E3 ubiquitin protein ligase HUWE1

Overview
NameE3 ubiquitin protein ligase HUWE1
Smed IDSMED30006629
Length (bp)12667
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin protein ligase HUWE1 (SMED30006629) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin protein ligase HUWE1 (SMED30006629) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin protein ligase HUWE1 (SMED30006629) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin protein ligase HUWE1 (SMED30006629) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006629

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30006629h1SMcG0001710 dd_Smed_v4_3378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006629h1SMcG0001710 dd_Smed_v4_3378_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30006629h1SMcG0001710 GAKN01012244.1SmedAsxl_pearson_GAKN01PMID:25956527
Henderson et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30006629h1SMcG0001710 GAKN01012244.1SmedAsxl_pearson_GAKN01PMID:25956527
Henderson et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30006629h1SMcG0001710 GAKN01012244.1SmedAsxl_pearson_GAKN01PMID:25956527
Henderson et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30006629h1SMcG0001710 KP954682smed_ncbi_20240424PMID:25956527
Henderson et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30006629h1SMcG0001710 KP954682smed_ncbi_20240424PMID:25956527
Henderson et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30006629h1SMcG0001710 KP954682smed_ncbi_20240424PMID:25956527
Henderson et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30006629h1SMcG0001710 KP954682smed_ncbi_20240424PMID:25956527
Henderson et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Human
Match: HUWE1 (HECT, UBA and WWE domain containing E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:30892])

HSP 1 Score: 583.948 bits (1504), Expect = 2.963e-177
Identity = 297/532 (55.83%), Postives = 370/532 (69.55%), Query Frame = 3
Query: 10662 ILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHS----------DCSEIHEEHNKSDNSNVSD-PLSHLNTSLVVDDTFMNSPAFSENGKHNP-----FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            +L++  S   +W +L + L  +++S +  AV+V Q  VE+F L H+          D  E    H K +   +S  PL+    S  +D  F   P+        P     FL F E H+ VLN ILR+ T    D   F+ L+ Y ++LDFD+KR+YF+ ++ +L  D   R E+  V V R  +FEDSY  LHRK+ EE K R  I F  EEGQD GGLLREWY+ +S E+FNP YALF+ SP D VTYTINP+S+ N NHLSYFKFVGR +AKA++DN+LL CYFTR+FYKHILG S+RYTD+E EDY F++GL +LL+NDVST+  D TFS ++ EFG  E RDL PNG+ ILVTEENK EYV LVCQ +MTGAIR+QL +FLEGFYEIIPK LISIF E+ELELLI GLP ID++DLK NT Y+KY   S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF+ LEGMNG  KFQI     ST+ LP+AHTCFN +DLP YE+F+KL   LL AI+ECSEG+G+
Sbjct:  669 LLSEQLSLDELWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPVRDTRESQLAHIKDEPPPLSPAPLTPATPS-SLDPFFSREPSSMHISSSLPPDTQKFLRFAETHRTVLNQILRQSTTHLAD-GPFAVLVDYIRVLDFDVKRKYFRQELERL--DEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGL 1196          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Human
Match: HUWE1 (HECT, UBA and WWE domain containing E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:30892])

