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAED---ATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTS--DHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGA 3167
            ME  H +   EV +++    E GL+   ++  R KYG NE+P E+ KSL  L+LEQFDDLLVKILLLAA+ISF+LALFE+ ED   A  AFVEPFVILLILIANA VGVWQERNAESAIEALKEYE + AKV RS H GIQ ++A+ELVPGD+VE+S+GDK+PAD+R+  I STTIR+DQSILTGES+SVIKHTD++ D RAVNQDKKN LFSGTN+ASGK RG+V   GL TEIGKIRT++  +E +KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSK+F+   ++   I    F I+GS Y P G++   G+ +  +  + ++L EL+ ICAMCNDS++DYNETK  YEKVGEATETALI L EK+N +   K GLS  +L    N  +Q KW K+FTLEFSRDRKSMS +  P     G +G +MFVKGAPEGV+ RCT VRVNG+   +T  +  +I+     YGTGRDTLRCLAL TID P     M+L DST+FV YE  +T VGVVGMLDPPR+EV DSIK C  AGIRVI+ITGDNK TAEAI RRIG+F ENE T GK++TGREFD+L PE Q +ACR+AKLFARVEP+HKSKI++ LQS G I+AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSAS+MVL+DDNF+SIVSAVEEGRAIYNNMKQFIRYLISSN+GEVVSIF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDR PR A+D LIS WLFFRY+ +G YVG ATVG++ WWF+ Y  GPQ+ YYQLTH  +C  + + F  +DCA+F    P +MALSVLV IEMLNA+NSLSENQSL VMPPW N+WL+ A+ LS  LHFVIL VDI++ IFQITPL  +EW AV+KIS+PV+++DE +KFI+R  +D +P   GA
Sbjct:    1 MEDAHAKDANEVCKFFGTGPE-GLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPAS---GGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYIDGKPETVGA 1002          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1350.5 bits (3494), Expect = 0.000e+0
Identity = 696/1000 (69.60%), Postives = 813/1000 (81.30%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAED---ATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTS--DHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDE 3149
            ME  H +   EV +++    E GL+   ++  R KYG NE+P E+ KSL  L+LEQFDDLLVKILLLAA+ISF+LALFE+ ED   A  AFVEPFVILLILIANA VGVWQERNAESAIEALKEYE + AKV RS H GIQ ++A+ELVPGD+VE+S+GDK+PAD+R+  I STTIR+DQSILTGES+SVIKHTD++ D RAVNQDKKN LFSGTN+ASGK RG+V   GL TEIGKIRT++  +E +KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSK+F+   ++   I    F I+GS Y P G++   G+ +  +  + ++L EL+ ICAMCNDS++DYNETK  YEKVGEATETALI L EK+N +   K GLS  +L    N  +Q KW K+FTLEFSRDRKSMS +  P     G +G +MFVKGAPEGV+ RCT VRVNG+   +T  +  +I+     YGTGRDTLRCLAL TID P     M+L DST+FV YE  +T VGVVGMLDPPR+EV DSIK C  AGIRVI+ITGDNK TAEAI RRIG+F ENE T GK++TGREFD+L PE Q +ACR+AKLFARVEP+HKSKI++ LQS G I+AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSAS+MVL+DDNF+SIVSAVEEGRAIYNNMKQFIRYLISSN+GEVVSIF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDR PR A+D LIS WLFFRY+ +G YVG ATVG++ WWF+ Y  GPQ+ YYQLTH  +C  + + F  +DCA+F    P +MALSVLV IEMLNA+NSLSENQSL VMPPW N+WL+ A+ LS  LHFVIL VDI++ IFQITPL  +EW AV+KIS+PV+++DE +KFI+R  +D E
Sbjct:    1 MEDAHAKDANEVCKFFGTGPE-GLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPAS---GGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYIDVE 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1350.5 bits (3494), Expect = 0.000e+0
Identity = 696/1000 (69.60%), Postives = 813/1000 (81.30%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAED---ATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTS--DHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDE 3149
            ME  H +   EV +++    E GL+   ++  R KYG NE+P E+ KSL  L+LEQFDDLLVKILLLAA+ISF+LALFE+ ED   A  AFVEPFVILLILIANA VGVWQERNAESAIEALKEYE + AKV RS H GIQ ++A+ELVPGD+VE+S+GDK+PAD+R+  I STTIR+DQSILTGES+SVIKHTD++ D RAVNQDKKN LFSGTN+ASGK RG+V   GL TEIGKIRT++  +E +KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSK+F+   ++   I    F I+GS Y P G++   G+ +  +  + ++L EL+ ICAMCNDS++DYNETK  YEKVGEATETALI L EK+N +   K GLS  +L    N  +Q KW K+FTLEFSRDRKSMS +  P     G +G +MFVKGAPEGV+ RCT VRVNG+   +T  +  +I+     YGTGRDTLRCLAL TID P     M+L DST+FV YE  +T VGVVGMLDPPR+EV DSIK C  AGIRVI+ITGDNK TAEAI RRIG+F ENE T GK++TGREFD+L PE Q +ACR+AKLFARVEP+HKSKI++ LQS G I+AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSAS+MVL+DDNF+SIVSAVEEGRAIYNNMKQFIRYLISSN+GEVVSIF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDR PR A+D LIS WLFFRY+ +G YVG ATVG++ WWF+ Y  GPQ+ YYQLTH  +C  + + F  +DCA+F    P +MALSVLV IEMLNA+NSLSENQSL VMPPW N+WL+ A+ LS  LHFVIL VDI++ IFQITPL  +EW AV+KIS+PV+++DE +KFI+R  +D E
Sbjct:    1 MEDAHAKDANEVCKFFGTGPE-GLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPAS---GGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYIDVE 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1350.5 bits (3494), Expect = 0.000e+0
Identity = 696/1000 (69.60%), Postives = 813/1000 (81.30%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAED---ATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTS--DHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDE 3149
            ME  H +   EV +++    E GL+   ++  R KYG NE+P E+ KSL  L+LEQFDDLLVKILLLAA+ISF+LALFE+ ED   A  AFVEPFVILLILIANA VGVWQERNAESAIEALKEYE + AKV RS H GIQ ++A+ELVPGD+VE+S+GDK+PAD+R+  I STTIR+DQSILTGES+SVIKHTD++ D RAVNQDKKN LFSGTN+ASGK RG+V   GL TEIGKIRT++  +E +KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSK+F+   ++   I    F I+GS Y P G++   G+ +  +  + ++L EL+ ICAMCNDS++DYNETK  YEKVGEATETALI L EK+N +   K GLS  +L    N  +Q KW K+FTLEFSRDRKSMS +  P     G +G +MFVKGAPEGV+ RCT VRVNG+   +T  +  +I+     YGTGRDTLRCLAL TID P     M+L DST+FV YE  +T VGVVGMLDPPR+EV DSIK C  AGIRVI+ITGDNK TAEAI RRIG+F ENE T GK++TGREFD+L PE Q +ACR+AKLFARVEP+HKSKI++ LQS G I+AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSAS+MVL+DDNF+SIVSAVEEGRAIYNNMKQFIRYLISSN+GEVVSIF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDR PR A+D LIS WLFFRY+ +G YVG ATVG++ WWF+ Y  GPQ+ YYQLTH  +C  + + F  +DCA+F    P +MALSVLV IEMLNA+NSLSENQSL VMPPW N+WL+ A+ LS  LHFVIL VDI++ IFQITPL  +EW AV+KIS+PV+++DE +KFI+R  +D E
Sbjct:    1 MEDAHAKDANEVCKFFGTGPE-GLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPAS---GGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYIDVE 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1254.2 bits (3244), Expect = 0.000e+0
Identity = 615/877 (70.13%), Postives = 719/877 (81.98%), Query Frame = 3
Query:  543 AKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTS--DHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGA 3167
            AKV RS H GIQ ++A+ELVPGD+VE+S+GDK+PAD+R+  I STTIR+DQSILTGES+SVIKHTD++ D RAVNQDKKN LFSGTN+ASGK RG+V   GL TEIGKIRT++  +E +KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSK+F+   ++   I    F I+GS Y P G++   G+ +  +  + ++L EL+ ICAMCNDS++DYNETK  YEKVGEATETALI L EK+N +   K GLS  +L    N  +Q KW K+FTLEFSRDRKSMS +  P     G +G +MFVKGAPEGV+ RCT VRVNG+   +T  +  +I+     YGTGRDTLRCLAL TID P     M+L DST+FV YE  +T VGVVGMLDPPR+EV DSIK C  AGIRVI+ITGDNK TAEAI RRIG+F ENE T GK++TGREFD+L PE Q +ACR+AKLFARVEP+HKSKI++ LQS G I+AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSAS+MVL+DDNF+SIVSAVEEGRAIYNNMKQFIRYLISSN+GEVVSIF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDR PR A+D LIS WLFFRY+ +G YVG ATVG++ WWF+ Y  GPQ+ YYQLTH  +C  + + F  +DCA+F    P +MALSVLV IEMLNA+NSLSENQSL VMPPW N+WL+ A+ LS  LHFVIL VDI++ IFQITPL  +EW AV+KIS+PV+++DE +KFI+R  +D +P   GA
Sbjct:    2 AKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPAS---GGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYIDGKPETVGA 875          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072216)

HSP 1 Score: 1353.19 bits (3501), Expect = 0.000e+0
Identity = 713/1008 (70.73%), Postives = 824/1008 (81.75%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGAYGVFLMW 3188
            ME  H++TV + L ++    E GL+ D IK  +KKYG NELP E+ KS+  LVLEQFDDLLVKILLLAA+ISF+LALFE+ E+   AFVEP VILLILIANAVVGVWQERNAESAIEALKEYE +  KV R    GIQK++A+E+VPGD+VE+S+GDK+PADIRIT I STT+R+DQSILTGES+SVIKHTDAI D RAVNQDKKNILFSGTN+A+GK RGVVI  GL T IGKIRT++  +E  KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSWI+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS++F+       + +   F++TGS Y P GE++  G+ +K +D+  L ELS IC MCNDSAIDYNE K  +EKVGEATETALI L EKLN +++ K GL +   A+     +++KW K+FTLEFSRDRKSMS++  P  +    TG ++FVKGAPEGV++RCT  RV      +T  +K++IL     YGTGRDTLRCLALA  D+P KP+EMDL DSTKF  YE  +T VGVVGMLDPPR EV DSI +C  AGIRVIVITGDNKATAEAICRRIGVF E+E T GKS++GREFD+LSP  Q  A  +++LF+RVEP HKSKI+E+LQS   ISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR A + LIS WLFFRYM IG YVG ATVG+AAWWF+F   GP+L+Y+QLTH   CL   + F  +DC IF  P  M+MALSVLV IEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D E  +   +G+ LMW
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMW 1008          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072211)

HSP 1 Score: 1353.19 bits (3501), Expect = 0.000e+0
Identity = 713/1008 (70.73%), Postives = 824/1008 (81.75%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGAYGVFLMW 3188
            ME  H++TV + L ++    E GL+ D IK  +KKYG NELP E+ KS+  LVLEQFDDLLVKILLLAA+ISF+LALFE+ E+   AFVEP VILLILIANAVVGVWQERNAESAIEALKEYE +  KV R    GIQK++A+E+VPGD+VE+S+GDK+PADIRIT I STT+R+DQSILTGES+SVIKHTDAI D RAVNQDKKNILFSGTN+A+GK RGVVI  GL T IGKIRT++  +E  KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSWI+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS++F+       + +   F++TGS Y P GE++  G+ +K +D+  L ELS IC MCNDSAIDYNE K  +EKVGEATETALI L EKLN +++ K GL +   A+     +++KW K+FTLEFSRDRKSMS++  P  +    TG ++FVKGAPEGV++RCT  RV      +T  +K++IL     YGTGRDTLRCLALA  D+P KP+EMDL DSTKF  YE  +T VGVVGMLDPPR EV DSI +C  AGIRVIVITGDNKATAEAICRRIGVF E+E T GKS++GREFD+LSP  Q  A  +++LF+RVEP HKSKI+E+LQS   ISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR A + LIS WLFFRYM IG YVG ATVG+AAWWF+F   GP+L+Y+QLTH   CL   + F  +DC IF  P  M+MALSVLV IEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D E  +   +G+ LMW
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMW 1008          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072214)

HSP 1 Score: 1353.19 bits (3501), Expect = 0.000e+0
Identity = 713/1008 (70.73%), Postives = 824/1008 (81.75%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGAYGVFLMW 3188
            ME  H++TV + L ++    E GL+ D IK  +KKYG NELP E+ KS+  LVLEQFDDLLVKILLLAA+ISF+LALFE+ E+   AFVEP VILLILIANAVVGVWQERNAESAIEALKEYE +  KV R    GIQK++A+E+VPGD+VE+S+GDK+PADIRIT I STT+R+DQSILTGES+SVIKHTDAI D RAVNQDKKNILFSGTN+A+GK RGVVI  GL T IGKIRT++  +E  KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSWI+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS++F+       + +   F++TGS Y P GE++  G+ +K +D+  L ELS IC MCNDSAIDYNE K  +EKVGEATETALI L EKLN +++ K GL +   A+     +++KW K+FTLEFSRDRKSMS++  P  +    TG ++FVKGAPEGV++RCT  RV      +T  +K++IL     YGTGRDTLRCLALA  D+P KP+EMDL DSTKF  YE  +T VGVVGMLDPPR EV DSI +C  AGIRVIVITGDNKATAEAICRRIGVF E+E T GKS++GREFD+LSP  Q  A  +++LF+RVEP HKSKI+E+LQS   ISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR A + LIS WLFFRYM IG YVG ATVG+AAWWF+F   GP+L+Y+QLTH   CL   + F  +DC IF  P  M+MALSVLV IEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D E  +   +G+ LMW
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMW 1008          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072212)

HSP 1 Score: 1353.19 bits (3501), Expect = 0.000e+0
Identity = 713/1008 (70.73%), Postives = 824/1008 (81.75%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGAYGVFLMW 3188
            ME  H++TV + L ++    E GL+ D IK  +KKYG NELP E+ KS+  LVLEQFDDLLVKILLLAA+ISF+LALFE+ E+   AFVEP VILLILIANAVVGVWQERNAESAIEALKEYE +  KV R    GIQK++A+E+VPGD+VE+S+GDK+PADIRIT I STT+R+DQSILTGES+SVIKHTDAI D RAVNQDKKNILFSGTN+A+GK RGVVI  GL T IGKIRT++  +E  KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSWI+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS++F+       + +   F++TGS Y P GE++  G+ +K +D+  L ELS IC MCNDSAIDYNE K  +EKVGEATETALI L EKLN +++ K GL +   A+     +++KW K+FTLEFSRDRKSMS++  P  +    TG ++FVKGAPEGV++RCT  RV      +T  +K++IL     YGTGRDTLRCLALA  D+P KP+EMDL DSTKF  YE  +T VGVVGMLDPPR EV DSI +C  AGIRVIVITGDNKATAEAICRRIGVF E+E T GKS++GREFD+LSP  Q  A  +++LF+RVEP HKSKI+E+LQS   ISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR A + LIS WLFFRYM IG YVG ATVG+AAWWF+F   GP+L+Y+QLTH   CL   + F  +DC IF  P  M+MALSVLV IEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D E  +   +G+ LMW
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMW 1008          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072217)

HSP 1 Score: 1353.19 bits (3501), Expect = 0.000e+0
Identity = 713/1008 (70.73%), Postives = 824/1008 (81.75%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGAYGVFLMW 3188
            ME  H++TV + L ++    E GL+ D IK  +KKYG NELP E+ KS+  LVLEQFDDLLVKILLLAA+ISF+LALFE+ E+   AFVEP VILLILIANAVVGVWQERNAESAIEALKEYE +  KV R    GIQK++A+E+VPGD+VE+S+GDK+PADIRIT I STT+R+DQSILTGES+SVIKHTDAI D RAVNQDKKNILFSGTN+A+GK RGVVI  GL T IGKIRT++  +E  KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSWI+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS++F+       + +   F++TGS Y P GE++  G+ +K +D+  L ELS IC MCNDSAIDYNE K  +EKVGEATETALI L EKLN +++ K GL +   A+     +++KW K+FTLEFSRDRKSMS++  P  +    TG ++FVKGAPEGV++RCT  RV      +T  +K++IL     YGTGRDTLRCLALA  D+P KP+EMDL DSTKF  YE  +T VGVVGMLDPPR EV DSI +C  AGIRVIVITGDNKATAEAICRRIGVF E+E T GKS++GREFD+LSP  Q  A  +++LF+RVEP HKSKI+E+LQS   ISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR A + LIS WLFFRYM IG YVG ATVG+AAWWF+F   GP+L+Y+QLTH   CL   + F  +DC IF  P  M+MALSVLV IEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D E  +   +G+ LMW
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMW 1008          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:ZFIN;Acc:ZDB-GENE-060531-103])

HSP 1 Score: 1308.89 bits (3386), Expect = 0.000e+0
Identity = 672/995 (67.54%), Postives = 801/995 (80.50%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDE 3149
            ME  H ++ +EVL  + + E TGL+ + +K    KYG NELP E+ KSL  LV+EQF+DLLV+ILLLAA +SF+LALFE+ E++T AFVEP VILLIL+ANAV+GVWQERNAE+AIEALKEYE +  KV R +   +Q+IKAR++VPGD+VEIS+GDKVPADIRITSI STT+RVDQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTNIA+G+  GVV++ G+ TEIGKIR Q+ ++E +KTPLQQKLDEFG+QLSKVIS+IC+AVW INIGHF DP HGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++FV+  +     +   F I+GS YAPEGE+    K V+  D+  LVEL+ IC++CNDS++DYNE KG YEKVGEATETAL  LVEK+N +     GLSK D A   N  ++    KKFTLEFSRDRKSMS +  P  +   ++  +MFVKGAPEGVIDRC FVRV  E   +T  +K E++  I  +GTGRDTLRCLALAT D+P   ++MDL ++ KF  YE+ +T VG VGMLDPPR EV  SIK C KAGIRVI+ITGDNK TA AICRRIG+F ENE   G+++TGREFD+L+PE Q +A ++A+ FARVEPAHKSKI+ YLQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLSDDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMD+ PR+  +PLIS WLFFRY+ IG YVG  TV +A WW++F   GPQ+++YQL H  QC  +  +F+ ++C +F    P +MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+GA+ LS  LHF+IL V+ L  IFQ+TPL   +W  V KISIPVI++DE +K+ISR  ++ E
Sbjct:    1 MENAHTKSASEVLANFGVNENTGLTLEQVKNNFDKYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPIVILLILVANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRTAVQRIKARDIVPGDIVEISVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGRAIGVVVSTGVSTEIGKIRNQMAATEQEKTPLQQKLDEFGQQLSKVISLICIAVWVINIGHFADPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVNKADDSSCSLHEFTISGSTYAPEGEVLKADKQVQCGDYDGLVELATICSLCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVDRAAACNLIIRQLMQKKFTLEFSRDRKSMSVYCTPNGT---NSQSKMFVKGAPEGVIDRCQFVRVGKERFPLTMAVKEELMSTIRDWGTGRDTLRCLALATRDSPPAVDKMDLENAGKFAEYESSLTFVGCVGMLDPPRKEVIGSIKLCNKAGIRVIMITGDNKGTAVAICRRIGIFSENEDVEGRAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVAYLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVSAATWWYLFDEDGPQVSFYQLRHFMQCTEENPMFEGINCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILHVEPLPLIFQVTPLHFSQWIIVFKISIPVILLDEALKYISRHHLEGE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:ZFIN;Acc:ZDB-GENE-060531-103])

HSP 1 Score: 1306.2 bits (3379), Expect = 0.000e+0
Identity = 671/993 (67.57%), Postives = 800/993 (80.56%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H ++ +EVL  + + E TGL+ + +K    KYG NELP E+ KSL  LV+EQF+DLLV+ILLLAA +SF+LALFE+ E++T AFVEP VILLIL+ANAV+GVWQERNAE+AIEALKEYE +  KV R +   +Q+IKAR++VPGD+VEIS+GDKVPADIRITSI STT+RVDQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTNIA+G+  GVV++ G+ TEIGKIR Q+ ++E +KTPLQQKLDEFG+QLSKVIS+IC+AVW INIGHF DP HGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++FV+  +     +   F I+GS YAPEGE+    K V+  D+  LVEL+ IC++CNDS++DYNE KG YEKVGEATETAL  LVEK+N +     GLSK D A   N  ++    KKFTLEFSRDRKSMS +  P  +   ++  +MFVKGAPEGVIDRC FVRV  E   +T  +K E++  I  +GTGRDTLRCLALAT D+P   ++MDL ++ KF  YE+ +T VG VGMLDPPR EV  SIK C KAGIRVI+ITGDNK TA AICRRIG+F ENE   G+++TGREFD+L+PE Q +A ++A+ FARVEPAHKSKI+ YLQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLSDDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMD+ PR+  +PLIS WLFFRY+ IG YVG  TV +A WW++F   GPQ+++YQL H  QC  +  +F+ ++C +F    P +MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+GA+ LS  LHF+IL V+ L  IFQ+TPL   +W  V KISIPVI++DE +K+ISR  ++
Sbjct:    1 MENAHTKSASEVLANFGVNENTGLTLEQVKNNFDKYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPIVILLILVANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRTAVQRIKARDIVPGDIVEISVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGRAIGVVVSTGVSTEIGKIRNQMAATEQEKTPLQQKLDEFGQQLSKVISLICIAVWVINIGHFADPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVNKADDSSCSLHEFTISGSTYAPEGEVLKADKQVQCGDYDGLVELATICSLCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVDRAAACNLIIRQLMQKKFTLEFSRDRKSMSVYCTPNGT---NSQSKMFVKGAPEGVIDRCQFVRVGKERFPLTMAVKEELMSTIRDWGTGRDTLRCLALATRDSPPAVDKMDLENAGKFAEYESSLTFVGCVGMLDPPRKEVIGSIKLCNKAGIRVIMITGDNKGTAVAICRRIGIFSENEDVEGRAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVAYLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVSAATWWYLFDEDGPQVSFYQLRHFMQCTEENPMFEGINCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILHVEPLPLIFQVTPLHFSQWIIVFKISIPVILLDEALKYISRHHLE 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-020905-1])

HSP 1 Score: 1296.57 bits (3354), Expect = 0.000e+0
Identity = 679/995 (68.24%), Postives = 800/995 (80.40%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDE 3149
            ME  H +   E L Y+ ++E TGL+ + +K+ + KYG+NELP E+ KS+  LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANAVVGVWQERNAESAIEALKEYE +  KV RS  + +Q+IKARE+VPGD+VE+S+GDKVPADIRIT+I STT+RVDQSILTGES+SVIKHT+++ D RAVNQDKKN+LFSGTNIA+GK  GVV+A G+ TEIGKIR Q+ ++E +KTPLQQKLDEFGEQLSKVIS+ICVAVW INIGHFNDP HGGSWIRGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V+K+FV+       +T   +DI+GSKY PEGE+   G  VK      LVEL+ ICA+CNDS++DYNE+KG YEKVGEATETAL CLVEK+N +N    GLSK + A      ++    K FTLEFSRDRKSMS +  P  +     G +MFVKGAPEGVIDRC +VRV      +T  +K +I+  I  +GTGRDTLRCLALAT DNP +PEEM+L DSTKF  YET +T VG VGMLDPPR EV  SI+ C  AGIRVI+ITGDNK TA AICRRIG+F ++E   G++FTGREFD+L    Q +A RKA  +ARVEP+HKSKI+E+LQ    I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSSIV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR   +PLIS WLFFRY+ IG YVG ATV +A WWF++   GP +++YQL+H  QC A  E F  ++C +F    PM+MALSVLV IEM NA+NSLSENQSL  MPPW+NLWL GAM LS  LHF+I+ VD L  IF++T L   +W  V+K+S PVI+IDE +KF++R  ++++
Sbjct:    1 MENAHTKETPECLAYFGVSESTGLTPEQVKKNQAKYGFNELPAEEGKSIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITAIRSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIEKVEGESVTLDQYDISGSKYTPEGEVTKNGLPVKCGQFDGLVELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTDVRGLSKVERANTCCAVIKQLMKKDFTLEFSRDRKSMSVYCSPAKASKAPVGNKMFVKGAPEGVIDRCAYVRVGTTRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDNPLRPEEMNLEDSTKFAEYETDLTFVGCVGMLDPPRKEVVGSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFSDDEDVTGRAFTGREFDDLPLPQQREAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGAATVAAAGWWFLYCDEGPMVSFYQLSHFMQCTADNEDFAGIECEVFEAAPPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWSNLWLAGAMTLSMSLHFMIIYVDPLPMIFKLTHLNFDQWIVVLKLSFPVILIDEALKFVARNYLEEK 995          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-020905-1])

HSP 1 Score: 1295.41 bits (3351), Expect = 0.000e+0
Identity = 679/993 (68.38%), Postives = 798/993 (80.36%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H +   E L Y+ ++E TGL+ + +K+ + KYG+NELP E+ KS+  LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANAVVGVWQERNAESAIEALKEYE +  KV RS  + +Q+IKARE+VPGD+VE+S+GDKVPADIRIT+I STT+RVDQSILTGES+SVIKHT+++ D RAVNQDKKN+LFSGTNIA+GK  GVV+A G+ TEIGKIR Q+ ++E +KTPLQQKLDEFGEQLSKVIS+ICVAVW INIGHFNDP HGGSWIRGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V+K+FV+       +T   +DI+GSKY PEGE+   G  VK      LVEL+ ICA+CNDS++DYNE+KG YEKVGEATETAL CLVEK+N +N    GLSK + A      ++    K FTLEFSRDRKSMS +  P  +     G +MFVKGAPEGVIDRC +VRV      +T  +K +I+  I  +GTGRDTLRCLALAT DNP +PEEM+L DSTKF  YET +T VG VGMLDPPR EV  SI+ C  AGIRVI+ITGDNK TA AICRRIG+F ++E   G++FTGREFD+L    Q +A RKA  +ARVEP+HKSKI+E+LQ    I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSSIV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR   +PLIS WLFFRY+ IG YVG ATV +A WWF++   GP +++YQL+H  QC A  E F  ++C +F    PM+MALSVLV IEM NA+NSLSENQSL  MPPW+NLWL GAM LS  LHF+I+ VD L  IF++T L   +W  V+K+S PVI+IDE +KF++R  ++
Sbjct:    1 MENAHTKETPECLAYFGVSESTGLTPEQVKKNQAKYGFNELPAEEGKSIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITAIRSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIEKVEGESVTLDQYDISGSKYTPEGEVTKNGLPVKCGQFDGLVELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTDVRGLSKVERANTCCAVIKQLMKKDFTLEFSRDRKSMSVYCSPAKASKAPVGNKMFVKGAPEGVIDRCAYVRVGTTRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDNPLRPEEMNLEDSTKFAEYETDLTFVGCVGMLDPPRKEVVGSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFSDDEDVTGRAFTGREFDDLPLPQQREAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGAATVAAAGWWFLYCDEGPMVSFYQLSHFMQCTADNEDFAGIECEVFEAAPPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWSNLWLAGAMTLSMSLHFMIIYVDPLPMIFKLTHLNFDQWIVVLKLSFPVILIDEALKFVARNYLE 993          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-020905-1])

HSP 1 Score: 1295.41 bits (3351), Expect = 0.000e+0
Identity = 679/993 (68.38%), Postives = 798/993 (80.36%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H +   E L Y+ ++E TGL+ + +K+ + KYG+NELP E+ KS+  LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANAVVGVWQERNAESAIEALKEYE +  KV RS  + +Q+IKARE+VPGD+VE+S+GDKVPADIRIT+I STT+RVDQSILTGES+SVIKHT+++ D RAVNQDKKN+LFSGTNIA+GK  GVV+A G+ TEIGKIR Q+ ++E +KTPLQQKLDEFGEQLSKVIS+ICVAVW INIGHFNDP HGGSWIRGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V+K+FV+       +T   +DI+GSKY PEGE+   G  VK      LVEL+ ICA+CNDS++DYNE+KG YEKVGEATETAL CLVEK+N +N    GLSK + A      ++    K FTLEFSRDRKSMS +  P  +     G +MFVKGAPEGVIDRC +VRV      +T  +K +I+  I  +GTGRDTLRCLALAT DNP +PEEM+L DSTKF  YET +T VG VGMLDPPR EV  SI+ C  AGIRVI+ITGDNK TA AICRRIG+F ++E   G++FTGREFD+L    Q +A RKA  +ARVEP+HKSKI+E+LQ    I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSSIV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR   +PLIS WLFFRY+ IG YVG ATV +A WWF++   GP +++YQL+H  QC A  E F  ++C +F    PM+MALSVLV IEM NA+NSLSENQSL  MPPW+NLWL GAM LS  LHF+I+ VD L  IF++T L   +W  V+K+S PVI+IDE +KF++R  ++
Sbjct:    1 MENAHTKETPECLAYFGVSESTGLTPEQVKKNQAKYGFNELPAEEGKSIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITAIRSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIEKVEGESVTLDQYDISGSKYTPEGEVTKNGLPVKCGQFDGLVELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTDVRGLSKVERANTCCAVIKQLMKKDFTLEFSRDRKSMSVYCSPAKASKAPVGNKMFVKGAPEGVIDRCAYVRVGTTRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDNPLRPEEMNLEDSTKFAEYETDLTFVGCVGMLDPPRKEVVGSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFSDDEDVTGRAFTGREFDDLPLPQQREAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGAATVAAAGWWFLYCDEGPMVSFYQLSHFMQCTADNEDFAGIECEVFEAAPPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWSNLWLAGAMTLSMSLHFMIIYVDPLPMIFKLTHLNFDQWIVVLKLSFPVILIDEALKFVARNYLE 993          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: atp2a3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:NCBI gene;Acc:779786])

HSP 1 Score: 1297.34 bits (3356), Expect = 0.000e+0
Identity = 664/993 (66.87%), Postives = 797/993 (80.26%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            M++ H +TV+EVL+++++ E  GLS + ++ +R+KYG NELP E+ KSL  LVLEQF+DLLV+ILLLAA +SFILA FE+ E+ T AFVEP VI++IL+ NA VGVWQERNAESAIEALKEYE +  KV R    G+Q+I+AR++VPGD+VE+++GDKVPADIRIT I STT+RVDQSILTGES+SVIKHTD I D RAVNQDKKN+LFSGTNIA+GK  G+VIA G+ TEIGKIR Q+ ++E +KTPLQQKLDEFG+QLSKVIS+ICVAVW INIGHFNDP HGGSW RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS++FV+        +   F ITGS YAP G++  + + V    +  LVEL+ ICA+CNDS++D+NE+KG YEKVGEATETAL CLVEK+N +N     LSK + A   N  ++    K+ TLEFSRDRKSMS +        G +  +MFVKGAPE VI+RC +VRV      +TP  + +I+  I  +GTG DTLRCLALAT D P K E+M L DSTKF+NYET +T VG VGMLDPPR EV  SI+ C +AGI+VI+ITGDNK TA AICR+IG+F + E    K++TGREFD+L PE Q +ACR A+ FARVEPAHKSKI+EYLQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNFSSIVSAVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR+  +PLIS WLFFRY+ IG+YVG ATVG+A WWF++   GPQ+ +YQL H  +C +   LF  +DC +F    P +MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+GA+ +S  LHF+IL +  +  +FQ+TPL   +W  V+KIS+PVI++DE +K+ISR  +D
Sbjct:    1 MDSAHAKTVSEVLRHFEVNENCGLSSEQVRRSREKYGLNELPAEEGKSLWELVLEQFEDLLVRILLLAAFVSFILAWFEEGEETTTAFVEPIVIIMILVINAFVGVWQERNAESAIEALKEYEPEMGKVIRGDRSGVQRIRARDIVPGDIVEVAVGDKVPADIRITEIRSTTLRVDQSILTGESVSVIKHTDPIPDPRAVNQDKKNMLFSGTNIAAGKAVGIVIATGIYTEIGKIRNQMVATEPEKTPLQQKLDEFGQQLSKVISLICVAVWVINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFVIEKIEGVNCSFHEFSITGSTYAPVGQVLKDEQPVNCGQYDGLVELATICALCNDSSLDFNESKGVYEKVGEATETALTCLVEKMNVFNTDLSTLSKVERANACNSVIKKLMKKECTLEFSRDRKSMSVYCNSVAPNSGQSASKMFVKGAPESVIERCNYVRVGSTKLPLTPSAREKIMSKIRDWGTGMDTLRCLALATRDVPPKLEDMQLDDSTKFINYETNLTFVGCVGMLDPPRKEVSISIELCKRAGIKVIMITGDNKGTAVAICRKIGIFSDYEDITDKAYTGREFDDLPPERQREACRSARCFARVEPAHKSKIVEYLQSYSEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRNPREPLISGWLFFRYLAIGVYVGLATVGAATWWFLYDEDGPQVTFYQLRHFMKCTSDNPLFSGIDCDVFESRYPTTMALSVLVTIEMCNALNSLSENQSLLRMPPWLNIWLLGAIIMSMALHFLILYIKPMPLVFQVTPLNWSQWVVVLKISLPVILLDEGLKYISRHHLD 993          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: atp2a3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:NCBI gene;Acc:779786])

HSP 1 Score: 1297.34 bits (3356), Expect = 0.000e+0
Identity = 664/993 (66.87%), Postives = 797/993 (80.26%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            M++ H +TV+EVL+++++ E  GLS + ++ +R+KYG NELP E+ KSL  LVLEQF+DLLV+ILLLAA +SFILA FE+ E+ T AFVEP VI++IL+ NA VGVWQERNAESAIEALKEYE +  KV R    G+Q+I+AR++VPGD+VE+++GDKVPADIRIT I STT+RVDQSILTGES+SVIKHTD I D RAVNQDKKN+LFSGTNIA+GK  G+VIA G+ TEIGKIR Q+ ++E +KTPLQQKLDEFG+QLSKVIS+ICVAVW INIGHFNDP HGGSW RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS++FV+        +   F ITGS YAP G++  + + V    +  LVEL+ ICA+CNDS++D+NE+KG YEKVGEATETAL CLVEK+N +N     LSK + A   N  ++    K+ TLEFSRDRKSMS +        G +  +MFVKGAPE VI+RC +VRV      +TP  + +I+  I  +GTG DTLRCLALAT D P K E+M L DSTKF+NYET +T VG VGMLDPPR EV  SI+ C +AGI+VI+ITGDNK TA AICR+IG+F + E    K++TGREFD+L PE Q +ACR A+ FARVEPAHKSKI+EYLQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNFSSIVSAVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR+  +PLIS WLFFRY+ IG+YVG ATVG+A WWF++   GPQ+ +YQL H  +C +   LF  +DC +F    P +MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+GA+ +S  LHF+IL +  +  +FQ+TPL   +W  V+KIS+PVI++DE +K+ISR  +D
Sbjct:    1 MDSAHAKTVSEVLRHFEVNENCGLSSEQVRRSREKYGLNELPAEEGKSLWELVLEQFEDLLVRILLLAAFVSFILAWFEEGEETTTAFVEPIVIIMILVINAFVGVWQERNAESAIEALKEYEPEMGKVIRGDRSGVQRIRARDIVPGDIVEVAVGDKVPADIRITEIRSTTLRVDQSILTGESVSVIKHTDPIPDPRAVNQDKKNMLFSGTNIAAGKAVGIVIATGIYTEIGKIRNQMVATEPEKTPLQQKLDEFGQQLSKVISLICVAVWVINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFVIEKIEGVNCSFHEFSITGSTYAPVGQVLKDEQPVNCGQYDGLVELATICALCNDSSLDFNESKGVYEKVGEATETALTCLVEKMNVFNTDLSTLSKVERANACNSVIKKLMKKECTLEFSRDRKSMSVYCNSVAPNSGQSASKMFVKGAPESVIERCNYVRVGSTKLPLTPSAREKIMSKIRDWGTGMDTLRCLALATRDVPPKLEDMQLDDSTKFINYETNLTFVGCVGMLDPPRKEVSISIELCKRAGIKVIMITGDNKGTAVAICRKIGIFSDYEDITDKAYTGREFDDLPPERQREACRSARCFARVEPAHKSKIVEYLQSYSEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRNPREPLISGWLFFRYLAIGVYVGLATVGAATWWFLYDEDGPQVTFYQLRHFMKCTSDNPLFSGIDCDVFESRYPTTMALSVLVTIEMCNALNSLSENQSLLRMPPWLNIWLLGAIIMSMALHFLILYIKPMPLVFQVTPLNWSQWVVVLKISLPVILLDEGLKYISRHHLD 993          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: atp2a3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:NCBI gene;Acc:779786])

HSP 1 Score: 1296.95 bits (3355), Expect = 0.000e+0
Identity = 664/993 (66.87%), Postives = 797/993 (80.26%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            M++ H +TV+EVL+++++ E  GLS + ++ +R+KYG NELP E+ KSL  LVLEQF+DLLV+ILLLAA +SFILA FE+ E+ T AFVEP VI++IL+ NA VGVWQERNAESAIEALKEYE +  KV R    G+Q+I+AR++VPGD+VE+++GDKVPADIRIT I STT+RVDQSILTGES+SVIKHTD I D RAVNQDKKN+LFSGTNIA+GK  G+VIA G+ TEIGKIR Q+ ++E +KTPLQQKLDEFG+QLSKVIS+ICVAVW INIGHFNDP HGGSW RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS++FV+        +   F ITGS YAP G++  + + V    +  LVEL+ ICA+CNDS++D+NE+KG YEKVGEATETAL CLVEK+N +N     LSK + A   N  ++    K+ TLEFSRDRKSMS +        G +  +MFVKGAPE VI+RC +VRV      +TP  + +I+  I  +GTG DTLRCLALAT D P K E+M L DSTKF+NYET +T VG VGMLDPPR EV  SI+ C +AGI+VI+ITGDNK TA AICR+IG+F + E    K++TGREFD+L PE Q +ACR A+ FARVEPAHKSKI+EYLQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNFSSIVSAVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR+  +PLIS WLFFRY+ IG+YVG ATVG+A WWF++   GPQ+ +YQL H  +C +   LF  +DC +F    P +MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+GA+ +S  LHF+IL +  +  +FQ+TPL   +W  V+KIS+PVI++DE +K+ISR  +D
Sbjct:    1 MDSAHAKTVSEVLRHFEVNENCGLSSEQVRRSREKYGLNELPAEEGKSLWELVLEQFEDLLVRILLLAAFVSFILAWFEEGEETTTAFVEPIVIIMILVINAFVGVWQERNAESAIEALKEYEPEMGKVIRGDRSGVQRIRARDIVPGDIVEVAVGDKVPADIRITEIRSTTLRVDQSILTGESVSVIKHTDPIPDPRAVNQDKKNMLFSGTNIAAGKAVGIVIATGIYTEIGKIRNQMVATEPEKTPLQQKLDEFGQQLSKVISLICVAVWVINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFVIEKIEGVNCSFHEFSITGSTYAPVGQVLKDEQPVNCGQYDGLVELATICALCNDSSLDFNESKGVYEKVGEATETALTCLVEKMNVFNTDLSTLSKVERANACNSVIKKLMKKECTLEFSRDRKSMSVYCNSVAPNSGQSASKMFVKGAPESVIERCNYVRVGSTKLPLTPSAREKIMSKIRDWGTGMDTLRCLALATRDVPPKLEDMQLDDSTKFINYETNLTFVGCVGMLDPPRKEVSISIELCKRAGIKVIMITGDNKGTAVAICRKIGIFSDYEDITDKAYTGREFDDLPPERQREACRSARCFARVEPAHKSKIVEYLQSYSEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRNPREPLISGWLFFRYLAIGVYVGLATVGAATWWFLYDEDGPQVTFYQLRHFMKCTSDNPLFSGIDCDVFESRYPTTMALSVLVTIEMCNALNSLSENQSLLRMPPWLNIWLLGAIIMSMALHFLILYIKPMPLVFQVTPLNWSQWVVVLKISLPVILLDEGLKYISRHHLD 993          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: atp2a1 (ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 [Source:NCBI gene;Acc:613090])

HSP 1 Score: 1296.95 bits (3355), Expect = 0.000e+0
Identity = 682/994 (68.61%), Postives = 804/994 (80.89%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITT-QHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            MEA H +T  E L Y+ + E TGLS + +K+   K+G NELP E+ KS+  LV EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANAVVGVWQERNAE AIEALKEYE +  KV RS  + +Q+IKARE+VPGD+VE+++GDKVPADIR+ SI STT+R+DQSILTGES+SVIKHT+A+ D RAVNQDKKN+LFSGTN+ +GK  GVVIA G  TEIGKIR ++ ++E +KTPLQQKLDEFGEQLSKVIS+ICVAVW INIGHFNDP HGGSWI+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++FV+ +   G+I +   F ITGS YAPEGE+    K+VK   +  LVEL+ ICA+CNDS++DYNE+KG +EKVGEATETAL  LVEK+N +N     LSK + A   N  ++    K+FTLEFSRDRKSMS +  P  +     G +MFVKGAPEGVIDRC +VRV      +TP IK +IL  I  +GTGRDTLRCLALAT D P K EEM L D+TKFV+YET +T VG VGMLDPPR EV  SIK C +AGIRVI+ITGDNK TA AICRRIG+F E++     +FTGREFD+L P  Q +AC++A  FARVEP HKSKI+E+LQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDR PR   +PLIS WLFFRY+ IG YVG ATVG+AAWWFM+   GP++ +YQL+H  QC  +   F+ ++C IF  P PM+MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IF++TPL   +W  V+KISIPVI++DE +KF++R  ++
Sbjct:    1 MEAAHTKTTEECLAYFGVNENTGLSPEIVKKNFDKFGPNELPAEEGKSIWELVAEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAEDAIEALKEYEPEMGKVYRSDRKSVQRIKAREIVPGDIVEVAVGDKVPADIRLISIKSTTLRIDQSILTGESVSVIKHTEAVPDPRAVNQDKKNMLFSGTNVGAGKAIGVVIATGPNTEIGKIRDEMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPIHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVL-DKVDGDICSLNEFSITGSTYAPEGEVLKNDKSVKAGQYDGLVELATICALCNDSSLDYNESKGVFEKVGEATETALTTLVEKMNVFNTEVRSLSKVERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPAKASRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTPAIKDKILTVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDATKFVDYETDLTFVGCVGMLDPPRKEVMGSIKLCREAGIRVIMITGDNKGTAIAICRRIGIFGEDDDVSRCAFTGREFDDLPPTEQREACKRASCFARVEPTHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYLAIGGYVGAATVGAAAWWFMYADDGPEVTFYQLSHFMQCTEENADFEGLECEIFESPVPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWVNIWLLGSICLSMSLHFLILYVEPLPMIFKLTPLNFTQWFVVLKISIPVILLDELLKFVARNYLE 993          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 1296.57 bits (3354), Expect = 0.000e+0
Identity = 675/997 (67.70%), Postives = 813/997 (81.54%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPL 3155
            ME  H +TV EVL ++ + E TGLS + +K+ ++++G NELP E+ K+L  LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLIL+ANA+VGVWQERNAE+AIEALKEYE +  KV R   + +Q+IKAR++VPGD+VE+++GDKVPADIR+TSI STT+RVDQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTNIA+GK  GVV+A G+ TEIGKIR ++ ++E ++TPLQQKLDEFGEQLSKVIS+IC+AVW INIGHFNDP HGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++F++            F+ITGS YAP GE+  + K VK   +  LVEL+ ICA+CNDS++D+NE KG YEKVGEATETAL CLVEK+N ++    GLS+ + A   N  ++    K+FTLEFSRDRKSMS +  P +     +  +MFVKGAPEG+IDRCT +RV      +T  IK +I+  I  +GTGRDTLRCLALAT DNP + E+M+L DST F+NYET +T VG VGMLDPPR+EV  S+K C +AGIRVI+ITGDNK TA AICRR+G+F E+E    ++FTGREFDELSP  Q DAC  A+ FARVEP+HKSKI+E+LQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR+  +PLIS WLFFRY+ IG YVG ATVG+AAWWF+    GP++ +YQL+H  QC  +   FD ++C IF  P PM+MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL LI+W  V+KIS+PVI++DET+K+++R  ++ E L
Sbjct:    1 MENAHTKTVEEVLAHFNVNESTGLSLEQVKKQKERWGANELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEVAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDKVEGDNCFLNEFNITGSTYAPMGEVLKDDKLVKCHQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTP-NKPSRTSMSKMFVKGAPEGLIDRCTHIRVGSIKVPLTAGIKQKIMSVIREWGTGRDTLRCLALATHDNPPRKEDMNLEDSTNFINYETNLTFVGCVGMLDPPRTEVAASVKMCRQAGIRVIMITGDNKGTAVAICRRVGIFREDEDVSERAFTGREFDELSPAAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAAEDGPRITFYQLSHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARNYLEPEKL 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:MGI Symbol;Acc:MGI:88110])