HSP 1 Score: 593.578 bits (1529), Expect = 4.863e-169
Identity = 297/532 (55.83%), Postives = 370/532 (69.55%), Query Frame = 3
Query: 10662 ILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHS----------DCSEIHEEHNKSDNSNVSD-PLSHLNTSLVVDDTFMNSPAFSENGKHNP-----FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            +L++  S   +W +L + L  +++S +  AV+V Q  VE+F L H+          D  E    H K +   +S  PL+    S  +D  F   P+        P     FL F E H+ VLN ILR+ T    D   F+ L+ Y ++LDFD+KR+YF+ ++ +L  D   R E+  V V R  +FEDSY  LHRK+ EE K R  I F  EEGQD GGLLREWY+ +S E+FNP YALF+ SP D VTYTINP+S+ N NHLSYFKFVGR +AKA++DN+LL CYFTR+FYKHILG S+RYTD+E EDY F++GL +LL+NDVST+  D TFS ++ EFG  E RDL PNG+ ILVTEENK EYV LVCQ +MTGAIR+QL +FLEGFYEIIPK LISIF E+ELELLI GLP ID++DLK NT Y+KY   S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF+ LEGMNG  KFQI     ST+ LP+AHTCFN +DLP YE+F+KL   LL AI+ECSEG+G+
Sbjct: 3846 LLSEQLSLDELWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPVRDTRESQLAHIKDEPPPLSPAPLTPATPS-SLDPFFSREPSSMHISSSLPPDTQKFLRFAETHRTVLNQILRQSTTHLAD-GPFAVLVDYIRVLDFDVKRKYFRQELERL--DEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGL 4373          

HSP 2 Score: 385.956 bits (990), Expect = 4.809e-106
Identity = 236/677 (34.86%), Postives = 364/677 (53.77%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGH--WTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYM---PYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQ-----PESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKC---LSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKIC-------LDSEIDQ--MTKKSVALNT---------QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            MK+DR K+         +C  L  +L    +  L+ E+++I  W+ GKCEL  W D+LDR D ILA+    V +  W L  D+P  E L   ++A+L FT  LIE+S  R+LY S EH+  L  +S+M ++ A+L L Y FSKRSNY +RL S  R  +L RL  +AE+WGGK++GFGLAECC   +M   P SA T+ +EF  D       G E          +K +      TL  +H++      ESPSE+ME+L + Y++     QM LF  +RL   F    +R   +  R+ A+SIL Y+N +++     L   ++EELVDVL++ D++ + IKA +LRTLT+I+H  +      ++ + TG  SYHG  P ++R  I  ++     PY       + TA+ SFLYHLA  +         LV  G+++++ ++I +   E D I+F TRAVRV D I     L+ ++    S +   + RL+ E+ +C       +  +I +   T++   + T         QR   +KSMLN +K+ I D  +S+ ++  MDG LP  L+ I  N    + P L L + EV+T FV+  PS +S++Q+  LT  +L  L  + +P  R+ L +LP + SAL +N RG+    + +  ++  K L    ++ AMR +R
Sbjct:    1 MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDRFDGILADAGQTVENMSWMLVCDRPEREQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLAECCRDLHMMKYPPSATTLHFEFYAD------PGAE----------VKIEKRTTSNTLHYIHIEQLDKISESPSEIMESLTKMYSIPK-DKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSII-DCTGTASYHGFLPVLVRNCIQAMIDPSMDPYP----HQFATALFSFLYHLASYDAGGEA----LVSCGMMEALLKVIKFLGDEQDQITFVTRAVRVVDLIT---NLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQRPNTTQEGEEMETDMDGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISN-AEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRR 647          

HSP 3 Score: 77.0258 bits (188), Expect = 1.142e-12
Identity = 81/300 (27.00%), Postives = 139/300 (46.33%), Query Frame = 3
Query: 8454 IAEGIDPTFLEALPQSMRREVIIEH-------RRA---NRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETA-NAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLL------SVTGRRRARQLTSGLSDLLSQMNRG-RWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKIS 9299
            + EG+DP+FL ALP  +RREV+          R A   N     + G      V  E +A LP  IQEE+LA  R E    E A NA              SS T +   +F+ +L   LRR +L DM+ S +A +  ++A EA+ +R+E    Q + +   L       +++   R+   TS LS      NRG ++ +  ++     + G ++ HN  + ++  T           + L+  + L+ L+ LL          K+ ++ ++++L++L  H Q R W+  ++++IL + S
Sbjct: 2964 LPEGVDPSFLAALPDDIRREVLQNQLGIRPPTRTAPSTNSSAPAVVGNPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQNA--------------SSDTPMDPVTFIQTLPSDLRRSVLEDMEDSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHSSTSALSAILRSPAFTSRLSG-----NRGVQYTRLAVQRGGTFQMGGSSSHNRPSGSNVDTLL-----RLRGRLLLDHEALSCLLVLLFVDEP-----KLNTSRLHRVLRNLCYHAQTRHWVIRSLLSILQRSS 3234          