HSP 1 Score: 1296.95 bits (3355), Expect = 0.000e+0
Identity = 679/999 (67.97%), Postives = 811/999 (81.18%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQ 3161
            ME  H +TV EVL ++ + E TGLS + +K+ ++++G NELP E+ K+LL LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLIL+ANA+VGVWQERNAE+AIEALKEYE +  KV R   + +Q+IKA+++VPGD+VEI++GDKVPADIR+TSI STT+RVDQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTNIA+GK  GVV+A G+ TEIGKIR ++ ++E ++TPLQQKLDEFGEQLSKVIS+IC+AVW INIGHFNDP HGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++F++        +   F ITGS YAP GE+  + K VK   +  LVEL+ ICA+CNDSA+DYNE KG YEKVGEATETAL CLVEK+N ++    GLSK + A   N  ++    K+FTLEFSRDRKSMS +  P +     +  +MFVKGAPEGVIDRCT +RV      MTP +K +I+  I  +G+G DTLRCLALAT DNP K EEM L DS  F+ YET +T VG VGMLDPPR EV  S+K C +AGIRVI+ITGDNK TA AICRRIG+F ++E    K+FTGREFDELSP  Q DAC  A+ FARVEP+HKSKI+E+LQS   I+AMTGDGVNDAPALKK+EIGIAMGSGTAVAK+AS+MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR+  +PLIS WLFFRY+ IG YVG ATVG+AAWWF+    GP++++YQL+H  QC      FD +DCAIF  P PM+MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL L +W  V+KIS+PVI++DET+KF++R  ++   +++
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDKVEGDTCSLNEFSITGSTYAPIGEVQKDDKPVKCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTP-NKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTPGVKQKIMSVIREWGSGSDTLRCLALATHDNPLKREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELSPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLEQPAILE 998          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:MGI Symbol;Acc:MGI:88110])

HSP 1 Score: 1294.26 bits (3348), Expect = 0.000e+0
Identity = 679/993 (68.38%), Postives = 807/993 (81.27%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H +TV EVL ++ + E TGLS + +K+ ++++G NELP E+ K+LL LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLIL+ANA+VGVWQERNAE+AIEALKEYE +  KV R   + +Q+IKA+++VPGD+VEI++GDKVPADIR+TSI STT+RVDQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTNIA+GK  GVV+A G+ TEIGKIR ++ ++E ++TPLQQKLDEFGEQLSKVIS+IC+AVW INIGHFNDP HGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++F++        +   F ITGS YAP GE+  + K VK   +  LVEL+ ICA+CNDSA+DYNE KG YEKVGEATETAL CLVEK+N ++    GLSK + A   N  ++    K+FTLEFSRDRKSMS +  P       +  +MFVKGAPEGVIDRCT +RV      MTP +K +I+  I  +G+G DTLRCLALAT DNP K EEM L DS  F+ YET +T VG VGMLDPPR EV  S+K C +AGIRVI+ITGDNK TA AICRRIG+F ++E    K+FTGREFDELSP  Q DAC  A+ FARVEP+HKSKI+E+LQS   I+AMTGDGVNDAPALKK+EIGIAMGSGTAVAK+AS+MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR+  +PLIS WLFFRY+ IG YVG ATVG+AAWWF+    GP++++YQL+H  QC      FD +DCAIF  P PM+MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL L +W  V+KIS+PVI++DET+KF++R  ++
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDKVEGDTCSLNEFSITGSTYAPIGEVQKDDKPVKCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKP-SRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTPGVKQKIMSVIREWGSGSDTLRCLALATHDNPLKREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELSPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:MGI Symbol;Acc:MGI:88110])

HSP 1 Score: 1294.26 bits (3348), Expect = 0.000e+0
Identity = 679/993 (68.38%), Postives = 807/993 (81.27%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H +TV EVL ++ + E TGLS + +K+ ++++G NELP E+ K+LL LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLIL+ANA+VGVWQERNAE+AIEALKEYE +  KV R   + +Q+IKA+++VPGD+VEI++GDKVPADIR+TSI STT+RVDQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTNIA+GK  GVV+A G+ TEIGKIR ++ ++E ++TPLQQKLDEFGEQLSKVIS+IC+AVW INIGHFNDP HGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++F++        +   F ITGS YAP GE+  + K VK   +  LVEL+ ICA+CNDSA+DYNE KG YEKVGEATETAL CLVEK+N ++    GLSK + A   N  ++    K+FTLEFSRDRKSMS +  P       +  +MFVKGAPEGVIDRCT +RV      MTP +K +I+  I  +G+G DTLRCLALAT DNP K EEM L DS  F+ YET +T VG VGMLDPPR EV  S+K C +AGIRVI+ITGDNK TA AICRRIG+F ++E    K+FTGREFDELSP  Q DAC  A+ FARVEP+HKSKI+E+LQS   I+AMTGDGVNDAPALKK+EIGIAMGSGTAVAK+AS+MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR+  +PLIS WLFFRY+ IG YVG ATVG+AAWWF+    GP++++YQL+H  QC      FD +DCAIF  P PM+MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL L +W  V+KIS+PVI++DET+KF++R  ++
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDKVEGDTCSLNEFSITGSTYAPIGEVQKDDKPVKCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKP-SRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTPGVKQKIMSVIREWGSGSDTLRCLALATHDNPLKREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELSPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a1 (ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 [Source:MGI Symbol;Acc:MGI:105058])

HSP 1 Score: 1290.79 bits (3339), Expect = 0.000e+0
Identity = 680/993 (68.48%), Postives = 795/993 (80.06%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            MEA H+++  E L Y+ ++E TGL+ D +K   +KYG NELP E+ KSL  LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANA+VGVWQERNAE+AIEALKEYE +  KV R+  + +Q+IKAR++VPGD+VE+++GDKVPADIRI SI STT+RVDQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTNIA+GK  G+V   G+ TEIGKIR Q+ ++E DKTPLQQKLDEFGEQLSKVIS+ICVAVW INIGHFNDP HGGSW RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V K+F++        +   F ITGS YAPEGE+    K V+   +  LVEL+ ICA+CNDS++D+NETKG YEKVGEATETAL  LVEK+N +N     LSK + A   N  ++    K+FTLEFSRDRKSMS +  P  S     G +MFVKGAPEGVIDRC +VRV      +T  +K +I+  I  +GTGRDTLRCLALAT D P K EEM L DS KF+ YE  +T VGVVGMLDPPR EV  SI+ C  AGIRVI+ITGDNK TA AICRRIG+F ENE    +++TGREFD+L    Q +ACR+A  FARVEP+HKSKI+EYLQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDR PR   +PLIS WLFFRYM IG YVG ATVG+AAWWF++   GP ++Y+QLTH  QC      FD +DC +F  P+PM+MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL VD L  IF++  L   +W  V+KIS+PVI +DE +KFI+R  ++
Sbjct:    1 MEAAHSKSTEECLSYFGVSETTGLTPDQVKRHLEKYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAVGIVATTGVSTEIGKIRDQMAATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIIDKVDGDVCSLNEFSITGSTYAPEGEVLKNDKPVRAGQYDGLVELATICALCNDSSLDFNETKGVYEKVGEATETALTTLVEKMNVFNTEVRSLSKVERANACNSVIRQLMKKEFTLEFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGPVKEKIMSVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSAKFMEYEMDLTFVGVVGMLDPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFSENEEVTDRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIGGYVGAATVGAAAWWFLYAEDGPHVSYHQLTHFMQCTEHNPEFDGLDCEVFEAPEPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDFTQWLMVLKISLPVIGLDELLKFIARNYLE 993          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a3 (ATPase, Ca++ transporting, ubiquitous [Source:MGI Symbol;Acc:MGI:1194503])

HSP 1 Score: 1275 bits (3298), Expect = 0.000e+0
Identity = 651/1006 (64.71%), Postives = 795/1006 (79.03%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGAYGVFL 3182
            ME  H  + A+VL+ + +T E GLS + + +AR++YG NELP E+ KSL  LV+EQF+DLLV+ILLLAA++SF+LA FE+ E+ T AFVEP VI+LIL+ANA+VGVWQERNAESAIEALKEYE +  KV RS  +G+Q+I+AR++VPGD+VE+++GDKVPAD+R+  I STT+RVDQSILTGES+SV KHTDAI D RAVNQDKKN+LFSGTNIASGK  GV +A GL+TE+GKIR+Q+ + E ++TPLQ+KLDEFG QLS  IS+ICVAVW INIGHF DPAHGGSW+RGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA+KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++FV+A +  G      F I+G+ Y PEGE+    + V+      LVEL+ ICA+CNDSA+DYNE KG YEKVGEATETAL CLVEK+N ++    GLS+ + A   N  ++    K+FTLEFSRDRKSMS +  P  +     G +MFVKGAPE VI+RC+ VRV   +  ++   +  IL  I  +G+G DTLRCLALAT D P + E+M L D ++FV YET +T VG VGMLDPPR EV   I +C +AGIRV++ITGDNK TA AICRR+G+F + E   GK++TGREFD+LSPE Q  ACR A+ FARVEPAHKS+I+E LQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVLSDDNF+SIV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR+  + LIS WLFFRY+ IG+YVG ATV +A WWF++ + GPQ+ +YQL +  +C     LF  +DC +F    P +MALSVLV IEM NA+NS+SENQSL  MPPW N WL+GA+ +S  LHF+IL V  L  IFQ+TPL+  +W  V+++S+PVI++DE +K++SR  MD      G  G F+
Sbjct:    1 MEEAHLLSAADVLRRFSVTAEGGLSLEQVTDARERYGPNELPTEEGKSLWELVVEQFEDLLVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALKEYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSILTGESVSVTKHTDAIPDPRAVNQDKKNMLFSGTNIASGKALGVAVATGLQTELGKIRSQMAAVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVAEAEAGTCRLHEFTISGTTYTPEGEVRQGEQPVRCGQFDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRVERAGACNSVIKQLMRKEFTLEFSRDRKSMSVYCTPTRADPKVQGSKMFVKGAPESVIERCSSVRVGSRTAPLSTTSREHILAKIRDWGSGSDTLRCLALATRDTPPRKEDMHLDDCSRFVQYETDLTFVGCVGMLDPPRPEVAACITRCSRAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVLGKAYTGREFDDLSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRNPREALISGWLFFRYLAIGVYVGLATVAAATWWFLYDTEGPQVTFYQLRNFLKCSEDNPLFAGIDCKVFESRFPTTMALSVLVTIEMCNALNSVSENQSLLRMPPWLNPWLLGAVVMSMALHFLILLVPPLPLIFQVTPLSGRQWGVVLQMSLPVILLDEALKYLSRNHMD------GVLGTFM 1000          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q7PPA5|ATC1_ANOGA (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae OX=7165 GN=SERCA PE=3 SV=5)

HSP 1 Score: 1397.1 bits (3615), Expect = 0.000e+0
Identity = 716/1008 (71.03%), Postives = 826/1008 (81.94%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGAYGVFLMW 3188
            ME  H++TV EVL ++++  E GLS D +KE +KKYG NELP E+ K+L  LVLEQFDDLLVKILLLAA+ISF+LALFE+ E    AFVEPFVILLILIANAVVGVWQERNAESAIEALKEYE +  KV R    G+QKI+A+E+VPGDVVE+S+GDK+PADIR+  I STTIR+DQSILTGES+SVIKHTDA+ D RAVNQDKKNILFSGTN+A+GK RGVVI  GL T IGKIRT++  +E  KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSWI+GA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS++F+       + +   F+I+GS Y P GE+   G+ +K +D++ L EL  IC MCNDSAID+NETK  +EKVGEATETALI L EKLNP+N+ K GL +   A+C    +++KW K+FTLEFSRDRKSMS++  P  +     G ++F KGAPEGV++RCT  RV      +T  +K  IL     YGTGRDTLRCLALAT D+P KP++MDL DSTKF  YE  +T VGVVGMLDPPR EV DSI +C  AGIRVIVITGDNKATAEAICRRIGVF E+E T GKS++GREFD+LS   Q +AC +A+LF+RVEPAHKSKI+E+LQS   ISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNFSSIV+AVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR A + LIS WLFFRYM IG YVGCATVG AAWWFMF   GPQL+Y+QLTH   CL   E F  +DC IF  P PM+MALSVLV IEMLNA+NSLSENQSL  MPPW N+WLI +MCLSF LHFVIL VD+LS +FQ+TPL   EW  VMK S+PV+++DE +KF++R+  D E  ++  +G+ L W
Sbjct:    1 MEDGHSKTVDEVLSHFRVDPERGLSLDQVKEYQKKYGPNELPAEEGKTLWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEGVE-AFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVIRGDKSGVQKIRAKEIVPGDVVEVSVGDKIPADIRLIKIYSTTIRIDQSILTGESVSVIKHTDAVPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLNTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISLICVAVWAINIGHFNDPAHGGSWIKGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFEKIEGNDSSFTEFEISGSTYEPIGEVTLNGQRIKAADYETLHELGTICIMCNDSAIDFNETKKVFEKVGEATETALIVLAEKLNPFNVAKQGLDRRSSAICVRQEIETKWKKEFTLEFSRDRKSMSSYCTPLKASKLGNGPKLFCKGAPEGVLERCTHARVGSTKVPLTQTLKQRILDLTRTYGTGRDTLRCLALATADSPMKPDDMDLNDSTKFYTYEVNLTFVGVVGMLDPPRKEVQDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFGEDEDTTGKSYSGREFDDLSVSEQREACSRARLFSRVEPAHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMTKPPRKADEGLISGWLFFRYMAIGGYVGCATVGGAAWWFMFSETGPQLSYWQLTHHLSCLGGGEEFKGIDCKIFNDPHPMTMALSVLVTIEMLNAMNSLSENQSLVQMPPWCNIWLIASMCLSFALHFVILYVDVLSTVFQVTPLDGNEWMTVMKFSLPVVLLDEILKFVARRISDGESYIKNMHGLVLAW 1007          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P22700|ATC1_DROME (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster OX=7227 GN=SERCA PE=1 SV=2)

HSP 1 Score: 1353.19 bits (3501), Expect = 0.000e+0
Identity = 713/1008 (70.73%), Postives = 824/1008 (81.75%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGAYGVFLMW 3188
            ME  H++TV + L ++    E GL+ D IK  +KKYG NELP E+ KS+  LVLEQFDDLLVKILLLAA+ISF+LALFE+ E+   AFVEP VILLILIANAVVGVWQERNAESAIEALKEYE +  KV R    GIQK++A+E+VPGD+VE+S+GDK+PADIRIT I STT+R+DQSILTGES+SVIKHTDAI D RAVNQDKKNILFSGTN+A+GK RGVVI  GL T IGKIRT++  +E  KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSWI+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS++F+       + +   F++TGS Y P GE++  G+ +K +D+  L ELS IC MCNDSAIDYNE K  +EKVGEATETALI L EKLN +++ K GL +   A+     +++KW K+FTLEFSRDRKSMS++  P  +    TG ++FVKGAPEGV++RCT  RV      +T  +K++IL     YGTGRDTLRCLALA  D+P KP+EMDL DSTKF  YE  +T VGVVGMLDPPR EV DSI +C  AGIRVIVITGDNKATAEAICRRIGVF E+E T GKS++GREFD+LSP  Q  A  +++LF+RVEP HKSKI+E+LQS   ISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR A + LIS WLFFRYM IG YVG ATVG+AAWWF+F   GP+L+Y+QLTH   CL   + F  +DC IF  P  M+MALSVLV IEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D E  +   +G+ LMW
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMW 1008          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q292Q0|ATC1_DROPS (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=SERCA PE=3 SV=2)

HSP 1 Score: 1335.09 bits (3454), Expect = 0.000e+0
Identity = 706/993 (71.10%), Postives = 812/993 (81.77%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H++TV + L ++    E GL+ D IK  + KYG NELP E+ KS+  LVLEQFDDLLVKILLLAA+ISF+LALFE+ E+   AFVEP VILLILIANAVVGVWQERNAESAIEALKEYE +  KV R    GIQK++A+E+VPGD+VE+S+GDK+PADIR+T I STTIR+DQSILTGES+SVIKHTDAI D RAVNQDKKNILFSGTN+A+GK RGVVI  GL T IGKIRT++  +E  KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSWI+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS++ +       + +   F++TGS Y P GE++  G+ VK SD++ L EL+ +C MCNDSAIDYNE K  +EKVGEATETALI L EKLN +++ K GL +   A+ +   +++KW K+FTLEFSRDRKSMS++  P  +    TG ++FVKGAPEGV+DRCT  RV      +T  +K++IL     YGTGRDTLRCLALA  D+P +PE+MDL DSTKF  YE  +T VGVVGMLDPPR EV D+I +C  AGIRVIVITGDNKATAEAICRRIGVF E E T GKS++GREFD+LS   Q  A  +++LF+RVEP HKSKI+EYLQ    ISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMD+ PR A + LIS WLFFRYM IG YVG ATVG+AAWWF+  S GP L Y+QLTH   CL   + F  +DC IF  PK M+MALSVLV IEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D
Sbjct:    1 MEDGHSKTVEQSLNFFGTDGERGLTLDQIKTNQAKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVIRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRLTHIYSTTIRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMLIFEKVEGNDSSFLEFELTGSTYEPIGELFLGGQRVKASDYEALQELATVCIMCNDSAIDYNEFKAAFEKVGEATETALIVLAEKLNAFSVNKSGLDRRSNAIAARGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLDRCTHARVGTSKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPIRPEDMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDAIVRCRAAGIRVIVITGDNKATAEAICRRIGVFTEEEDTTGKSYSGREFDDLSIAEQKAAVARSRLFSRVEPQHKSKIVEYLQGMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFIASSEGPGLTYWQLTHHLSCLGGGDEFKGVDCKIFSDPKAMTMALSVLVTIEMLNAMNSLSENQSLISMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIAD 993          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P35316|ATC_ARTSF (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana OX=6661 PE=2 SV=1)

HSP 1 Score: 1321.99 bits (3420), Expect = 0.000e+0
Identity = 705/1000 (70.50%), Postives = 824/1000 (82.40%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDAT---FAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFV---MANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDD 3146
            ME  H +   EV+ Y+ +  E GL+ + +K+ ++KYG NELP E+ KSLL+L+LEQFDDLLVKILLLAA+IS +LALFE+ +D      A+VEPFVILLILIANAVVGVWQE+NAESAIEALKEYE +  KV R+   GIQKIKAR+LVPGD+VEIS+GDK+PAD+R+ SILSTT+R+DQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTN+++GK RGVV+  GL T IG IRTQ+  +E  KTPLQQKLDEFGEQLSKVIS+ICVAVWAINIGHFNDPAHGGSWI+GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS++FV   + + A  E+    F++TGS Y P GE + +G+ +  +D+  + E++ IC MCNDSAID+NE K  +EKVGEATETALI L EKLNPYN+ K G  +   A+     + ++W K+FTLEFSRDRKSMS++ VP  +     G +MFVKGAPEGV+DRCT VRV  +   MTP I  +IL    AYGTGRDTLRCLALATID+P  P++MD+ DSTKFV YE   T VGVVGMLDPPR EV D+I++C  AGIRVIVITGDNKATAEAICRRIGVF E+E T G ++TGREFD+LS E Q DA  +++LFARVEP HKSKI+EYLQ  G ISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR A + LI+ WLFFRYM IG YVG ATVG+AA WFM    GP LN+YQL+H  QC  + E F+ +DC IF  P PM+MALSVLV IEMLNA+NSLSENQSL VMPPW+N+WLI A+CLS  LHFVIL V+ILS +FQI PLTL EW  V+KIS PV+++DE +KF++RK  D+
Sbjct:    1 MEDAHAKKWEEVVDYFGVDPERGLALEQVKKNQEKYGPNELPAEEGKSLLTLILEQFDDLLVKILLLAAIISLVLALFEEHDDEAEQLTAYVEPFVILLILIANAVVGVWQEKNAESAIEALKEYEPEMGKVIRADKTGIQKIKARDLVPGDIVEISVGDKIPADLRLISILSTTLRIDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNVSAGKARGVVMGTGLNTAIGSIRTQMFETEEMKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFVFKDIPDDAAPEL--YQFELTGSTYEPIGETFMQGQKINAADYDAVKEITTICMMCNDSAIDFNEYKQAFEKVGEATETALIVLGEKLNPYNLSKAGKDRRSAALVVREDMDTRWKKEFTLEFSRDRKSMSSYCVPLKAGLLSNGPKMFVKGAPEGVLDRCTHVRVGTKKVPMTPAIMDKILEVTRAYGTGRDTLRCLALATIDDPMDPKDMDIIDSTKFVKYEQNCTFVGVVGMLDPPRKEVLDAIERCRAAGIRVIVITGDNKATAEAICRRIGVFGEDENTEGMAYTGREFDDLSVEGQRDAVARSRLFARVEPFHKSKIVEYLQGMGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRRADEGLITGWLFFRYMAIGTYVGAATVGAAAHWFMMSPTGPGLNFYQLSHHLQCTPENEYFEGIDCEIFSDPHPMTMALSVLVTIEMLNAINSLSENQSLLVMPPWSNIWLISAICLSMTLHFVILYVEILSTVFQICPLTLTEWIVVLKISFPVLLLDEVLKFVARKYTDE 998          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q9YGL9|AT2A3_CHICK (Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Gallus gallus OX=9031 GN=ATP2A3 PE=2 SV=1)

HSP 1 Score: 1308.12 bits (3384), Expect = 0.000e+0
Identity = 660/993 (66.47%), Postives = 791/993 (79.66%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            MEA H+  V +VL  + + E  GLS + ++  R+KYG NELP E+ KSL  LVLEQF+DLLV+ILL+AA +SFILA FE+ E++T AFVEP VI++ILIANAVVGVWQERNAESAIEALKEYE +  KV R+   G+Q+I+AR++VPGD+VE+++GDKVPADIRI  I STT+RVDQSILTGESMSVIKH D I D RAVNQDKKN+LFSGTNIA+GK  G+VIA G+ TEIGKIR Q+  +E +KTPLQQKLDEF +QLSKVI ++C+AVW INI HF+DP HGGSW RGAIYYFK +VALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++F+M      + +   F ITGS YAPEG+I  + K V+   +  LVEL+ ICA+CNDS++DYNE+K  YEKVGEATETAL CLVEK+N ++     LSK + A   N  ++    K+ TLEFSRDRKSMS +  P        G +MFVKGAPE VI+RCT VRV      +TP ++ +IL  I  +G G DTLRCLALAT D P + E M L DST F +YET +T VG VGMLDPPR EV  SI+ C KAGIRVI+ITGDNK TA AICRRIG+F E+E   GK++TGREFDELSPE Q  ACR+A+ FARVEPAHKS+I+EYLQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVLSDDNFS+IVSAVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMD+ PR+  +PLIS WLFFRY+ IG+YVG ATVG+A WWF++ + GPQ++++QL +  +C     +F+ ++C IF    P +MALSVLV IEM NA+NS+SENQSL  MPPW N+WL+GA+ +S  LHF IL V  +  IFQ+TPL+  +W  V+KIS+PVI++DE +K++SR  ++
Sbjct:    1 MEAAHSVPVQDVLSRFGVAESCGLSPEQVRRNREKYGPNELPAEERKSLWELVLEQFEDLLVRILLMAAFLSFILAWFEEGEESTTAFVEPIVIIMILIANAVVGVWQERNAESAIEALKEYEPEMGKVIRADRSGVQRIRARDIVPGDIVEVAVGDKVPADIRIIEIRSTTLRVDQSILTGESMSVIKHADPIPDPRAVNQDKKNMLFSGTNIAAGKAVGIVIATGVYTEIGKIRNQMVETEPEKTPLQQKLDEFSQQLSKVIFLVCIAVWVINISHFSDPVHGGSWFRGAIYYFKTSVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIMEKVEGTQCSLHEFSITGSTYAPEGQILKDEKPVRCGQYDGLVELATICALCNDSSLDYNESKKVYEKVGEATETALTCLVEKMNVFDTDTSKLSKVERANACNSVIKHLMRKECTLEFSRDRKSMSVYCTPTGPGHNSAGSKMFVKGAPESVIERCTHVRVGTAKVPLTPPVREKILSQIRDWGMGTDTLRCLALATHDAPVQRETMQLHDSTTFTHYETNLTFVGCVGMLDPPRKEVTSSIEMCRKAGIRVIMITGDNKGTAVAICRRIGIFTESEDVAGKAYTGREFDELSPEAQRQACREARCFARVEPAHKSRIVEYLQSFNEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFSTIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKLPRNPKEPLISGWLFFRYLAIGVYVGLATVGAATWWFLYDAEGPQVSFHQLRNFMRCTEDNPIFEGVNCEIFESRYPTTMALSVLVTIEMCNALNSVSENQSLLRMPPWLNIWLLGAIVMSMALHFFILYVKPMPLIFQVTPLSWPQWVVVLKISLPVILLDEGLKYLSRNHLE 993          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: H2KSK6 (Calcium-transporting ATPase OS=Clonorchis sinensis OX=79923 GN=CLF_109631 PE=3 SV=1)

HSP 1 Score: 1478.77 bits (3827), Expect = 0.000e+0
Identity = 749/1006 (74.45%), Postives = 868/1006 (86.28%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDS-------IDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQ 3161
            ME   ++ + EVL ++ + EETGLS+D +K++  KYG NELP E++K+L  LVLEQFDDLLVKILLLAA+ISF+LALFE++E+   AFVEPFVILLILIANAV+GVWQERNAESAIEALKEYE + AKV R +H GIQ+IKARELVPGD+VE+S+GDKVPAD+RIT I+STT+RVDQSILTGES+SVIK T+A+ D RAVNQDKKN+LFSGTNIA+GK RGVV+  GL TEIGKIR Q+  +E DKTPLQQKLDEFG+QLSKVISIICVAVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++F+ + +        HF+ITGSKYAPEGE++  G+ V++ ++  L+E++NICAMCNDSAIDYNE+K  YEKVGEATETAL CLVEK+N Y   K GLSK DL+M  N+ +Q+ W+K+FTLEFSRDRKSMS +L+P+ +           TG RMFVKGAPEGV+DRC+FVRV G+   MTP +K+EI++H++AYGTGRDTLRCLALAT D+P    +M+L DS+KFVNYE  +T VGVVGMLDPPR EV DS+ KC K+GIRVI+ITGDNKATAEAICRRIG+F E+E T GKSFTGREFD L  E Q +ACR+A+LFARVEPAHKSKI+E+LQ DG +SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+DMVL+DDNF SIV AVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+R PR+  DPLIS WLFFRY+ +G YVGCATVG+AAWWF  Y +GPQLNYYQLTHQ+QCLAQE  F+ +DCAIF HPKPM+MALSVLV+IEMLNA+NSLSENQSL VMPPW NLWL+ AM LS  LHF+ILEVD LSK+FQITPLTL EW  V+KIS+PV++IDET+K I+RK   D P+M+
Sbjct:    1 MENAFSKEIKEVLGHFDVDEETGLSDDQVKKSGAKYGPNELPAEEAKALWELVLEQFDDLLVKILLLAAIISFVLALFEESEETISAFVEPFVILLILIANAVIGVWQERNAESAIEALKEYEPEIAKVFRKNHHGIQRIKARELVPGDIVEVSVGDKVPADMRITKIMSTTLRVDQSILTGESVSVIKFTEAVPDPRAVNQDKKNMLFSGTNIAAGKARGVVVCTGLMTEIGKIRNQMMDTEQDKTPLQQKLDEFGQQLSKVISIICVAVWAINIGHFNDPAHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAAKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIFSKTDDRAPEVHHFEITGSKYAPEGEVFLNGQRVESGEYDGLIEIANICAMCNDSAIDYNESKHVYEKVGEATETALCCLVEKMNVYKTSKSGLSKKDLSMVCNHQIQNLWTKEFTLEFSRDRKSMSVYLLPKPNSAAKIPNTGSETGPRMFVKGAPEGVLDRCSFVRVEGKKVPMTPALKAEIVKHVAAYGTGRDTLRCLALATSDSPPAKGQMNLEDSSKFVNYEQNLTFVGVVGMLDPPRMEVLDSVIKCRKSGIRVIMITGDNKATAEAICRRIGIFGEDEPTSGKSFTGREFDALPIEEQREACRRARLFARVEPAHKSKIVEFLQEDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAADMVLADDNFRSIVLAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNRPPRNIKDPLISGWLFFRYLAVGGYVGCATVGAAAWWFTLYPKGPQLNYYQLTHQSQCLAQESRFEGIDCAIFTHPKPMTMALSVLVLIEMLNAMNSLSENQSLLVMPPWVNLWLMLAMVLSMSLHFLILEVDFLSKVFQITPLTLEEWFMVIKISLPVLLIDETLKLIARK-FTDVPVMR 1005          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A4S2L1X3 (Calcium-transporting ATPase OS=Opisthorchis felineus OX=147828 GN=CRM22_010137 PE=3 SV=1)

HSP 1 Score: 1475.69 bits (3819), Expect = 0.000e+0
Identity = 747/1000 (74.70%), Postives = 863/1000 (86.30%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDS-------IDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME   ++ + EVL ++ + EETGLS+D +K++  KYG NELP E++K+L  LVLEQFDDLLVKILLLAA+ISF+LALFE++E+   AFVEPFVILLILIANAV+GVWQERNAESAIEALKEYE + AKV R +H GIQ+IKARELVPGD+VE+S+GDKVPAD+RIT I+STT+RVDQSILTGES+SVIK T+A+ D RAVNQDKKN+LFSGTNIA+GK RGVV+  GL TEIGKIR Q+  +E DKTPLQQKLDEFG+QLSKVISIICVAVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++FV + +        HF+ITGSKYAPEGE++  G+ V++ ++  L+E++NICAMCNDSAIDYN++K  YEKVGEATETAL CLVEK+N Y   K GLSK DL+M  N+ +Q+ W+K+FTLEFSRDRKSMS +L+P+ +           TG RMFVKGAPEGV+DRC+FVRV G+   MTP +K+EI++H++AYGTGRDTLRCLALAT D+P    +M+L DS+KFVNYE  +T VGVVGMLDPPR EV DSI KC K+GIRVI+ITGDNKATAEAICRRIG+F E+E T GKSFTGREFD L  E Q +ACR+A+LFARVEPAHKSKI+E+LQ DG +SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+DMVL+DDNF SIV AVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+R PR+  DPLIS WLFFRY+ +G YVGCATVG+AAWWF  Y +GPQLNYYQLTHQ+QCLAQE  F+ +DCAIF HPKPM+MALSVLV+IEMLNA+NSLSENQSL VMPPW N WL+ AM LS  LHF+ILEVD LSK+FQITPLTL EW  V+KIS+PV++IDET+K I+RK  D
Sbjct:    1 MENAFSKEITEVLAHFDVDEETGLSDDQVKKSEAKYGPNELPAEEAKALWELVLEQFDDLLVKILLLAAIISFVLALFEESEETISAFVEPFVILLILIANAVIGVWQERNAESAIEALKEYEPEIAKVFRKNHHGIQRIKARELVPGDIVEVSVGDKVPADMRITKIMSTTLRVDQSILTGESVSVIKFTEAVPDPRAVNQDKKNMLFSGTNIAAGKARGVVVCTGLMTEIGKIRNQMMDTEQDKTPLQQKLDEFGQQLSKVISIICVAVWAINIGHFNDPAHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAAKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVFSKTDDRAPEVHHFEITGSKYAPEGEVFLNGQRVESGEYDGLIEIANICAMCNDSAIDYNDSKHVYEKVGEATETALCCLVEKMNVYKTSKSGLSKKDLSMVCNHQIQNLWTKEFTLEFSRDRKSMSVYLLPKPNSAAKIPNTGSETGPRMFVKGAPEGVLDRCSFVRVEGKKVPMTPALKAEIVKHVAAYGTGRDTLRCLALATSDSPPAKGQMNLEDSSKFVNYEQNLTFVGVVGMLDPPRMEVLDSIIKCRKSGIRVIMITGDNKATAEAICRRIGIFGEDEPTSGKSFTGREFDALPIEEQREACRRARLFARVEPAHKSKIVEFLQEDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAADMVLADDNFRSIVLAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNRPPRNIKDPLISGWLFFRYLAVGGYVGCATVGAAAWWFTLYPKGPQLNYYQLTHQSQCLAQESRFEGIDCAIFTHPKPMTMALSVLVLIEMLNAMNSLSENQSLCVMPPWVNPWLMLAMVLSMSLHFLILEVDFLSKVFQITPLTLEEWFMVIKISLPVLLIDETLKLIARKFTD 1000          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A5K3FDE6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 1475.3 bits (3818), Expect = 0.000e+0
Identity = 749/1004 (74.60%), Postives = 857/1004 (85.36%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPR-DSIDGHT----------GQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H R   +VL Y+ + EETGLS++ +K   +KYG NELP E++KSL  LV+EQFDDLLVKILLLAA+ISF+LALFE+ ED+  AFVEPFVILLIL+ANA+VGVWQERNAESAIEALKEYE + AKV R SHRGIQ+IKA  LVPGD+VE+SIGDKVPADIRIT I STT+RVDQSILTGES+SV+K T+ + D RAVNQDKKN+LFSGTNIA+GKCRGVV+  GL TEIGKIR Q+ ++E DKTPLQQKLDEFG+QLSKVISIIC+AVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTV + F+ +++    I T  F+ITGSKYAPEGE++  G+ V   +++ LVEL+NICAMCNDSA+DYNE+KG YEKVGEATETAL   VEK+N Y I K GL+K +L M  N+++Q+ W+K FTLEFSRDRKSMS F+ P+ ++ + H           G RMFVKGAPEGVIDRCTF RV  +   MTP IK+EI+++++AYGTGRDTLRCLALAT D P   E+MDL DSTKF  YE+ +T VGVVGMLDPPRSEVHDSI KC  AGIRVIVITGDNKATAEAICRRIGVF E+E T GKSFTGREFD+L  E Q +A R+A+LFARVEPAHKSKI+E+LQ+DG +SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFS+IV+AVEEGRAIY+NMKQFIRYLISSN+GEVVSIFLTAALG+PEALIPVQLLWVNLVTDG PATALGFNPPDLDIM R PR  SDPLIS WLFFRY+ IG YVGCATVGSAAWWF+ Y +GPQLNYYQLTHQ+QCLAQE  F  +DC+IF HPKPM+MALSVLVV+EMLNA+NSLSENQSL VMPPWTN WL+GAM +S GLHF+ILEVD L+ +FQ+TPL+  EW  V++ S+PVI IDE +K I+RK  D
Sbjct:    1 MENAHCRKAEDVLAYFNVDEETGLSDEQVKRNSEKYGLNELPAEETKSLWELVIEQFDDLLVKILLLAALISFVLALFEEDEDSITAFVEPFVILLILVANAIVGVWQERNAESAIEALKEYEPEIAKVFRKSHRGIQRIKAVNLVPGDIVEVSIGDKVPADIRITKIFSTTMRVDQSILTGESVSVLKMTEEVPDPRAVNQDKKNMLFSGTNIAAGKCRGVVVGTGLSTEIGKIRNQMMATEQDKTPLQQKLDEFGQQLSKVISIICIAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAAKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVCRAFIFSHADENNIATHQFEITGSKYAPEGEVFLGGQRVNCGEYEGLVELANICAMCNDSAVDYNESKGLYEKVGEATETALCVFVEKMNVYGISKSGLTKKELGMVCNHNIQAMWNKLFTLEFSRDRKSMSVFVTPKTNTTNPHPVGGVSTPTGPGARMFVKGAPEGVIDRCTFARVGSKKVAMTPQIKAEIVKYVAAYGTGRDTLRCLALATCDAPIPKEQMDLEDSTKFRKYESNLTFVGVVGMLDPPRSEVHDSIVKCRHAGIRVIVITGDNKATAEAICRRIGVFSEDEPTTGKSFTGREFDDLPLEEQREAVRRARLFARVEPAHKSKIVEFLQADGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYSNMKQFIRYLISSNVGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGFPATALGFNPPDLDIMTRPPRSTSDPLISGWLFFRYLTIGGYVGCATVGSAAWWFLIYDKGPQLNYYQLTHQSQCLAQESRFKGIDCSIFAHPKPMTMALSVLVVVEMLNAMNSLSENQSLLVMPPWTNYWLLGAMIMSIGLHFIILEVDFLANVFQLTPLSFEEWIVVIEFSLPVIFIDEILKLIARKFTD 1004          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: C1LE79 (Calcium-transporting ATPase OS=Schistosoma japonicum OX=6182 GN=Ca-P60A PE=2 SV=1)

HSP 1 Score: 1469.91 bits (3804), Expect = 0.000e+0
Identity = 743/1002 (74.15%), Postives = 853/1002 (85.13%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFL---------VPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME   ++TV EVL Y+    ETG+S+D +K+   K+G NELP E++K++  LVLEQFDDLLVKILLLAA+ISF+LALFE+ E++  AFVEP VILLILIANAV+GVWQERNAESAIEALKEYE + AKV R SH GIQ+IKARELVPGD+VE+S+GDKVPAD+RI  I+STT+RVDQSILTGES+SVIK TDA+ D RAVNQDKKNILFSGTNIA+GK +G+V++ GL TEIGKIR Q+  +E D+TPLQQKLDEFG+QLSKVISIIC+AVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++F  A +        HF+ITGSKYAPEGE++  G+ V +S++  L+E++NICAMCNDSAIDYNETK  YEKVGEATETAL CLVEK+N Y   K GLSK DL+M  N+ +Q+ W+K FTLEFSRDRKSMS ++         VP  +  G T  RMFVKGAPEGV+DRCTFVRV  +   MTP +KSEI++H+++YGTGRDTLRCLALAT D P    +MDL DSTKFV YE  +T VGVVGMLDPPR EV DSI +C K+GIRVI+ITGDNKATAEAICRRIG+F E+E T GKSFTGREFD L  E Q +ACR+A+LFARVEP HKSKI+E+LQ DG +SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+DMVL+DDNF+SIV AVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDR PR+  DPLIS WLFFRY+ IG+YVGCATVG+AAWWF  YS+GPQLNYYQLTHQ+QCLAQE  F+ +DC+IF HPKPM+MALSVLV+IEMLNA+NSLSENQSL  MPPW N+WLI AM +S  LHF+ILEV+ LSK+FQITPL+L EW  V+KIS PVI IDE +K I+R+  D
Sbjct:    1 METAFSKTVDEVLNYFDSDPETGMSDDQVKKQTAKFGPNELPAEEAKAIWQLVLEQFDDLLVKILLLAAIISFVLALFEENEESISAFVEPLVILLILIANAVIGVWQERNAESAIEALKEYEPEIAKVFRKSHYGIQRIKARELVPGDIVEVSVGDKVPADLRIIKIMSTTLRVDQSILTGESVSVIKFTDAVPDPRAVNQDKKNILFSGTNIAAGKAKGIVVSTGLMTEIGKIRNQMMDTEQDRTPLQQKLDEFGQQLSKVISIICIAVWAINIGHFNDPAHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAAKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFTFAKADDKAPEVYHFEITGSKYAPEGEVFLSGQKVDSSEYDGLIEIANICAMCNDSAIDYNETKNVYEKVGEATETALCCLVEKMNVYKTSKSGLSKKDLSMVCNHQIQAMWNKDFTLEFSRDRKSMSVYVQAKPAYASKVPNTAGSGETAPRMFVKGAPEGVLDRCTFVRVGNKKVPMTPPLKSEIVKHVASYGTGRDTLRCLALATCDAPVNKAQMDLEDSTKFVKYEQNLTFVGVVGMLDPPRMEVFDSIARCRKSGIRVIMITGDNKATAEAICRRIGIFGEDEPTTGKSFTGREFDSLPIEEQREACRRARLFARVEPMHKSKIVEFLQEDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAADMVLADDNFNSIVLAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRNIKDPLISGWLFFRYVAIGVYVGCATVGAAAWWFSLYSKGPQLNYYQLTHQSQCLAQESRFEGVDCSIFSHPKPMTMALSVLVLIEMLNAMNSLSENQSLIAMPPWVNMWLILAMVVSMSLHFLILEVEFLSKVFQITPLSLEEWFMVVKISAPVIFIDEILKLIARRFTD 1002          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A3Q0KMK3 (Calcium-transporting ATPase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 1466.06 bits (3794), Expect = 0.000e+0
Identity = 741/1002 (73.95%), Postives = 855/1002 (85.33%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFL---------VPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME   ++TV EVL +++   E GLS++ IK+   K+G NELP E+SK++  LVLEQFDDLLVKILL+AA+ISF+LALFE+ E++  AFVEP VILLILIANAV+GVWQERNAESAIEALKEYE + AKV R SH GIQ+IKARELVPGD+VE+S+GDKVPAD+RI  I+STT+RVDQSILTGES+SVIK TDA+ D RAVNQDKKNILFSGTNIA+GK RG+V++ GL TEIGKIR Q+  +E DKTPLQQKLDEFG+QLSKVISIICVAVWAINIGHFNDPAHGGSW++GAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMA KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++F+ + +        HF+ITGSKYAPEGE++  G+ V++ ++  LVE++NICAMCNDSAIDYNETK  YEKVGEATETAL CLVEK+N Y   K GLSK DL+M  N+ +Q+ W+K+FTLEFSRDRKSMS +L         VP  +  G TG RMFVKGAPEGV+DRCTFVR+  +   MTP +K+EI++H+++YGTGRDTLRCLALAT D P    +MDL DSTKFV YE  +T VGVVGMLDPPR EV DSI +C K+GIRVI+ITGDNKATAEAICRRIG+F E+E T GKSFTGREFD L  E Q +ACR+A+LFARVEP HKSKI+E+LQ DG +SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+DMVL+DDNF+SIV AVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+R PR+  DPLIS WLFFRY+ IG+YVGCATVG+AAWWF  Y +GPQLNYYQLTHQ+QCLAQE  F+ +DC+IF HPKPM+MALSVLV+IEMLNA+NSLSENQSL  MPPW N+WL+ AM +S  LHF+ILEV+ LSK+FQITPL+L EW  V+KIS PVI IDE +K I+R+  D
Sbjct:    1 METAFSKTVDEVLHHFESDPENGLSDEQIKKQTAKFGPNELPAEESKAIWQLVLEQFDDLLVKILLMAAIISFVLALFEENEESISAFVEPLVILLILIANAVIGVWQERNAESAIEALKEYEPEIAKVFRKSHYGIQRIKARELVPGDIVEVSVGDKVPADMRIIKIMSTTLRVDQSILTGESVSVIKFTDAVPDPRAVNQDKKNILFSGTNIAAGKARGIVVSTGLMTEIGKIRNQMMDTEPDKTPLQQKLDEFGQQLSKVISIICVAVWAINIGHFNDPAHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAAKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIFSKADDKAPEVHHFEITGSKYAPEGEVFLNGQKVESGEYDGLVEVANICAMCNDSAIDYNETKHVYEKVGEATETALCCLVEKMNVYKTSKSGLSKKDLSMVCNHQIQAMWNKEFTLEFSRDRKSMSVYLQVKPAFASKVPNTAGSGETGPRMFVKGAPEGVLDRCTFVRIGNKKVPMTPPLKAEIVKHVASYGTGRDTLRCLALATCDAPVNKAQMDLEDSTKFVKYEQNLTFVGVVGMLDPPRMEVFDSIARCRKSGIRVIMITGDNKATAEAICRRIGIFSEDEPTTGKSFTGREFDALPIEEQREACRRARLFARVEPMHKSKIVEFLQEDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAADMVLADDNFNSIVLAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRNIKDPLISGWLFFRYVAIGVYVGCATVGAAAWWFSLYPKGPQLNYYQLTHQSQCLAQESRFEGVDCSIFSHPKPMTMALSVLVLIEMLNAMNSLSENQSLVAMPPWVNIWLVLAMIVSMSLHFLILEVEFLSKVFQITPLSLEEWFMVIKISAPVIFIDEILKLIARRFTD 1002          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a1 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1-like [Source:NCBI gene;Acc:103045170])