HSP 4 Score: 67.3958 bits (163), Expect = 9.660e-10
Identity = 78/303 (25.74%), Postives = 123/303 (40.59%), Query Frame = 3
Query: 4794 LVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVI-YEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIML----LP--------------------SKSKDQRKFENL---------SEYEHKIISCVPDPLGDEEVVELSDNMLQFLI--SIKKIDNVYKWDCLQAACYLLIRLC--DKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGA 5588
            L+K+  ++     A   Q E       K IT + L+ID YE+TA + + R  +  Y       W W DDR G W   S  +N+ I+ ++++G+            Y   F ++ Q NEE+   RP+ML    +P                    SK  D ++ EN          S    K  S     +G+  +  L+++M+  LI   +  +      D L A   L +RL    KY++    L + +  I  L       G+T  LVT    LLR   E P  L+HT+  ++    + GA
Sbjct: 1557 LIKLLEVVQPCLQAAKEQKEV---QTPKWITPVLLLIDFYEKTAISSKRRAQMTKYLQSNSNNWRWFDDRSGRWCSYSASNNSTIDSAWKSGETSVRFT-AGRRRYTVQFTTMVQVNEETGNRRPVMLTLLRVPRLNKNSKNSNGQELEKTLEESKEMDIKRKENKGNDTPLALESTNTEKETSLEETKIGEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYAMMFAELKSTR-MILNLTQSSGFNGFT-PLVTL---LLRHIIEDPCTLRHTMEKVVRSAATSGA 1850          

HSP 5 Score: 58.5362 bits (140), Expect = 4.822e-7
Identity = 31/92 (33.70%), Postives = 56/92 (60.87%), Query Frame = 3
Query: 2511 KDNKTEEMNQFSCDDD--AVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWA 2780
            + N+TE   Q    ++   + LMDYI NV KF+E  +S+   +    Q+  +++GL  ++ IL +P+LP DFP+S ACQ++  + + +L+ +
Sbjct:  745 QQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESILSNNTTDDHC-QEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLS 835          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Human
Match: HUWE1 (HECT, UBA and WWE domain containing E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:30892])

HSP 1 Score: 593.578 bits (1529), Expect = 4.863e-169
Identity = 297/532 (55.83%), Postives = 370/532 (69.55%), Query Frame = 3
Query: 10662 ILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHS----------DCSEIHEEHNKSDNSNVSD-PLSHLNTSLVVDDTFMNSPAFSENGKHNP-----FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            +L++  S   +W +L + L  +++S +  AV+V Q  VE+F L H+          D  E    H K +   +S  PL+    S  +D  F   P+        P     FL F E H+ VLN ILR+ T    D   F+ L+ Y ++LDFD+KR+YF+ ++ +L  D   R E+  V V R  +FEDSY  LHRK+ EE K R  I F  EEGQD GGLLREWY+ +S E+FNP YALF+ SP D VTYTINP+S+ N NHLSYFKFVGR +AKA++DN+LL CYFTR+FYKHILG S+RYTD+E EDY F++GL +LL+NDVST+  D TFS ++ EFG  E RDL PNG+ ILVTEENK EYV LVCQ +MTGAIR+QL +FLEGFYEIIPK LISIF E+ELELLI GLP ID++DLK NT Y+KY   S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF+ LEGMNG  KFQI     ST+ LP+AHTCFN +DLP YE+F+KL   LL AI+ECSEG+G+
Sbjct: 3846 LLSEQLSLDELWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPVRDTRESQLAHIKDEPPPLSPAPLTPATPS-SLDPFFSREPSSMHISSSLPPDTQKFLRFAETHRTVLNQILRQSTTHLAD-GPFAVLVDYIRVLDFDVKRKYFRQELERL--DEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGL 4373          