HSP 1 Score: 1301.96 bits (3368), Expect = 0.000e+0
Identity = 680/1004 (67.73%), Postives = 804/1004 (80.08%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD--DEPLMQGAY 3170
            ME  H +  AE L Y+ + E TGLS +  K+   K+GYNELP E+ K++  LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANAVVGVWQERNAESAIEALKEYE +  KV R+  + +Q+IKARE+VPGD+VE+S+GDKVPADIRITSI STT+RVDQSILTGES+SVIKHT+++ D RAVNQDKKN+LFSGTNIA+GK  GV +A G+ TEIGKIR Q+ ++E +KTPLQQKLDEFGEQLSKVIS+ICVAVW INIGHFNDP HGGSWIRGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V+K+F++       ++   +DI+GSKY PEGE+   G  VK      L+EL+ ICA+CNDS++DYNE+KG YEKVGEATETAL CLVEK+N +N    GLSK + A      ++    K+FTLEFSRDRKSMS +  P        G +MFVKGAPEGVIDRC +VRV      +T  +K +I+  I  +GTGRDTLRCLALAT D+  + EEM+L DSTKF +YET +T VG VGMLDPPR EV  SI+ C  AGIRVI+ITGDNK TA AICRRIG+F E+E   G++FTGREFD+L    Q DA RKA  +ARVEP+HKSKI+E+LQ    I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSSIV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR   +PLIS WLFFRY+ IG YVG ATV +AAWWF++   GP +++YQL+H  QC A+ E F+ ++C +F    PM+MALSVLV IEM NA+NSLSENQSL  MPPW+NLWL+ AM LS  LHF+I+ VD L  IF++T LTL +W  V+K+S PVI+IDE +KF++R  ++  DE L+   +
Sbjct:    1 MENAHTQESAECLAYFSVNEGTGLSPEQFKKNLTKFGYNELPAEEGKTIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRADRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVAVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWMINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIIDKVEGDSVSLDQYDISGSKYTPEGEVTKRGLPVKCGQLDGLIELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTEVRGLSKVERANACCSVIKQLMKKEFTLEFSRDRKSMSVYCSPGKPSKAPMGNKMFVKGAPEGVIDRCAYVRVGTNRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDSLLRKEEMNLEDSTKFADYETDLTFVGCVGMLDPPRKEVMGSIQLCRAAGIRVIMITGDNKGTAVAICRRIGIFGEDEDVTGRAFTGREFDDLPLTQQRDAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGSYVGAATVAAAAWWFIYSDDGPMVSFYQLSHFMQCSAENEDFEGIECEVFESAPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNLWLVAAMSLSMSLHFMIIYVDPLPMIFKLTHLTLEQWLVVLKLSFPVILIDELLKFVARNYLEQKDENLVSKKW 1004          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a1 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1-like [Source:NCBI gene;Acc:103045170])

HSP 1 Score: 1300.42 bits (3364), Expect = 0.000e+0
Identity = 677/993 (68.18%), Postives = 799/993 (80.46%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H +  AE L Y+ + E TGLS +  K+   K+GYNELP E+ K++  LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANAVVGVWQERNAESAIEALKEYE +  KV R+  + +Q+IKARE+VPGD+VE+S+GDKVPADIRITSI STT+RVDQSILTGES+SVIKHT+++ D RAVNQDKKN+LFSGTNIA+GK  GV +A G+ TEIGKIR Q+ ++E +KTPLQQKLDEFGEQLSKVIS+ICVAVW INIGHFNDP HGGSWIRGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V+K+F++       ++   +DI+GSKY PEGE+   G  VK      L+EL+ ICA+CNDS++DYNE+KG YEKVGEATETAL CLVEK+N +N    GLSK + A      ++    K+FTLEFSRDRKSMS +  P        G +MFVKGAPEGVIDRC +VRV      +T  +K +I+  I  +GTGRDTLRCLALAT D+  + EEM+L DSTKF +YET +T VG VGMLDPPR EV  SI+ C  AGIRVI+ITGDNK TA AICRRIG+F E+E   G++FTGREFD+L    Q DA RKA  +ARVEP+HKSKI+E+LQ    I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSSIV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR   +PLIS WLFFRY+ IG YVG ATV +AAWWF++   GP +++YQL+H  QC A+ E F+ ++C +F    PM+MALSVLV IEM NA+NSLSENQSL  MPPW+NLWL+ AM LS  LHF+I+ VD L  IF++T LTL +W  V+K+S PVI+IDE +KF++R  ++
Sbjct:    1 MENAHTQESAECLAYFSVNEGTGLSPEQFKKNLTKFGYNELPAEEGKTIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRADRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVAVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWMINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIIDKVEGDSVSLDQYDISGSKYTPEGEVTKRGLPVKCGQLDGLIELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTEVRGLSKVERANACCSVIKQLMKKEFTLEFSRDRKSMSVYCSPGKPSKAPMGNKMFVKGAPEGVIDRCAYVRVGTNRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDSLLRKEEMNLEDSTKFADYETDLTFVGCVGMLDPPRKEVMGSIQLCRAAGIRVIMITGDNKGTAVAICRRIGIFGEDEDVTGRAFTGREFDDLPLTQQRDAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGSYVGAATVAAAAWWFIYSDDGPMVSFYQLSHFMQCSAENEDFEGIECEVFESAPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNLWLVAAMSLSMSLHFMIIYVDPLPMIFKLTHLTLEQWLVVLKLSFPVILIDELLKFVARNYLE 993          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a3 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:103024029])

HSP 1 Score: 1297.34 bits (3356), Expect = 0.000e+0
Identity = 664/995 (66.73%), Postives = 801/995 (80.50%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDE 3149
            ME  H ++ +EVL+ + + E TGL+ + +K  +++YG NELP E+ KSL  LV+EQF+DLLV+ILLLAA +SF+LALFE+ E++T AFVEP VILLILIANAV+GVWQERNAE+AIEALKEYE +  KV R + + +Q+IKARE+VPGD+VE+++GDKVPADIRI SI STT+RVDQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTNIA+G+  GVV+  G+ TEIGKIR Q+  +E +KTPLQQKLDEFG+QLSKVIS+ICVAVW INIGHF DP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++FV+  + +   +   F+ITGS YAPEG++    K V+  D   L+EL+ IC+MCNDS++DYNE KG YEKVGEATETAL  LVEK+N +     GLSK + A   N  ++    K+FTLEFSRDRKSMS +  P  S    +  +MFVKGAPE VIDRCT VR+     ++T   K E++  I  +GTG+DTLRCLALAT D P + ++MDL ++TKF  YE+ +T VG VGMLDPPR EV  S+K C +AGIRVI+ITGDNK TA AICRRIG+F E+E   GK++TGREFD+L+PE Q +A ++A+ FARVEPAHKSKI+ YLQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLSDDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMD+ PR+  +PLIS WLFFRY+ IG YVG  TVG+A WW++F  +GPQ+++ QL H  QC     +F  +DC +F    P +MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+GA+ LS  LHF+IL V+ L  IFQ+TPL   +W  V+KISIPVI++DE +K++SR  ++ E
Sbjct:    1 MENAHTKSASEVLRNFDVNENTGLTLEQVKTNQERYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPLVILLILIANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRKAVQRIKAREIVPGDIVEVAVGDKVPADIRIVSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGRAIGVVVCTGVSTEIGKIRNQMACTEQEKTPLQQKLDEFGQQLSKVISLICVAVWVINIGHFGDPVHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVDKADSSSCSLHEFNITGSTYAPEGQVLKGVKPVQCGDFDGLLELATICSMCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVERAGACNSVIRQLMKKEFTLEFSRDRKSMSVYCTPTKS---GSQSKMFVKGAPESVIDRCTHVRIGSGKAELTIAAKEELMSTIRDWGTGKDTLRCLALATRDTPPRKQDMDLENATKFAAYESDLTFVGCVGMLDPPRKEVIGSVKLCSEAGIRVIMITGDNKGTAVAICRRIGIFTEHEDVEGKAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVGYLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVGAATWWYLFDEQGPQVSFNQLRHFMQCTEDNPMFKGIDCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILYVEPLPLIFQVTPLHCSQWIVVLKISIPVILLDEALKYVSRHHLEGE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a3 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:103024029])

HSP 1 Score: 1296.18 bits (3353), Expect = 0.000e+0
Identity = 663/993 (66.77%), Postives = 800/993 (80.56%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H ++ +EVL+ + + E TGL+ + +K  +++YG NELP E+ KSL  LV+EQF+DLLV+ILLLAA +SF+LALFE+ E++T AFVEP VILLILIANAV+GVWQERNAE+AIEALKEYE +  KV R + + +Q+IKARE+VPGD+VE+++GDKVPADIRI SI STT+RVDQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTNIA+G+  GVV+  G+ TEIGKIR Q+  +E +KTPLQQKLDEFG+QLSKVIS+ICVAVW INIGHF DP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++FV+  + +   +   F+ITGS YAPEG++    K V+  D   L+EL+ IC+MCNDS++DYNE KG YEKVGEATETAL  LVEK+N +     GLSK + A   N  ++    K+FTLEFSRDRKSMS +  P  S    +  +MFVKGAPE VIDRCT VR+     ++T   K E++  I  +GTG+DTLRCLALAT D P + ++MDL ++TKF  YE+ +T VG VGMLDPPR EV  S+K C +AGIRVI+ITGDNK TA AICRRIG+F E+E   GK++TGREFD+L+PE Q +A ++A+ FARVEPAHKSKI+ YLQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLSDDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMD+ PR+  +PLIS WLFFRY+ IG YVG  TVG+A WW++F  +GPQ+++ QL H  QC     +F  +DC +F    P +MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+GA+ LS  LHF+IL V+ L  IFQ+TPL   +W  V+KISIPVI++DE +K++SR  ++
Sbjct:    1 MENAHTKSASEVLRNFDVNENTGLTLEQVKTNQERYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPLVILLILIANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRKAVQRIKAREIVPGDIVEVAVGDKVPADIRIVSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGRAIGVVVCTGVSTEIGKIRNQMACTEQEKTPLQQKLDEFGQQLSKVISLICVAVWVINIGHFGDPVHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVDKADSSSCSLHEFNITGSTYAPEGQVLKGVKPVQCGDFDGLLELATICSMCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVERAGACNSVIRQLMKKEFTLEFSRDRKSMSVYCTPTKS---GSQSKMFVKGAPESVIDRCTHVRIGSGKAELTIAAKEELMSTIRDWGTGKDTLRCLALATRDTPPRKQDMDLENATKFAAYESDLTFVGCVGMLDPPRKEVIGSVKLCSEAGIRVIMITGDNKGTAVAICRRIGIFTEHEDVEGKAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVGYLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVGAATWWYLFDEQGPQVSFNQLRHFMQCTEDNPMFKGIDCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILYVEPLPLIFQVTPLHCSQWIVVLKISIPVILLDEALKYVSRHHLE 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: ENSAMXT00000046993.1 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:103040450])

HSP 1 Score: 1278.46 bits (3307), Expect = 0.000e+0
Identity = 682/996 (68.47%), Postives = 806/996 (80.92%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVP---RDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H +TV EV  Y+ + E TGL  D +K  ++K+G NELP E+ KSL  LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANA+VGVWQERNAE+AIEALKEYE +  KV R   + +Q+IKAR++VPGD+VE+++GDKVPADIR+TSI STT+RVDQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTNIA+GK  GVV+A G+ TEIGKIR ++ S+E ++TPLQQKLDEFGEQLSKVIS+IC+AVW INIGHFNDP HGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++F++        + + F +TGS YAPEGE+Y +GK VK S +  LVE++ ICA+CNDS++D+NE KG YEKVGEATETAL CLVEK+N ++    GLSK + A   N  ++    K+FTLEFSRDRKSMS +  P   R SI      +MFVKGAPEGVIDRCT +RV      +TP IK +IL  I  YGTGRDTLRCLALAT DNP   E++ L DST+FV YET +T VG VGMLDPPR+EV  S+K C  AGIRVI+ITGDNK TA AICRRIG+F EN+     +FTGREFD+LSP  Q +A   A+ FARVEP+HKSKI+EYLQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVL+DDNF++IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR+A +PLIS WLFFRY+ IG YVG ATVG+AAWWF+    GP++ +YQL+H  QC      +  ++C IF  P PM+MALSVLV IEM NA+NS+SENQSL  MPPW N+WL+GA+CLS  LHF+IL V+ L  IFQITPL L +W  V+KIS+PVI++DE +KF +R  ++
Sbjct:    1 MENAHTKTVEEVYSYFSVNESTGLGLDQLKRQKEKWGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEVAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAVGVVVATGVNTEIGKIRDEMASTEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIIDQVQGDSCSLREFTVTGSTYAPEGEVYQDGKPVKCSKYDALVEMATICALCNDSSLDFNEAKGVYEKVGEATETALTCLVEKMNVFDNDLKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKARSSIG-----KMFVKGAPEGVIDRCTHIRVGSNKVPLTPGIKEKILSVIREYGTGRDTLRCLALATRDNPISKEDLVLEDSTRFVEYETDLTFVGCVGMLDPPRAEVAASMKLCRLAGIRVIMITGDNKGTAVAICRRIGIFGENDDVSSMAFTGREFDDLSPATQREAVLTARCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFATIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNAREPLISGWLFFRYLAIGGYVGAATVGAAAWWFIAAEDGPRVTFYQLSHFLQCGPDNPEYKGVNCEIFESPYPMTMALSVLVTIEMCNALNSVSENQSLLRMPPWENVWLLGAICLSMSLHFLILYVEPLPMIFQITPLNLTQWLMVLKISLPVILLDEVLKFAARNYLE 991          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010373.1 (pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 gene:ENSPMAG00000009373.1 transcript:ENSPMAT00000010373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1117.84 bits (2890), Expect = 0.000e+0
Identity = 585/847 (69.07%), Postives = 683/847 (80.64%), Query Frame = 3
Query:  621 ISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGV--VGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPL 3155
            +++GDKVPADIR+TSI STT+RVDQSILTGES+SVIKHTD + D RAVNQDKKN+LFSGTNIA+GK  GVV+A G+ TEIGKIR ++ ++E DKTPLQQKLDEFGEQLSKVIS+IC+AVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V ++F++  +     +   F ITGS YAPEGE+Y   K V+  ++  L+EL+ ICA+CNDS++D+NE KG YEKVGEATETAL C VEK+N ++    GLSK + A   N  ++    K+FTLEFSRDRKSMS +  P        G +MFVKGAPEGVIDRC+ VRV      MT  +K +IL  I  YGTGRDTLRCLALAT D P + E+M+L DSTKF +YE  +T VG   VGMLDPPR EV  SI  C +AGIRVI   GDNK TA AICRRIG+F E+E    K++TGREFD+L  E Q  AC++A+ FARVEP+HKSKI+E+LQS   I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSSIV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+R PR+  +PLIS WLFFRY+ IG YVG ATVG+AAWWFM    GP + +YQL+H  QC  +   F+ +DC +F  P PM+MALSVLV IEM NA+NSLSENQSL  MPPW N+WL+GA+CLS  LHF+IL V+ L  IFQITPL L +W  V+KIS+PVI++DET+KFI+R  ++ + L
Sbjct:    1 LAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAVGVVVATGVNTEIGKIRDEMAATEQDKTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWMRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIIDRADGENCSLNEFTITGSTYAPEGEVYKNDKLVRCGEYDGLIELATICALCNDSSLDFNEAKGVYEKVGEATETALTCQVEKMNVFDTHLVGLSKVERANACNNVIKQLMKKEFTLEFSRDRKSMSVYCTPVKPSRSSVGNKMFVKGAPEGVIDRCSHVRVGTTKLPMTAGMKEKILATIREYGTGRDTLRCLALATRDMPPRREDMNLIDSTKFASYEVDLTFVGCVGVGMLDPPRKEVSSSIILCREAGIRVI---GDNKGTAVAICRRIGIFGEDEDVKDKAYTGREFDDLPLEEQRLACQRARCFARVEPSHKSKIVEFLQSCDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFMAADDGPGVTFYQLSHFMQCTPEHPDFEGLDCHVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWDNIWLLGAICLSMSLHFLILYVEPLPIIFQITPLNLEQWLVVLKISLPVILLDETLKFIARNYLEGKEL 844          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 239.58 bits (610), Expect = 1.116e-69
Identity = 154/482 (31.95%), Postives = 251/482 (52.07%), Query Frame = 3
Query: 1701 FVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDAC-RKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSM 3140
            FVKGA E VID C   R  G+ H +    +  +L        G   LR LA+A+      PE               ++T +G+VG++DPPR  V  S+     +G+ V ++TGD+  TA AI  R+G+   +    G + +G E  +L    QL    RK  +F R  P HK KI++ LQ +G +  MTGDGVNDA AL+ A+IG+AMG SGT V K A+DM+L DD+F +I+SA+EEG+ I+ N+K F+R+ +S++I  +  I L   +  P  L  +Q+LW+N++ DG PA +LG  P D D++ + PR+  D ++++ L  + ++  I +   T+      F+F+                     EL D M     + P+  +M  +  V  +M NA++S S+ +S+F    ++N     A+  S      ++    L ++FQ   L+ ++   ++ ++  V +  E MK + R+ +
Sbjct:   15 FVKGAFERVIDMCCSFR--GQGHTLPLSAQQLVLYKQEETYMGASGLRVLAMAS-----GPEL-------------GQLTFLGLVGIIDPPRPGVRKSVAILVSSGVSVKMVTGDSMETAVAIANRLGL---SSNGGGAAISGEE--DLMETTQLSQIIRKVSVFYRASPRHKLKIVKALQKNGEVVGMTGDGVNDAVALRAADIGVAMGRSGTDVCKEAADMILVDDDFYTIMSAIEEGKGIFYNIKNFVRFQLSTSIAALTLITLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDSILTRSLISKILISAIIIVSGTL------FVFW--------------------RELQDNM-----ITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFESGFFSNRMFCYAVGGSIMGQMAVIYFPPLQQVFQTENLSAVDLLFLLGLTSTVWIASEVMKAVERRRL 440          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 223.016 bits (567), Expect = 4.770e-64
Identity = 146/478 (30.54%), Postives = 244/478 (51.05%), Query Frame = 3
Query: 1713 APEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGRE-FDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSM 3140
            A E VID C   R  G+ H +    +  +L        G   LR LA+A+      PE               ++T +G+VG++DPPR  V  S+     +G+ V ++TGD+  TA AI  R+G+   +    G + +G E +    P        +  +F R  P HK KI++ LQ +G +  MTGDGVNDA AL+ A+IG+AMG SGT V K A+DM+L DD+F +I+SA+EEG+ I+ N+K F+R+ +S++I  +  I L   +  P  L  +Q+LW+N++ DG PA +LG  P D D++ + PR+  D ++++ L  + ++  I +   T+      F+F+                     EL D M     + P+  +M  +  V  +M NA++S S+ +S+F    ++N     A+  S      ++    L ++FQ   L+ ++   ++ ++  V +  E MK + R+ +
Sbjct:    1 AFERVIDMCCSFR--GQGHTLPLSAQQLVLYKQEETYMGASGLRVLAMAS-----GPEL-------------GQLTFLGLVGIIDPPRPGVRKSVAILVSSGVSVKMVTGDSMETAVAIANRLGL---SSNGGGAAISGEEAWGGRHPAAAF-VVLQVSVFYRASPRHKLKIVKALQKNGEVVGMTGDGVNDAVALRAADIGVAMGRSGTDVCKEAADMILVDDDFYTIMSAIEEGKGIFYNIKNFVRFQLSTSIAALTLITLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDSILTRSLISKILISAIIIVSGTL------FVFW--------------------RELQDNM-----ITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFESGFFSNRMFCYAVGGSIMGQMAVIYFPPLQQVFQTENLSAVDLLFLLGLTSTVWIASEVMKAVERRRL 423          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002888.1 (pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1 gene:ENSPMAG00000002641.1 transcript:ENSPMAT00000002888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 200.29 bits (508), Expect = 7.708e-55
Identity = 134/373 (35.92%), Postives = 201/373 (53.89%), Query Frame = 3
Query: 1698 MFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILR-HISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETK-MTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEE-NETTFGKSFTGR---EFDELSP-----------------EMQLDACRKAK---LFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHAS-DPLISKWL----------------FFRYMVI 2684
            + +KGAPE ++DRC+ + + G+   +   ++      ++   G G    R L L  +  P           T+ +N+  + + LVG++ M+DPPR+ V D++ KC  AGI+VI+ TGD+  TA+AI + +G+  E NET   +    R     +++ P                 E QLD   K     +FAR  P  K  I+E  Q  G I A+TGDGVND+ ALKKA+IGIAMG  G+ V+K A+DM+L DDNF+SIV+ VEEGR I++N+K+ I Y ++SNI E+          +P  L  V +L ++L TD +PA +L +   + DIM R+PR+   D L+++ L                FF Y VI
Sbjct:   62 LVMKGAPERILDRCSSIIIEGQEESLDEELEEAFQNAYLELGGLGE---RVLGLCQLRLPVDQFPRGYAFDTENINFPMEDLCLVGLMSMIDPPRATVPDAVGKCRSAGIKVIMATGDHPITAKAIAKSVGIISEGNETV--EDIAARLNIPVNQVDPRDAKACVVHGSDLKNMTETQLDDILKNYTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSLALKKADIGIAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNVRVDKLVNERLISIAYGQIGMIQALGGFFTYFVI 429          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002145.1 (pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene:ENSPMAG00000001949.1 transcript:ENSPMAT00000002145.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.229 bits (404), Expect = 1.275e-42
Identity = 133/414 (32.13%), Postives = 203/414 (49.03%), Query Frame = 3
Query: 2022 RVIVITGDNKATAEAICRRIGVFEE-NETTFGKS-------------------FTGREFDELSPEMQLDACRKAK---LFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHAS-DPLISKWL----------------FFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNY--YQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRK 3134
            +VI++TGD+  TA+AI + +G+  E NET    +                     G +  +++ E+QLD   K     +FAR  P  K  I+E  Q  G I A+TGDGVND+PALKKA+IGIAMG +G+ V+K A+DM+L DDNF+SIV+ VEEGR I++N+K+ I Y ++SNI E+          +P  L  V +L ++L TD +PA +L +   + DIM R+PR+A  D L+++ L                FF Y VI      A  G   W  +    G ++N+    L        QE  +++    I  +    S  +S+ VV++  + +   +   S+F      N  LI  +     L   +     +    ++ PL    W      S+ + V DE  KFI R+
Sbjct:    1 QVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMT-EIQLDDILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNARVDKLVNERLISIAYGQIGMIQALGGFFSYFVI-----LAENGFLPWNLI----GIRINWDDKSLNDLEDSYGQEWTYEQR--KIVEYTCHTSFFVSI-VVVQWADLIICKTRRNSVF-QQGMKNKVLIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSLLIFVYDEVRKFILRR 400          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMR1 (High affinity Ca2+/Mn2+ P-type ATPase; required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting, processing; D53A mutant (Mn2+ transporting) is rapamycin sensitive, Q783A mutant (Ca2+ transporting) is rapamycin resistant; Mn2+ transport into Golgi lumen required for rapamycin sensitivity; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease; human ATP2C1 can complement yeast null mutant [Source:SGD;Acc:S000003135])

HSP 1 Score: 395.971 bits (1016), Expect = 1.488e-121
Identity = 287/916 (31.33%), Postives = 471/916 (51.42%), Query Frame = 3
Query:  444 ILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQ--------DKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMST-FLVPRDSIDGHTGQRMFVKGAPEGVIDRCT-FVRVNG-ESHKMTPIIKSEILRHISAYGTGRDTLRCLALA--TIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGS-GTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDE 3149
            I L +     VG  QE  +E ++EAL +    E  + R        + A  LVPGD+V   IGD++PADIRI   +  +  +D+S LTGE+  V K +  I  +   +Q        ++  I + GT +  G  +G+V+  G  T  G +   + + E  KTPLQ  +D+ G+ LS V  I+   +  + I        G SW+      F+I+V+LAVAAIPEGLP ++T  LALG  RMAK+ AIVR LPSVETLG  +VICSDKTGTLT+N MTVSKL+ + +S + ++     D         G +    K   T D +  + + N   +CN+++  +++    +  +G  T+ AL+   E+L  + +P                +++   K   L F+  RK M+T  L P D+        ++VKGA E +++  T +++  G ++ K+T   K+ I  +  A     + LR    A  T+ + + P   DL            +T  G++GM DPPR  V  +I++  + G+ +I+ITGD++ TA  I ++IG+   +        +G + DE+S +   +      +FAR  P HK  I+  L+  G + AMTGDGVNDAPALK ++IG++MG  GT VAK ASDMVL+DD+FS+I++A+EEG+ I+NN++ F+ + +S+++  +  + L+ A  +P  L  +Q+LW+N++ DG PA +LG  P D ++M + PR  +D +++  +  R +       C  VG+    ++F          ++    +  A++                 +M  +  V  +M NA+      +S+F +  +TN     A+ LS       + +     IF+   L + +   ++ IS  V ++DE  K  +RK  +++
Sbjct:  120 ITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQES--HVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLS--IDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGI------IQGRSWLE----MFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCL-DSMSNKLNVLSLDKNKKTKNSNGNL----KNYLTEDVRETLTIGN---LCNNAS--FSQEHAIF--LGNPTDVALL---EQLANFEMP---------------DIRNTVQKVQELPFNSKRKLMATKILNPVDN-----KCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATI--NECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKD---------LTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKL--SVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTA---ACIIVGTV---YIFVK--------EMAEDGKVTARD----------------TTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPFFQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTRKKNEED 943          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA2 (P-type ATPase sodium pump; involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux [Source:SGD;Acc:S000002446])

HSP 1 Score: 296.975 bits (759), Expect = 7.263e-85
Identity = 295/1102 (26.77%), Postives = 494/1102 (44.83%), Query Frame = 3
Query:  159 EEMEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAI--ADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIG------SSEADK-----------------------TPLQQKLDEFGEQL---SKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGS----------KYAP-------EGEIYFEGKAVKTSDHKNLVE---------------LSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSI----------DGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEI--LRHISAYGTGRDTLRCLALA----TIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKS------FTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPE-------ALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPP-------------WTNLWLIGAMCLSFGLHFVILEVDILS-KIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRK 3134
            EE  A H  T  E  ++   +   GL++D      K  G N L  +      ++VL Q  + ++ +L+++  ISF          A   ++   VI  ++  N ++G+ QE  A   + +LK   S  A V R+     + I ++++VPGD+  + +GD +PAD+R+    +     D+S+LTGES+ V K  + +   +      D+ N+ FS + +  G+ +G+VI   L +EIGKI   +       S +  K                       TPL +KL +    L   + + +II +A    ++             R AIY    A+ +A++ IP  L  V+T  +++G   M  +N IVR L S+E LG  + ICSDKTGTLT  +M   ++++      G IT  + D   +          +++P       +G++            K+L E               L+NI  +  D A D       ++  G+ TE A+     K++   +P + L+       SN + QS  S+      S   + ++ F  P DS           + +    ++ KGA E +I  C+      +  K+TP+   ++  +R  + Y    + LR L  A    T D     +  ++T +      E+ +  +G++G+ DPPR+E   ++KK ++AGI V ++TGD   TA+AI + +G+   N   + +        TG +FD LS E   D      + AR  P  K ++IE L       AMTGDGVND+P+LK A +GIAMG +G+ V+K ASD+VLSDDNF+SI++AVEEGR + +N+++F+  L++ N+ +  +++L   L   +        L PV++LW+ +VT   PA  LG      D+MDR P H S+  I  W     ++     G    GS    F     G  +N  +L H           D          +  S A + +    ++ A   +   +S F M P             W N +L  ++   F   F ++ + +++ K+F   P+   EW   +  +I   +  E  K   R+
Sbjct:   12 EEFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISF----------AVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKS--ETINSKDVVPGDICLVKVGDTIPADLRLIETKNFD--TDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDK-----------RVAIY----AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWI---PRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATD------CWKAHGDPTEIAIQVFATKMD---LPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEF--PFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCS-SWYGKDGVKITPLTDCDVETIRK-NVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNR--ATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQ--ALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPP-HDSEVGIFTW---EVIIDTFAYGIIMTGSCMASFTGSLYG--INSGRLGHDCDGTYNSSCRDVY--------RSRSAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIG-AEWGLAIAFTIAFWIGAELYKCGKRR 1049          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA1 (P-type ATPase sodium pump; involved in Na+ and Li+ efflux to allow salt tolerance [Source:SGD;Acc:S000002447])

HSP 1 Score: 294.664 bits (753), Expect = 4.208e-84
Identity = 294/1101 (26.70%), Postives = 493/1101 (44.78%), Query Frame = 3
Query:  162 EMEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAI--ADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIG------SSEADK-----------------------TPLQQKLDEFGEQL---SKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGS----------KYAP-------EGEIYFEGKAVKTSDHKNLVE---------------LSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSI----------DGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEI--LRHISAYGTGRDTLRCLALA----TIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKS------FTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPE-------ALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPP-------------WTNLWLIGAMCLSFGLHFVILEVDILS-KIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRK 3134
            E  A H  T  E  ++   +   GL++D      K  G N L  +      ++VL Q  + ++ +LL++ +ISF          A   ++   VI  ++  N ++G+ QE  A   + +LK   S  A V R+     + I ++++VPGD+  + +GD +PAD+R+    +     D+S+LTGES+ V K  + +   +      D+ N+ FS + +  G+ +G+VI   L +EIGKI   +       S +  K                       TPL +KL +    L   + + +II +A    ++             R AIY    A+ +A++ IP  L  V+T  +++G   M  +N IVR L S+E LG  + ICSDKTGTLT  +M   ++++      G IT  + D   +          +++P       +G++            K+L E               L+NI  +  D A D       ++  G+ TE A+     K++   +P + L+       SN + QS  S+      S   + ++ F  P DS           + +    ++ KGA E +I  C+      +  K+TP+   ++  +R  + Y    + LR L  A    T D     +  ++T +      E+ +  +G++G+ DPPR+E   ++KK ++AGI V ++TGD   TA+AI + +G+   N   + +        TG +FD LS E   D      + AR  P  K ++IE L        MTGDGVND+P+LK A +GIAMG +G+ V+K ASD+VLSDDNF+SI++AVEEGR + +N+++F+  L++ N+ +  +++L   L   +        L PV++LW+ +VT   PA  LG      D+MDR P H S+  I  W     ++     G    GS    F     G  +N  +L H           D          +  S A + +    ++ A   +   +S F M P             W N +L  ++   F   F ++ + +++ K+F   P+   EW   +  +I   +  E  K   R+
Sbjct:   13 EFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISMIISF----------AMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKS--ETINSKDVVPGDICLVKVGDTIPADLRLIETKNFD--TDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDK-----------RVAIY----AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWI---PRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATD------CWKAHGDPTEIAIQVFATKMD---LPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEF--PFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCS-SWYGKDGVKITPLTDCDVETIRK-NVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNR--ATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQ--ALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPP-HDSEVGIFTW---EVIIDTFAYGIIMTGSCMASFTGSLYG--INSGRLGHDCDGTYNSSCRDVY--------RSRSAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIG-AEWGLAIAFTIAFWIGAELYKCGKRR 1049          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA5 (Protein with similarity to P-type ATPase sodium pumps; member of the Na+ efflux ATPase family [Source:SGD;Acc:S000002445])

HSP 1 Score: 294.664 bits (753), Expect = 4.587e-84
Identity = 290/1102 (26.32%), Postives = 493/1102 (44.74%), Query Frame = 3
Query:  159 EEMEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAI--ADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIG------SSEADK-----------------------TPLQQKLDEFGEQL---SKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGS----------KYAP-------EGEIYFEGKAVKTSDHKNLVE---------------LSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSI----------DGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEI--LRHISAYGTGRDTLRCLALA----TIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKS------FTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPE-------ALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPP-------------WTNLWLIGAMCLSFGLHFVILEVDILS-KIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRK 3134
            EE  A H  T  E  ++   +   GL++D      K  G N L  +      ++VL Q  + ++ +L+++  ISF          A   ++   VI  ++  N ++G+ QE  A   + +LK   S  A V R+     + I ++++VPGD+  + +GD +PAD+R+    +     D+S+LTGES+ V K  + +   +      D+ N+ FS + +  G+ +G+VI   L +EIGKI   +       S +  K                       TPL +KL +    L   + + +II +A    ++             R AIY    A+ +A++ IP  L  V+T  +++G   M  +N IVR L S+E LG  + ICSDKTGTLT  +M   ++++      G IT  + D   +          +++P       +G++            K+L E               L+NI  +  D A D       ++  G+ TE A+     K++   +P + L+       SN + QS  S+      S   + ++ F  P DS           + +    ++ KGA E +I  C+      +  K+TP+   ++  +R  + Y    + LR L  A    T D     +  ++T +      E+ +  +G++G+ DPPR+E   ++KK ++AGI V ++TGD   TA+AI + +G+   N   + +        TG +FD LS E   D      + AR  P  K ++IE L       AMTGDGVND+P+LK A +GIAMG +G+ V+K ASD+VLSDDNF+SI++AVEEGR + +N+++F+  L++ N+ +  +++L   L   +        L PV++LW+ +VT   PA  LG      D+MDR P  +   + +  +       GI +  + + S      F      +N  +L H           D          +  S A + +    ++ A   +   +S F M P             W N +L  ++   F   F ++ + +++ K+F   P+   EW   +  +I   +  E  K   R+
Sbjct:   12 EEFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISF----------AVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKS--ETINSKDVVPGDICLVKVGDTIPADLRLIETKNFD--TDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDK-----------RVAIY----AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWI---PRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATD------CWKAHGDPTEIAIQVFATKMD---LPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEF--PFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCS-SWYGKDGVKITPLTDCDVETIRK-NVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNR--ATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQ--ALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIIDTFAYGIIMTGSCMAS------FTGSLYGINSGRLGHDCDGTYNSSCRDVY--------RSRSAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIG-AEWGLAIAFTIAFWIGAELYKCGKRR 1049          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMC1 (Vacuolar Ca2+ ATPase involved in depleting cytosol of Ca2+ ions; prevents growth inhibition by activation of calcineurin in the presence of elevated concentrations of calcium; similar to mammalian PMCA1a [Source:SGD;Acc:S000002974])

HSP 1 Score: 199.519 bits (506), Expect = 1.633e-52
Identity = 126/362 (34.81%), Postives = 202/362 (55.80%), Query Frame = 3
Query: 1614 TLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGES-HKMTPIIKSEILRHISAYGTGRDTLRCLALATID----NPTKPEEMDLTDSTK------FVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKS-FTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEA--LIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLIS 2654
            T+ F   RK     +  ++  +     R F+KGA E V   C++ R + ++  ++    K E    I    +  D LR +++A  D    +   PE++   DS          N +  + L G++G+ DP R+ V +S+++C +AG+ V ++TGDN  TA+AI R   +   + ++   S   G EF +L+   ++      ++ AR  P  K  ++E L+  G + A+TGDG NDAPALK A++G +MG SGT VA+ ASD++L  D+FS+IV+A++ GR +  ++K+FI++ +  NI  V+  F+++     E   L  VQLLW+NL+ D L A AL  + PD +IMDRKPR  S  LIS
Sbjct:  612 TIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEINEDNKKETDDEIKNLAS--DALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSEAYSAMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDRKPRGRSTSLIS 971          

HSP 2 Score: 119.398 bits (298), Expect = 1.317e-27
Identity = 125/410 (30.49%), Postives = 192/410 (46.83%), Query Frame = 3
Query:  198 VLQYYKITEETGLSEDNIKEARK-----KYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFE--------DAEDATFA---FVEPFVILLILIANAVVGVWQERNAESAIEAL-KEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIK--------------------HTDAIADTRAVNQDKKNI----LFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINI-----------GHFND--PAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLF 1265
            + +Y K  +  G+S   I   RK      YG N LP    KS L LV   F+D  +++L +AAV+SF+L L+E        D E        ++E   I++ +    +V    +   E     L K+ E+ +  V R+    +  I    ++ GDV+ +  GD VPAD  + S        D+S +TGES ++ K                    H+  + D   VN+D   I    L SG+ I SG  RGV+ ++G+ +  G+  T + ++E + TPLQ  L +  + +S    +  + ++ +             G F+D  PA  GS     +  F  ++ + V A+PEGLP  +T  LA  T RM K   +VR L S ET+G  + +CSDKTGTLT N MTV + F
Sbjct:   62 LFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLPERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVIRNDQEIL--ISIHHVLVGDVISLQTGDVVPADCVMISGKCE---ADESSITGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPL-DIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSL-NAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKF---MNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGF 461          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO47465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM93])

HSP 1 Score: 1323.15 bits (3423), Expect = 0.000e+0
Identity = 679/994 (68.31%), Postives = 809/994 (81.39%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDS-----IDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISR 3131
            M+  H + V E+L+Y+ ++E  GL    +K+ +KK+G NELP E  K L  LVLEQFDDLLVKILL+AAVISF+LALFE+ ED T AFVEP VIL+ILI NA++GVWQERNAESAIEALKEYE + AKV R    GIQ IKAR+LVPGD+VE+++GDKVPADIRIT+I STT+RVDQSILTGES+SV+KHTDAI D RAVNQDK N+LFSGTNIASGKC GVV+  GL T+IGKIR Q+  S+ ++TPLQQKLDEFGEQLSKVI+IIC+AVWAINIGHFNDP HGGSW++GAIYYFKIAVALAVAAIPEGLPAV+T CLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V K FVM + + G      F++ G+ Y P G+I  +G+ V TSD++ L E + IC++CNDS++DYN  + +YEKVGE+TETALI LVEKLN  N+   G +K+ LA   N S+++ ++K+FTLEFSRDRKSMS + VP+       +DG    +MFVKGAPEG++DRC FVRV  + H MTP +K++IL  I AYGTG DTLRCLALAT+D+P  P +MDL  S KFVNYE+ MT VGV GMLDPPR EV D+IK C KAGIRVIVITGDNKATAEAICRRI VF ++E T G S++GREFD+L+P  Q +AC +A+LF+RVEP+HKSKI+ YLQ +G ISAMTGDGVNDAPALKKAEIG+AMGSGTAVAK+AS+M+L+DDNFS+IV+AVEEGR+IY+N KQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNL+TDG PATAL FNPPD DIM + PR    PLIS WLFFRY+ IG+YVGCATVG++AWWFMFY  GP+++YYQLTH  QC         +DCA+F    PM+MALSVLV IEM NA+NSL+EN+SL  MPPW N  L+ A+  SF +HF+IL   I + IF+ITPL  +EW AV+K S PVI++DE +KFISR
Sbjct:    1 MDLAHTKPVPEILKYFNVSESKGLDPAQVKQFQKKFGPNELPAEDGKPLWKLVLEQFDDLLVKILLVAAVISFVLALFEEGEDQTTAFVEPIVILVILILNAIIGVWQERNAESAIEALKEYEPEIAKVQRQDKSGIQMIKARDLVPGDIVEVAVGDKVPADIRITTIKSTTLRVDQSILTGESISVVKHTDAIPDERAVNQDKTNMLFSGTNIASGKCSGVVVGTGLSTQIGKIRDQMIPSDDERTPLQQKLDEFGEQLSKVITIICIAVWAINIGHFNDPIHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVVTICLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVHKFFVMKDISRGRAEFHEFEVEGTTYDPVGDITKDGRNVTTSDYEVLPEFATICSLCNDSSVDYNNVRDSYEKVGESTETALIVLVEKLNVLNVDLEGKTKAQLATICNESIKNHFNKEFTLEFSRDRKSMSVYCVPQKDGPNSFLDGK--PKMFVKGAPEGILDRCDFVRVGNKKHPMTPKMKAQILDLIKAYGTGADTLRCLALATVDDPIAPSKMDLEASEKFVNYESHMTFVGVAGMLDPPRPEVTDAIKLCAKAGIRVIVITGDNKATAEAICRRIEVFGQDEDTTGLSYSGREFDDLTPSEQREACLRARLFSRVEPSHKSKIVTYLQEEGEISAMTGDGVNDAPALKKAEIGVAMGSGTAVAKTASEMILADDNFSTIVAAVEEGRSIYDNTKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLMTDGPPATALSFNPPDSDIMSKPPRSPRQPLISGWLFFRYLAIGVYVGCATVGASAWWFMFYENGPKVSYYQLTHHMQCGTDPSF--GLDCAVFGDLHPMTMALSVLVTIEMFNALNSLAENESLLTMPPWRNPSLLTAIAASFLMHFLILYFPITNTIFRITPLNWVEWMAVLKFSFPVILLDEVLKFISR 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO35616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL15])

HSP 1 Score: 456.062 bits (1172), Expect = 3.326e-144
Identity = 329/990 (33.23%), Postives = 521/990 (52.63%), Query Frame = 3
Query:  189 VAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQD-----KKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWI--RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRK 3134
            V EVL+ +   +  GLS D I+  R  +G+NE    + K+L    L+QF + ++ +LL +  +S  +  F+DA   T A       +LI++  A V   QE  ++ ++EA+ +    +    R+    +    AR LVPGD+V ISIGD+VPADIR+T  +     +D+S  TGE     K T  I    AVN       ++NI F GT + SG+ +GVVI  G  +E G+I   + + E  KTPLQ+ +D  G+QLS     +C+    + +G          WI  R  +  F I V+LAVAAIPEGLP V+T  LALG  RMAK+NAIV+ LP VETLGC+SVICSDKTGTLT N+MTVS++F    +A G     + + TG  Y+P GE+      +  + + ++ +      +CN+++I      G     G+ TE A++ + +K + +     G+   D          S+  K   ++  R  +S +   + RD          +VKGAPE V+ +CT    NG +  MT      I   + A  +    LR +A A        E++             ++T +G++G+LDPPR+ V ++++    +G++V +ITGD++ TA  I   +G+  +   T     +G E + L          +  +F RV P HK  I++ LQ  GH+ AMTGDGVNDA ALK+A+IGIAMG SGT V+K A++M+L DD+F++I++A+EEG+ I+ N+K F+R+ +S++I  +  I ++  L +P  L  +Q+LW+N++ DG PA +LG  P D D+M R PR+   P+I+K L  + +   + + C T+    W F                        E+ D +     + P+  +M  +  V  +M NA++  S+ +S+F +   TN   + A+  S    F+++    L  +FQ   L + +   ++ +S  V ++DE  KFI+ +
Sbjct:   16 VEEVLKQFNTDQSRGLSNDEIERRRMLHGWNEFDVVEEKALWKKYLDQFKEPMILLLLASGFVSICMGQFDDAFSITVA-------ILIVVTVAFV---QEYRSDKSVEAITKLVPPQCHCVRAGK--MFNFLARCLVPGDLVCISIGDRVPADIRLTEAVDLE--IDESSFTGEMEPASKTTLPIP---AVNSGSGVSARRNIAFMGTLVRSGRGKGVVIGTGENSEFGEIFKLMKAEETPKTPLQKSMDSLGKQLS--FYSLCIIGLIVLLG----------WIQKRAILEMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNAIVKKLPIVETLGCSSVICSDKTGTLTKNEMTVSQIF----TADGF----YAEATGVGYSPLGEVILNEDPITYTSNSSIAKTVEAGYLCNNASI----RNGVL--YGQPTEGAIVTVAQKASTFTC---GI---DFVRVDERPFSSE-KKLMAVKCRRKHRSSAMAEIARDI--------YYVKGAPENVMRQCTSYYKNGSAVPMTAKDVERIGDAVLAMSS--RGLRVIAFA------HGEDLQ------------QLTYLGIMGLLDPPRNGVREAVRTLLDSGVQVKMITGDSRETAITIAELLGIHFKGRPT----LSGEELEALDGLQLSTIIDQVSVFYRVSPRHKVAIVKALQQHGHVVAMTGDGVNDAVALKRADIGIAMGKSGTDVSKEAAEMILVDDDFNTIMAAIEEGKGIFYNIKNFVRFQLSTSIAAISLITISTFLKLPNPLNAMQILWINIIMDGPPAQSLGVEPVDSDVMRRPPRNVKSPMITKTLIAKVISAALLIVCGTL----WVFW----------------------REMRDNI-----ITPRDTTMTFTCFVFFDMFNALSCRSQEKSIFQVGFLTNRMFLYAVGGSLIGQFLVIYFAPLQAVFQTEALHITDILLLLAVSSSVFIVDEIRKFITYR 892          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO40680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M1])

HSP 1 Score: 332.028 bits (850), Expect = 7.824e-97
Identity = 256/809 (31.64%), Postives = 399/809 (49.32%), Query Frame = 3
Query:  441 VILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEF-SRDRKSMSTFLVPR------------DSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILR-HISAYGTGRDTLRCLALATIDNPTKPE----EMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVF------------------EENETTFGKSFT--GREFDELSPEMQLDA--CRKAKL-FARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFY 2741
            V+  ++I   +   +QE  +   +E+ K     EA V RS  R  + + A  LV GDVV +  GD++P DIRI    S    VD S LTGES    +  D    T     + +N+ F  T    G   GVV+  G  T +G+I        + KTP+  +++ F   ++ V   + V  + I             W+   I+     + + VA +PEGL A +T CL L  +RMA KN +V++L +VETLG TS ICSDKTGTLT N+MTV+ L+   N    + +      +G K              K++    L  ++ +C      A   ++     E  G+A+E+AL+  VE                LA+ +  S +    K   + F S ++  +S   +P             D  + ++   + +KGAPE ++DRC+ + VNG+   +    K    + ++   G G    R L       PT+      E D  D+  F      +  VG++ M+DPPR+ V D++ KC  AGI+VI++TGD+  TA+AI + +G+                   EE + T  K+    G +  +   E ++D   C   ++ FAR  P  K  I+E  Q  G I A+TGDGVND+PALKKA+IG+AMG +G+ V+K A+DM+L DDNF+SIV+ VEEGR I++N+K+ I Y ++SNI E+    +   L +P  L  V +L ++L TD +PA +L +   + DIM R+PR   DP+  K +  R + +  Y     + ++A +F ++
Sbjct:  163 VLAFVVIVTGIFSYYQESKSSKIMESFKNLVPQEANVLRSGGR--KTVGAENLVIGDVVSVKGGDRLPGDIRILECKSFK--VDNSSLTGESEPQSRGPDC---THENPLETRNLAFFSTYALEGNATGVVVQTGDNTVMGRIANLASGLGSGKTPIAVEIEHFIHIITGVAVFLGVTFFIIAF------ILKYKWLEAVIFL----IGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDNNIVEADTSEDQKQASGEK--------------KSTTWYALSRVATLCNRAEFKADQEDKPVLKRECTGDASESALLKYVE----------------LAIGNVISFRKNHKKVCEIPFNSTNKYQVSIHEIPDEPEHDIEEGSDVDEREKNSKHILVMKGAPERILDRCSTILVNGKEQALDDKEKENFNQAYLDLGGLGE---RVLGFCHFYLPTEQFPLGFEFDPEDNPNFP--LEGLCFVGLMSMIDPPRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGTETVEDIAERLNIPVEEVDETKAKAIVVHGSQLKDYDQE-KIDGILCNHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLMFIILDIPLPLGTVTILCIDLGTDMVPAISLAYEHAENDIMKRQPR---DPINDKLVNERLIAMA-YGQIGMIQASAGFFTYF 914          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO36455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII2])

HSP 1 Score: 324.709 bits (831), Expect = 2.575e-94
Identity = 251/792 (31.69%), Postives = 388/792 (48.99%), Query Frame = 3
Query:  468 AVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCN---------DSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEI-LRHISAYGTGRDTLRCLALATIDNPTKPEEMDL-TDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTF--------------GKS------FTGREFDELSPEMQLDACRKAK--LFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFY 2741
            A    +QE  +   +++ K     EA + R   + ++   A ++V GD++ ++IGD+VPADIR+         VD S LTGES    +  +    T     + KN+ F  TN   G C G+V+  G  T +G+I        + KTP+  ++  F       I II     A+ +  F      G  I  A+ +    + + VA +PEGL A +T CL L  +RMA KN +V++L +VETLG TS ICSDKTGTLT N+MTV+ ++    +   + T                    G A++ ++      L  I  +CN         + A+   +T G     G A+E AL+  VE                L + S   ++ ++ +   + F+   K   +     D    ++   + +KGAPE V+DRC+ + + GE   +   +K    + ++   G G   L   A   +D    P   +  TD   F      +  VG++ M+DPPR+ V D++ KC  AGI+V ++TGD+  TA+AI + +G+  E   T                KS        G E  +++ +   D  +  K  +FAR  P  K  I+E  Q +G I A+TGDGVND+PALKKA+IGIAMG SG+ V+K A+DM+L DDNF+SIV+ VEEGR I++N+K+ I Y ++SNI E+    +    G+P+ L  + +L ++L TD +PA +L +   + DIM R PR   DP   K +  R  +I +  G      A+  F+ Y
Sbjct:  179 ACFSYYQESKSSKIMDSFKNMVPQEATILRDGKKVVKN--AEQVVIGDIIFVAIGDRVPADIRVIESKGFK--VDNSSLTGESEPQARGPEF---THENPLETKNLAFFSTNAVEGTCTGIVVQTGDNTVMGRIAGLASGLGSGKTPIAIEIGHF-------IHIITGVAVALGVTFFIISLVLGYTILQAVIFL---IGIIVANVPEGLLATVTVCLTLTAKRMAAKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKTFEADTTEDQ----------------SGTAMEKTE--TWTALGRIAGLCNRAEFVSGQDNVAVLRRDTMG-----GNASEAALLKCVE----------------LQVGSVTKMREEFHRVAEIPFNSTNKYHVSIHEINDENSTYS-HHLLMKGAPERVLDRCSTILIKGELKPLDDDMKQAFEMAYLDLGGMGERVL-GFAQHYLDKENFPIGFEFETDEPNFP--VEGLCFVGLMSMIDPPRAAVPDAVAKCRSAGIKVFMVTGDHPITAKAIAQGVGIISEGTETVEDISLRLEIPVEEVDKSQADAIVVHGGELKDMTDKDIDDILKNHKEIVFARTSPQQKLIIVEGCQRNGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLMFIVAGIPQPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPR---DPRTEKLVNER--LISMTYGQIGFMQASAGFLTY 905          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO41775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I0])

HSP 1 Score: 291.197 bits (744), Expect = 2.838e-82
Identity = 276/986 (27.99%), Postives = 442/986 (44.83%), Query Frame = 3
Query:  378 SFILALFEDAE----DATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADK------TPLQ--------------------QKLDEFG----EQLSKVISIICVAVWAINIGHFNDPA-------------------HGGSW----IRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDI---TGSKYAPEG-EIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYE----KVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAY--GTGRDTLRCLALATIDNPTKPEEMDLT--DSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTF---GKSF-----------TGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIE-----YLQSDGHISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNS-LSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEW 3065
            S +L +F   E    +A   +++ F IL+ +   A+V    +   E     L+     E K T   +   ++I   E+V GD+ +I  GD +PAD  +         VD+S LTGES  V K             +K  +  +GT+I  G  + +V A+GL ++ G I T +G++  DK       P Q                    Q+  E G    ++  K +    +   A+ IG F   A                      SW    +   +  F   + + V A+PEGLP  +T  LA   ++M   N +VR L + ET+G  + ICSDKTGTLTTN+MTV +L+ M          QH         +++PE  EI  +G A+ +S   N V                    G  E    +VG  TE AL+ LV  L          +  D     + + +S + K +T  F+  RKSMST +   D      G R+F KGA E ++ RCT   + G + +  P    + L  + +       D LR + +A  D P   ++ D T  D        ++MT + + G+ DP R EV  +IKKC +AGI V ++TGDN  TA +I  + G+ E ++      GK F           + ++FDE+ P +        ++ AR  P  K  +++      L     I A+TGDG ND PALKKA++G AMG +GT VAK ASD++L+DDNF SIV AV  GR +Y+++ +F+++ ++ N+  +V  F+ A +     L   QLLWVNL+ D   + AL   PP  +++ RKP   + PLI++ +    +  G+Y            F+   +G +  ++ +        ++   +   C    H    ++  +  V++++ N +NS +   +       + N   +G M  +F +  +I+E  +  K F +  L   +W
Sbjct:  121 SLLLGIFAPEECGGSEANTGWIDGFAILIAVCIVALVTAVNDYQKEQQFRGLQSKIELEHKFTVIRNGDAKEILNSEIVVGDLCQIKYGDLLPADGVVVQSNDLK--VDESSLTGESDMVKKG------------EKDPLFLAGTHIMEGSGKMIVTAVGLNSQSGIIFTLLGATHPDKIDSGDDAPPQSPAIKGAPGDDFEDVNLDDDQESSENGKERKDKQEKSVLQAKLTKLAVTIGWFGVAAALLTIIVMALQFSIRKYVKEKASWQNTHLNAYVNAFITGLTVLVVAVPEGLPLAVTISLAYSVKKMLDDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQLYTMG---------QHHKTIPENPKEFSPELLEILCKGIALNSSYASNCV------------------VNGGREILPMQVGNKTECALLGLVLDLG--------DTYQDY---RDNNPESTFVKVYT--FNSSRKSMSTAIRMPDG-----GYRLFSKGASEILLSRCT--SIIGRNGQPEPFSSQDCLSLVQSVIEPMASDGLRTICMAYRDFPPTGKDHDDTPPDWDDEAGILSEMTAIAIAGIEDPVRQEVPAAIKKCQQAGIVVRMVTGDNVNTARSIAGKCGILEPDKDFLVLDGKEFNKLIRDSNGRVSQKKFDEIWPRL--------RVLARSSPEDKYTLVKGIIDSKLNPAREIVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFRSIVMAVMWGRNVYDSISKFLQFQLTVNLVAIVIAFVGACVVEVSPLTGTQLLWVNLIMDSFASLALATEPPTEELLTRKPYGRTKPLITRTMIRNILGHGVY-------QIIVLFVLVFKGAE--FFDI--------EDGFLEETRCKPTQHS---AVIFNTFVLMQLFNEINSRMVHGERNVFKGIFRNPIFVGIMGGTFIVQILIIE--LTGKAFHVVGLNWEQW 1015          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:NCBI gene;Acc:101160483])

HSP 1 Score: 1325.07 bits (3428), Expect = 0.000e+0
Identity = 685/993 (68.98%), Postives = 798/993 (80.36%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H++  AEVL ++ +TE+TGLS D +K   +KYG+NELP E+ KS+  LV+EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANA+VGVWQERNAESAIEALKEYE +  KV R+  + +Q+IKARE+VPGDVVE+S+GDKVPADIRI SI STT+RVDQSILTGES+SVIKHTDA+ D RAVNQDKKN+LFSGTNIA+GK  G+ +A G+ TEIGKIR Q+ ++E +KTPLQQKLDEFGEQLSKVIS+ICVAVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V+K+F++       +    FDI+GSKY PEGE+      VK   +  LVEL+ ICA+CNDS++DYNE+KG YEKVGEATETAL CLVEK+N +N    GLSK + A      ++    K+FTLEFSRDRKSMS +  P  S     G +MFVKGAPEGVIDRC++VRV      +T  +K  I+  I  +GTGRDTLRCLALAT D P + EEM+L DS  FV+YET +T VG VGMLDPPR EV  SI+ C  AGIRVI+ITGDNK TA AICRRIG+F E E   GK+FTGREFD+LS   Q +A RKA  FARVEP+HKSKI+E+LQ    I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSSIVSAVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR   +PLIS WLFFRY+ IG YVG ATV +AAWWF++   GP + +YQL+H  QC    E FD + C +F    PM+MALSVLV IEM NA+NSLSENQSL  MPPW+NLWL+GAM LS  LHF+I+ VD L  IF++T L L +W  V+K+S PVI+IDE +KF++R  ++
Sbjct:    1 MENAHSKESAEVLAHFGVTEDTGLSPDQVKRNLEKYGFNELPAEEGKSIWDLVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEMGKVYRADRKSVQRIKAREIVPGDVVEVSVGDKVPADIRIISIKSTTLRVDQSILTGESVSVIKHTDAVPDPRAVNQDKKNMLFSGTNIAAGKATGIAVATGVTTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWIINIGHFNDPVHGGSWMRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIIDKVEGDNVALGQFDISGSKYTPEGEVTRNSSLVKCGQYDGLVELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTDVRGLSKVERANTCCSVIKQLMKKEFTLEFSRDRKSMSVYCTPAKSAKAPVGSKMFVKGAPEGVIDRCSYVRVGTNRIPLTSPVKDHIMSVIKEWGTGRDTLRCLALATRDTPPRKEEMNLEDSNHFVDYETDLTFVGCVGMLDPPRKEVTSSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFTEEEDVTGKAFTGREFDDLSLYEQKNAVRKACCFARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGSATVAAAAWWFLYCDEGPMVTFYQLSHFMQCSEDNEDFDGIRCEVFESAPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNLWLMGAMSLSMSLHFMIIYVDPLPMIFKLTHLNLEQWLMVLKLSFPVILIDELLKFVARTYLE 993          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:NCBI gene;Acc:101160483])

HSP 1 Score: 1321.22 bits (3418), Expect = 0.000e+0
Identity = 677/995 (68.04%), Postives = 787/995 (79.10%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDE 3149
            ME  H++  AEVL ++ +TE+TGLS D +K   +KYG+N                QF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANA+VGVWQERNAESAIEALKEYE +  KV R+  + +Q+IKARE+VPGDVVE+S+GDKVPADIRI SI STT+RVDQSILTGES+SVIKHTDA+ D RAVNQDKKN+LFSGTNIA+GK  G+ +A G+ TEIGKIR Q+ ++E +KTPLQQKLDEFGEQLSKVIS+ICVAVW INIGHFNDP HGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V+K+F++       +    FDI+GSKY PEGE+      VK   +  LVEL+ ICA+CNDS++DYNE+KG YEKVGEATETAL CLVEK+N +N    GLSK + A      ++    K+FTLEFSRDRKSMS +  P  S     G +MFVKGAPEGVIDRC++VRV      +T  +K  I+  I  +GTGRDTLRCLALAT D P + EEM+L DS  FV+YET +T VG VGMLDPPR EV  SI+ C  AGIRVI+ITGDNK TA AICRRIG+F E E   GK+FTGREFD+LS   Q +A RKA  FARVEP+HKSKI+E+LQ    I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSSIVSAVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR   +PLIS WLFFRY+ IG YVG ATV +AAWWF++   GP + +YQL+H  QC    E FD + C +F    PM+MALSVLV IEM NA+NSLSENQSL  MPPW+NLWL+GAM LS  LHF+I+ VD L  IF++T L L +W  V+K+S PVI+IDE +KF++R  ++ E
Sbjct:    1 MENAHSKESAEVLAHFGVTEDTGLSPDQVKRNLEKYGFNGKSIWDLVVE------QFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEMGKVYRADRKSVQRIKAREIVPGDVVEVSVGDKVPADIRIISIKSTTLRVDQSILTGESVSVIKHTDAVPDPRAVNQDKKNMLFSGTNIAAGKATGIAVATGVTTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWIINIGHFNDPVHGGSWMRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIIDKVEGDNVALGQFDISGSKYTPEGEVTRNSSLVKCGQYDGLVELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTDVRGLSKVERANTCCSVIKQLMKKEFTLEFSRDRKSMSVYCTPAKSAKAPVGSKMFVKGAPEGVIDRCSYVRVGTNRIPLTSPVKDHIMSVIKEWGTGRDTLRCLALATRDTPPRKEEMNLEDSNHFVDYETDLTFVGCVGMLDPPRKEVTSSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFTEEEDVTGKAFTGREFDDLSLYEQKNAVRKACCFARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGSATVAAAAWWFLYCDEGPMVTFYQLSHFMQCSEDNEDFDGIRCEVFESAPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNLWLMGAMSLSMSLHFMIIYVDPLPMIFKLTHLNLEQWLMVLKLSFPVILIDELLKFVARTYLEGE 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1l (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:101171864])

HSP 1 Score: 1309.66 bits (3388), Expect = 0.000e+0
Identity = 685/993 (68.98%), Postives = 794/993 (79.96%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H +T AE L ++ + E TGL+ D  K+  +KYGYNELP E+ KS+  L++EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANA+VGVWQERNAESAIEALKEYE +  KV RS  + +Q IKARE+VPGD+VE+S+GDKVPADIRITSI STT+RVDQSILTGES+SVIKHT+ + D RAVNQDKKN+LFSGTNIA+GK  GV IA G+ TEIGKIR Q+ ++E +KTPLQ KLDEFGEQLSKVIS+ICVAVWAINIGHFNDP HGGSWIRGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V+K+FV+ N+    +    FDI+GSKY PEGE+   G     S +  LVEL+ ICA+CNDS++DYNE+K  YEKVGEATETAL CLVEK+N +N     LS+ + A      ++    K FTLEFSRDRKSMS +  P     G  G +MFVKGAPEGVIDRC +VRV      +T  IK +I+  I  +GTGRDTLRCLALAT D P K EEM L DSTKFV+YET +T VG VGMLDPPR EV  SI+ C  AGIRVI+ITGDNK TA AICRRIG+F E+E   GK++TGREFD+L    Q +A R+A  FARVEPAHKSKI+E+LQ    I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSSIV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR   +PLIS WLFFRYM IG YVG ATVG AAWWF++   GP++ YYQL+H  QC A  E F  +DC IF    PM+MALSVLV IEM NA+NSLSENQSL  MPPW+N WL+ AM LS  LHF+I+ VD L  IF++  L++ +W  V+K+S PVI+IDE +KF++R  ++
Sbjct:    1 MENAHAKTPAECLAHFGVNENTGLTPDQFKKNLEKYGYNELPAEEGKSIWELIIEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQMIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTEVVPDMRAVNQDKKNMLFSGTNIAAGKAIGVAIATGVGTEIGKIRDQMAATEQEKTPLQAKLDEFGEQLSKVISLICVAVWAINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIKNADGDHVDLDAFDISGSKYTPEGEVTQGGARTNCSQYDGLVELATICALCNDSSLDYNESKKIYEKVGEATETALCCLVEKMNVFNTNVKNLSRVERANACCSVIKQLMKKNFTLEFSRDRKSMSVYCTPAK---GDGGAKMFVKGAPEGVIDRCAYVRVGTTRVPLTNAIKDKIMAVIKEWGTGRDTLRCLALATRDTPLKVEEMVLEDSTKFVDYETDLTFVGCVGMLDPPRKEVTSSIELCRNAGIRVIMITGDNKGTAIAICRRIGIFSEDEDVSGKAYTGREFDDLPLHEQAEAVRRACCFARVEPAHKSKIVEFLQGFDDITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKPPRSPKEPLISGWLFFRYMAIGGYVGAATVGGAAWWFLYDPTGPEITYYQLSHFMQCHADNEDFAGIDCEIFEECPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNFWLLAAMTLSMSLHFMIIYVDPLPMIFKLKHLSVDQWMVVLKLSFPVILIDEVLKFVARNYVE 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1l (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:101171864])

HSP 1 Score: 1308.89 bits (3386), Expect = 0.000e+0
Identity = 685/993 (68.98%), Postives = 794/993 (79.96%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H +T AE L ++ + E TGL+ D  K+  +KYGYNELP E+ KS+  L++EQF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANA+VGVWQERNAESAIEALKEYE +  KV RS  + +Q IKARE+VPGD+VE+S+GDKVPADIRITSI STT+RVDQSILTGES+SVIKHT+ + D RAVNQDKKN+LFSGTNIA+GK  GV IA G+ TEIGKIR Q+ ++E +KTPLQ KLDEFGEQLSKVIS+ICVAVWAINIGHFNDP HGGSWIRGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V+K+FV+ N+    +    FDI+GSKY PEGE+   G     S +  LVEL+ ICA+CNDS++DYNE+K  YEKVGEATETAL CLVEK+N +N     LS+ + A      ++    K FTLEFSRDRKSMS +  P     G  G +MFVKGAPEGVIDRC +VRV      +T  IK +I+  I  +GTGRDTLRCLALAT D P K EEM L DSTKFV+YET +T VG VGMLDPPR EV  SI+ C  AGIRVI+ITGDNK TA AICRRIG+F E+E   GK++TGREFD+L    Q +A R+A  FARVEPAHKSKI+E+LQ    I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSSIV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR   +PLIS WLFFRYM IG YVG ATVG AAWWF++   GP++ YYQL+H  QC A  E F  +DC IF    PM+MALSVLV IEM NA+NSLSENQSL  MPPW+N WL+ AM LS  LHF+I+ VD L  IF++  L++ +W  V+K+S PVI+IDE +KF++R  ++
Sbjct:    1 MENAHAKTPAECLAHFGVNENTGLTPDQFKKNLEKYGYNELPAEEGKSIWELIIEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQMIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTEVVPDMRAVNQDKKNMLFSGTNIAAGKAIGVAIATGVGTEIGKIRDQMAATEQEKTPLQAKLDEFGEQLSKVISLICVAVWAINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIKNADGDHVDLDAFDISGSKYTPEGEVTQGGARTNCSQYDGLVELATICALCNDSSLDYNESKKIYEKVGEATETALCCLVEKMNVFNTNVKNLSRVERANACCSVIKQLMKKNFTLEFSRDRKSMSVYCTPAK---GDGGAKMFVKGAPEGVIDRCAYVRVGTTRVPLTNAIKDKIMAVIKEWGTGRDTLRCLALATRDTPLKVEEMVLEDSTKFVDYETDLTFVGCVGMLDPPRKEVTSSIELCRNAGIRVIMITGDNKGTAIAICRRIGIFSEDEDVSGKAYTGREFDDLPLHEQAEAVRRACCFARVEPAHKSKIVEFLQGFDDITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKPPRSPKEPLISGWLFFRYMAIGGYVGAATVGGAAWWFLYDPTGPEITYYQLSHFMQCHADNEDFAGIDCEIFEECPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNFWLLAAMTLSMSLHFMIIYVDPLPMIFKLKHLSVDQWMVVLKLSFPVILIDEVLKFVARNYVE 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1l (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:101171864])

HSP 1 Score: 1306.2 bits (3379), Expect = 0.000e+0
Identity = 677/995 (68.04%), Postives = 786/995 (78.99%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDE 3149
            ME  H +T AE L ++ + E TGL+ D  K+  +KYGYN     +      ++  QF+DLLV+ILLLAA ISF+LA FE+ E+   AFVEPFVILLILIANA+VGVWQERNAESAIEALKEYE +  KV RS  + +Q IKARE+VPGD+VE+S+GDKVPADIRITSI STT+RVDQSILTGES+SVIKHT+ + D RAVNQDKKN+LFSGTNIA+GK  GV IA G+ TEIGKIR Q+ ++E +KTPLQ KLDEFGEQLSKVIS+ICVAVWAINIGHFNDP HGGSWIRGA+YYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V+K+FV+ N+    +    FDI+GSKY PEGE+   G     S +  LVEL+ ICA+CNDS++DYNE+K  YEKVGEATETAL CLVEK+N +N     LS+ + A      ++    K FTLEFSRDRKSMS +  P     G  G +MFVKGAPEGVIDRC +VRV      +T  IK +I+  I  +GTGRDTLRCLALAT D P K EEM L DSTKFV+YET +T VG VGMLDPPR EV  SI+ C  AGIRVI+ITGDNK TA AICRRIG+F E+E   GK++TGREFD+L    Q +A R+A  FARVEPAHKSKI+E+LQ    I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSSIV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR   +PLIS WLFFRYM IG YVG ATVG AAWWF++   GP++ YYQL+H  QC A  E F  +DC IF    PM+MALSVLV IEM NA+NSLSENQSL  MPPW+N WL+ AM LS  LHF+I+ VD L  IF++  L++ +W  V+K+S PVI+IDE +KF++R  ++ +
Sbjct:    1 MENAHAKTPAECLAHFGVNENTGLTPDQFKKNLEKYGYNGESLGRKSIWELIIE-QFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQMIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTEVVPDMRAVNQDKKNMLFSGTNIAAGKAIGVAIATGVGTEIGKIRDQMAATEQEKTPLQAKLDEFGEQLSKVISLICVAVWAINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIKNADGDHVDLDAFDISGSKYTPEGEVTQGGARTNCSQYDGLVELATICALCNDSSLDYNESKKIYEKVGEATETALCCLVEKMNVFNTNVKNLSRVERANACCSVIKQLMKKNFTLEFSRDRKSMSVYCTPAK---GDGGAKMFVKGAPEGVIDRCAYVRVGTTRVPLTNAIKDKIMAVIKEWGTGRDTLRCLALATRDTPLKVEEMVLEDSTKFVDYETDLTFVGCVGMLDPPRKEVTSSIELCRNAGIRVIMITGDNKGTAIAICRRIGIFSEDEDVSGKAYTGREFDDLPLHEQAEAVRRACCFARVEPAHKSKIVEFLQGFDDITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKPPRSPKEPLISGWLFFRYMAIGGYVGAATVGGAAWWFLYDPTGPEITYYQLSHFMQCHADNEDFAGIDCEIFEECPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNFWLLAAMTLSMSLHFMIIYVDPLPMIFKLKHLSVDQWMVVLKLSFPVILIDEVLKFVARNYVESK 991          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 1969.9 bits (5102), Expect = 0.000e+0
Identity = 1007/1008 (99.90%), Postives = 1008/1008 (100.00%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGAYGVFLMW 3188
            MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNELPPEKSKSLLSLVLEQFDDLLVKILLLAAVISFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADIRITSILSTTIRVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRK+MDDEPLMQGAYGVFLMW
Sbjct:    1 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNELPPEKSKSLLSLVLEQFDDLLVKILLLAAVISFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADIRITSILSTTIRVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 1008          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 1964.5 bits (5088), Expect = 0.000e+0
Identity = 1004/1005 (99.90%), Postives = 1005/1005 (100.00%), Query Frame = 3
Query:  174 MHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGAYGVFLMW 3188
            MHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNELPPEKSKSLLSLVLEQFDDLLVKILLLAAVISFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADIRITSILSTTIRVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRK+MDDEPLMQGAYGVFLMW
Sbjct:    1 MHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNELPPEKSKSLLSLVLEQFDDLLVKILLLAAVISFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADIRITSILSTTIRVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 1005          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 1947.17 bits (5043), Expect = 0.000e+0
Identity = 1004/1037 (96.82%), Postives = 1005/1037 (96.91%), Query Frame = 3
Query:  174 MHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQL--------------------------------THQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGAYGVFLMW 3188
            MHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNELPPEKSKSLLSLVLEQFDDLLVKILLLAAVISFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADIRITSILSTTIRVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQL                                THQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRK+MDDEPLMQGAYGVFLMW
Sbjct:    1 MHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNELPPEKSKSLLSLVLEQFDDLLVKILLLAAVISFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADIRITSILSTTIRVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHHMQCLAERDTFQGIQCGIFTNPKPMSLALSTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 1037          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 1938.31 bits (5020), Expect = 0.000e+0
Identity = 992/1008 (98.41%), Postives = 998/1008 (99.01%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQGAYGVFLMW 3188
            MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNELPPEKSKSLLSLVLEQFDDLLVKILLLAAVISFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADIRITSILSTTIRVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTH  QCLA+ + F  + C IF +PKPMS+ALSVLV IEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRK+MDDEPLMQGAYGVFLMW
Sbjct:    1 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNELPPEKSKSLLSLVLEQFDDLLVKILLLAAVISFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADIRITSILSTTIRVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 1008          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000050554.1 (SMESG000050554.1)

HSP 1 Score: 1458.74 bits (3775), Expect = 0.000e+0
Identity = 745/993 (75.03%), Postives = 860/993 (86.61%), Query Frame = 3
Query:  165 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNXXXXXXXXXXXXXXXXQFXXXXXXXXXXXXXXSFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADXXXXXXXXXXXXVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVPRDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMD 3143
            ME  H +TV EVL Y+ + EE GLS++ +K   +++G+NE+P E++K+L  L+LEQFDDLLVKILLLAA+ISF+LALFE+ ED+  AFVEPFVI+LILIANA+VGVWQERNAESAIEALKEYE + AKV R + +G+QKIKARELVPGD+ +I++GDKVPADIRIT I STTIR+DQSILTGES+SVIKH+DAI D RAVNQDKKN+LFSGTN+ASGKCRGVVI  GL+TEIGKIR Q+  +E ++TPLQQKLDEFG+QLSKVI+IIC+AVWAINIGHFNDPAHGGSW+RGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V+++FV +N    EI+T  F+ITGSKYAPEGE++  G+ V+T D++ L+E++NICAMCNDS+IDYNETK  YEKVGEATETAL CLVEK+N +N+ K GL+K  L M  N+ +Q  W K+FTLEFSRDRKSMS ++ P          +MF KGAPEG++DRC FVRV  +   MT  IKSEI+R    YGTGRDTLRCLALAT+DNP K E+M+L DS +F  YET MT VGVVGMLDPPR+EV DSI KC  AGIRVIVITGDNKATAEAICRRIGVF ENETTFGKS+TGREFD+LS EM+ +A R+AKLFARVEPAHKSKI+EYLQ DG +SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PR   +PLI+ WLFFRYM +G YVG ATVG+AAWWF  Y +GPQLNYYQLTHQAQCLAQE  F+ +DC+IF+HPKPM+MALSVLV+IEMLNA+NSLSENQSL  MPPW NLWL+G+M LS  LHF+ILEVD LSK+FQITPL++ EW AV+KIS PVI++DE +K I+RK  D
Sbjct:    1 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKILLLAAIISFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAK----EGSPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMAVGTYVGAATVGAAAWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 989          
The following BLAST results are available for this feature:
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP2A10.000e+068.34ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A20.000e+067.88ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A10.000e+068.31ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A20.000e+067.88ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A30.000e+065.33ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sca-10.000e+069.38Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-10.000e+069.60Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-10.000e+069.60Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-10.000e+069.60Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-10.000e+070.13Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SERCA0.000e+070.73gene:FBgn0263006 transcript:FBtr0072216[more]
SERCA0.000e+070.73gene:FBgn0263006 transcript:FBtr0072211[more]
SERCA0.000e+070.73gene:FBgn0263006 transcript:FBtr0072214[more]
SERCA0.000e+070.73gene:FBgn0263006 transcript:FBtr0072212[more]
SERCA0.000e+070.73gene:FBgn0263006 transcript:FBtr0072217[more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2a30.000e+067.54ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a30.000e+067.57ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a10.000e+068.24ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a10.000e+068.38ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a10.000e+068.38ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2a30.000e+066.87ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a30.000e+066.87ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a30.000e+066.87ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a10.000e+068.61ATPase, Ca++ transporting, cardiac muscle, fast tw... [more]
ATP2A20.000e+067.70ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp2a20.000e+067.97ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
Atp2a20.000e+068.38ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
Atp2a20.000e+068.38ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
Atp2a10.000e+068.48ATPase, Ca++ transporting, cardiac muscle, fast tw... [more]
Atp2a30.000e+064.71ATPase, Ca++ transporting, ubiquitous [Source:MGI ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7PPA5|ATC1_ANOGA0.000e+071.03Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|P22700|ATC1_DROME0.000e+070.73Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|Q292Q0|ATC1_DROPS0.000e+071.10Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|P35316|ATC_ARTSF0.000e+070.50Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|Q9YGL9|AT2A3_CHICK0.000e+066.47Sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2KSK60.000e+074.45Calcium-transporting ATPase OS=Clonorchis sinensis... [more]
A0A4S2L1X30.000e+074.70Calcium-transporting ATPase OS=Opisthorchis feline... [more]
A0A5K3FDE60.000e+074.60Uncharacterized protein OS=Mesocestoides corti OX=... [more]
C1LE790.000e+074.15Calcium-transporting ATPase OS=Schistosoma japonic... [more]
A0A3Q0KMK30.000e+073.95Calcium-transporting ATPase OS=Schistosoma mansoni... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2a10.000e+067.73sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a10.000e+068.18sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a30.000e+066.73sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a30.000e+066.77sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
ENSAMXT00000046993.10.000e+068.47sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010373.10.000e+069.07pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 ge... [more]
atp2c11.116e-6931.95ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
atp2c14.770e-6430.54ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
ENSPMAT00000002888.17.708e-5535.92pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1... [more]
ENSPMAT00000002145.11.275e-4232.13pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PMR11.488e-12131.33High affinity Ca2+/Mn2+ P-type ATPase; required fo... [more]
ENA27.263e-8526.77P-type ATPase sodium pump; involved in Na+ efflux ... [more]
ENA14.208e-8426.70P-type ATPase sodium pump; involved in Na+ and Li+... [more]
ENA54.587e-8426.32Protein with similarity to P-type ATPase sodium pu... [more]
PMC11.633e-5234.81Vacuolar Ca2+ ATPase involved in depleting cytosol... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474650.000e+068.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356163.326e-14433.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406807.824e-9731.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364552.575e-9431.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417752.838e-8227.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2a10.000e+068.98ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a10.000e+068.04ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a1l0.000e+068.98sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a1l0.000e+068.98sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a1l0.000e+068.04sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039058.10.000e+099.90SMESG000039058.1[more]
SMESG000039058.10.000e+099.90SMESG000039058.1[more]
SMESG000039058.10.000e+096.82SMESG000039058.1[more]
SMESG000039058.10.000e+098.41SMESG000039058.1[more]
SMESG000050554.10.000e+075.03SMESG000050554.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006630 ID=SMED30006630|Name=Calcium-transporting ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=3367bp
TCTCGCTCTAGTTCTATCGCTATCAGAAAAAAAATAATTTCGAATTCAAT
CATTTCATTTATTATTGTTTTTTATTTACAAATAAAAAATAAATAAATTT
CTGACTCAAAACATTTTCTTTCTGGGTTTCATTGAGAAATTGAAAATTAA
TCATATTTGAAGAGATGGAAGCAATGCATAATCGCACTGTGGCAGAAGTG
CTTCAGTATTATAAGATAACAGAGGAAACCGGATTATCCGAGGATAATAT
TAAAGAAGCCCGAAAGAAATATGGATATAACGAGCTTCCTCCAGAAAAAA
GTAAATCTTTACTCTCCTTAGTATTGGAACAATTTGATGATCTTCTTGTC
AAAATTCTATTATTAGCGGCAGTTATATCATTTATTTTGGCTCTGTTTGA
AGATGCTGAAGATGCCACATTTGCTTTTGTTGAGCCTTTCGTGATTTTGT
TGATTTTAATAGCGAATGCAGTCGTTGGAGTATGGCAAGAAAGGAATGCC
GAATCTGCAATTGAAGCTTTGAAAGAATATGAATCAGATGAAGCGAAAGT
TACTCGATCTAGCCACCGAGGCATACAGAAGATTAAAGCAAGGGAACTTG
TTCCAGGAGATGTTGTTGAAATTTCAATTGGAGACAAAGTTCCAGCTGAT
ATTCGAATAACATCAATTTTGAGCACAACGATTCGAGTCGACCAATCGAT
TCTGACAGGGGAGTCAATGTCTGTCATTAAGCATACCGATGCCATCGCAG
ACACTAGGGCAGTGAACCAAGACAAGAAGAATATATTGTTCAGCGGAACA
AATATTGCGTCTGGGAAATGTCGTGGAGTTGTAATAGCGATCGGTTTGGA
AACAGAAATAGGAAAAATCAGAACTCAAATCGGATCATCAGAAGCTGACA
AAACTCCATTGCAACAAAAATTGGATGAATTTGGTGAACAATTGTCAAAG
GTCATTTCAATTATCTGCGTCGCAGTTTGGGCAATAAATATTGGGCATTT
CAATGATCCTGCTCATGGAGGATCGTGGATTCGTGGAGCGATTTATTATT
TTAAAATTGCGGTGGCATTGGCTGTAGCTGCTATACCAGAAGGTCTTCCA
GCAGTTATTACAACTTGTTTAGCACTTGGTACAAGAAGAATGGCAAAAAA
GAATGCTATCGTTAGATCCTTACCTAGTGTTGAGACGTTAGGTTGTACAA
GTGTAATATGCTCAGATAAAACTGGTACATTGACCACCAATCAAATGACC
GTCAGCAAACTTTTTGTCATGGCTAATTCAGCTACTGGAGAGATTACTAC
TCAGCATTTTGATATCACCGGGTCAAAATACGCTCCAGAAGGTGAAATAT
ATTTTGAAGGCAAGGCTGTCAAAACCAGTGACCACAAAAATTTGGTAGAA
CTAAGCAACATTTGTGCAATGTGCAACGATTCAGCAATAGACTACAACGA
GACCAAAGGAACATATGAAAAGGTTGGCGAAGCCACGGAGACTGCATTAA
TATGCTTGGTGGAAAAATTGAATCCTTACAATATACCCAAACATGGGCTG
TCAAAATCAGATTTGGCGATGTGCTCCAATTATAGTGTTCAGAGTAAATG
GTCCAAAAAATTCACTTTAGAATTTTCACGCGATAGAAAGTCAATGTCCA
CCTTCTTAGTGCCTCGAGATTCAATTGATGGTCATACTGGTCAAAGAATG
TTTGTTAAAGGTGCACCTGAAGGCGTCATAGATAGATGTACGTTTGTACG
AGTGAATGGAGAAAGCCATAAAATGACTCCGATTATTAAATCCGAAATTC
TGAGACACATATCAGCTTACGGTACCGGTCGGGATACTCTAAGATGCTTA
GCACTAGCAACAATTGATAATCCAACCAAACCAGAAGAAATGGATCTCAC
TGACTCCACAAAATTTGTTAACTACGAAACAAAAATGACTCTCGTCGGAG
TAGTTGGGATGTTAGACCCGCCAAGATCAGAAGTACACGATAGCATAAAA
AAGTGCTACAAAGCCGGAATTCGGGTCATTGTAATTACAGGAGACAATAA
AGCTACAGCTGAAGCCATTTGTCGACGGATTGGAGTGTTCGAGGAAAATG
AAACGACTTTTGGAAAGTCTTTTACTGGTCGGGAATTCGATGAACTTTCA
CCAGAAATGCAGTTAGATGCGTGTAGAAAAGCAAAGCTATTTGCACGTGT
TGAACCAGCGCATAAAAGCAAAATTATTGAATATCTACAATCAGATGGCC
ACATTTCTGCTATGACTGGCGATGGGGTTAATGATGCTCCCGCCTTGAAG
AAAGCAGAAATCGGAATTGCAATGGGCAGTGGAACAGCTGTTGCGAAGAG
TGCATCAGATATGGTGTTATCAGATGATAATTTTAGTAGCATTGTTTCGG
CCGTGGAAGAAGGAAGAGCTATTTATAATAATATGAAACAATTTATTCGC
TATTTAATATCTTCAAATATTGGCGAGGTTGTCAGTATCTTCTTAACTGC
GGCTCTAGGAATGCCGGAAGCTCTAATTCCTGTTCAATTACTTTGGGTCA
ATTTAGTTACCGACGGATTACCCGCAACTGCACTAGGTTTCAATCCTCCA
GATTTAGATATCATGGATAGAAAACCGCGTCACGCTTCTGATCCCTTAAT
TAGTAAATGGCTATTTTTTCGCTACATGGTAATAGGAATATATGTGGGAT
GTGCAACAGTTGGATCAGCAGCCTGGTGGTTTATGTTTTACAGCAGAGGT
CCTCAATTAAATTACTATCAATTGACTCATCAAGCACAATGCTTGGCACA
AGAGGAATTGTTTGATCGAATGGACTGTGCAATATTCATGCATCCAAAAC
CCATGTCAATGGCTCTGAGTGTCTTGGTCGTCATTGAAATGCTGAATGCA
GTCAACAGTTTATCGGAAAACCAATCGCTTTTTGTCATGCCTCCGTGGAC
CAATTTATGGCTCATAGGTGCAATGTGCTTGAGTTTTGGACTTCATTTCG
TGATTTTAGAAGTGGACATTTTATCAAAAATTTTTCAAATTACTCCCTTG
ACCTTGATTGAGTGGTCAGCAGTGATGAAGATCTCGATCCCAGTTATTGT
GATAGATGAAACAATGAAGTTCATATCCCGCAAATCTATGGATGACGAAC
CTTTGATGCAGGGTGCTTATGGCGTATTTCTCATGTGGGCGGCTTATTTT
GCTTTGTTATTTCTGTGTCCATAATTTTGAGCATGACATTAGGCATGTGA
AAAATCAGAAATAAATCTTAATTAATTTTTATTACAATTCTGACAGCTCA
TGTGATCTAGGATTAATAAATGACTTTAGAAATACTTTTGTTTAAGTCTT
ACCAATTCAGTGTTGAT
back to top

protein sequence of SMED30006630-orf-1

>SMED30006630-orf-1 ID=SMED30006630-orf-1|Name=SMED30006630-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1020bp
MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNELPPEKSKSLL
SLVLEQFDDLLVKILLLAAVISFILALFEDAEDATFAFVEPFVILLILIA
NAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDV
VEISIGDKVPADIRITSILSTTIRVDQSILTGESMSVIKHTDAIADTRAV
NQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQ
QKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICS
DKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGK
AVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVE
KLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVP
RDSIDGHTGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHIS
AYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGML
DPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFG
KSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAM
TGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEG
RAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTD
GLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVG
SAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMA
LSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEV
DILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKSMDDEPLMQG
AYGVFLMWAAYFALLFLCP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR005782P-type_ATPase_IIA
IPR001757P_typ_ATPase
IPR030332SERCA1/2
IPR036412HAD-like_sf
IPR004014ATPase_P-typ_cation-transptr_N
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR023298ATPase_P-typ_TM_dom_sf
IPR023214HAD_sf
IPR006068ATPase_P-typ_cation-transptr_C
IPR023299ATPase_P-typ_cyto_dom_N
IPR018303ATPase_P-typ_P_site
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0046872metal ion binding
GO:0005388calcium-transporting ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0016020membrane
GO:0016021integral component of membrane
GO:0033017sarcoplasmic reticulum membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0070588calcium ion transmembrane transport
GO:0099132ATP hydrolysis coupled cation transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 701..720
score: 83.2
coord: 595..606
score: 54.88
coord: 617..627
score: 66.86
coord: 724..736
score: 56.5
coord: 176..190
score: 60.06
coord: 349..363
score: 80.03
NoneNo IPR availablePFAMPF13246Cation_ATPasecoord: 418..528
e-value: 8.6E-21
score: 73.8
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 124..329
e-value: 1.7E-52
score: 177.6
NoneNo IPR availableGENE3DG3DSA:2.70.150.10coord: 1..64
e-value: 1.0E-8
score: 37.1
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 243..989
e-value: 0.0
score: 1227.7
NoneNo IPR availableGENE3DG3DSA:2.70.150.10coord: 95..242
e-value: 1.6E-52
score: 179.7
NoneNo IPR availablePFAMPF08282Hydrolase_3coord: 686..745
e-value: 4.7E-6
score: 26.5
NoneNo IPR availableSFLDSFLDG00002C1.7:_P-type_atpase_likecoord: 330..753
e-value: 0.0
score: 256.9
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 330..753
e-value: 0.0
score: 256.9
NoneNo IPR availablePANTHERPTHR42861FAMILY NOT NAMEDcoord: 1..994
NoneNo IPR availableCDDcd02083P-type_ATPase_SERCAcoord: 5..989
e-value: 0.0
score: 1863.89
NoneNo IPR availableTMHMMTMhelixcoord: 60..79
NoneNo IPR availableTMHMMTMhelixcoord: 958..980
NoneNo IPR availableTMHMMTMhelixcoord: 260..279
NoneNo IPR availableTMHMMTMhelixcoord: 299..321
NoneNo IPR availableTMHMMTMhelixcoord: 84..106
NoneNo IPR availableTMHMMTMhelixcoord: 760..782
NoneNo IPR availableTMHMMTMhelixcoord: 931..948
NoneNo IPR availableTMHMMTMhelixcoord: 1000..1017
NoneNo IPR availableTMHMMTMhelixcoord: 837..859
IPR004014Cation-transporting P-type ATPase, N-terminalSMARTSM00831Cation_ATPase_N_a_2coord: 3..77
e-value: 3.8E-17
score: 73.0
IPR004014Cation-transporting P-type ATPase, N-terminalPFAMPF00690Cation_ATPase_Ncoord: 5..72
e-value: 2.8E-17
score: 62.2
IPR005782P-type ATPase, subfamily IIA, SERCA-typeTIGRFAMTIGR01116TIGR01116coord: 53..855
e-value: 0.0
score: 1012.1
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 331..739
e-value: 0.0
score: 1227.7
IPR006068Cation-transporting P-type ATPase, C-terminalPFAMPF00689Cation_ATPase_Ccoord: 784..987
e-value: 9.4E-42
score: 142.8
IPR023299P-type ATPase, cytoplasmic domain NGENE3DG3DSA:3.40.1110.10coord: 359..603
e-value: 0.0
score: 1227.7
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILYSSF81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 356..599
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 670..786
e-value: 1.9E-35
score: 120.2
coord: 93..376
e-value: 1.2E-42
score: 143.9
IPR030332Sarcoplasmic/endoplasmic reticulum calcium ATPase 1/2PANTHERPTHR42861:SF18SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM ATPASE 2coord: 1..994
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 351..357
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 3..991
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 583..749
IPR008250P-type ATPase, A domain superfamilySUPERFAMILYSSF81653Calcium ATPase, transduction domain Acoord: 130..237