HSP 2 Score: 385.956 bits (990), Expect = 4.809e-106
Identity = 236/677 (34.86%), Postives = 364/677 (53.77%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGH--WTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYM---PYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQ-----PESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKC---LSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKIC-------LDSEIDQ--MTKKSVALNT---------QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            MK+DR K+         +C  L  +L    +  L+ E+++I  W+ GKCEL  W D+LDR D ILA+    V +  W L  D+P  E L   ++A+L FT  LIE+S  R+LY S EH+  L  +S+M ++ A+L L Y FSKRSNY +RL S  R  +L RL  +AE+WGGK++GFGLAECC   +M   P SA T+ +EF  D       G E          +K +      TL  +H++      ESPSE+ME+L + Y++     QM LF  +RL   F    +R   +  R+ A+SIL Y+N +++     L   ++EELVDVL++ D++ + IKA +LRTLT+I+H  +      ++ + TG  SYHG  P ++R  I  ++     PY       + TA+ SFLYHLA  +         LV  G+++++ ++I +   E D I+F TRAVRV D I     L+ ++    S +   + RL+ E+ +C       +  +I +   T++   + T         QR   +KSMLN +K+ I D  +S+ ++  MDG LP  L+ I  N    + P L L + EV+T FV+  PS +S++Q+  LT  +L  L  + +P  R+ L +LP + SAL +N RG+    + +  ++  K L    ++ AMR +R
Sbjct:    1 MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDRFDGILADAGQTVENMSWMLVCDRPEREQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLAECCRDLHMMKYPPSATTLHFEFYAD------PGAE----------VKIEKRTTSNTLHYIHIEQLDKISESPSEIMESLTKMYSIPK-DKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSII-DCTGTASYHGFLPVLVRNCIQAMIDPSMDPYP----HQFATALFSFLYHLASYDAGGEA----LVSCGMMEALLKVIKFLGDEQDQITFVTRAVRVVDLIT---NLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQRPNTTQEGEEMETDMDGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISN-AEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRR 647          

HSP 3 Score: 77.0258 bits (188), Expect = 1.142e-12
Identity = 81/300 (27.00%), Postives = 139/300 (46.33%), Query Frame = 3
Query: 8454 IAEGIDPTFLEALPQSMRREVIIEH-------RRA---NRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETA-NAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLL------SVTGRRRARQLTSGLSDLLSQMNRG-RWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKIS 9299
            + EG+DP+FL ALP  +RREV+          R A   N     + G      V  E +A LP  IQEE+LA  R E    E A NA              SS T +   +F+ +L   LRR +L DM+ S +A +  ++A EA+ +R+E    Q + +   L       +++   R+   TS LS      NRG ++ +  ++     + G ++ HN  + ++  T           + L+  + L+ L+ LL          K+ ++ ++++L++L  H Q R W+  ++++IL + S
Sbjct: 2964 LPEGVDPSFLAALPDDIRREVLQNQLGIRPPTRTAPSTNSSAPAVVGNPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQNA--------------SSDTPMDPVTFIQTLPSDLRRSVLEDMEDSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHSSTSALSAILRSPAFTSRLSG-----NRGVQYTRLAVQRGGTFQMGGSSSHNRPSGSNVDTLL-----RLRGRLLLDHEALSCLLVLLFVDEP-----KLNTSRLHRVLRNLCYHAQTRHWVIRSLLSILQRSS 3234          

HSP 4 Score: 67.3958 bits (163), Expect = 9.660e-10
Identity = 78/303 (25.74%), Postives = 123/303 (40.59%), Query Frame = 3
Query: 4794 LVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVI-YEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIML----LP--------------------SKSKDQRKFENL---------SEYEHKIISCVPDPLGDEEVVELSDNMLQFLI--SIKKIDNVYKWDCLQAACYLLIRLC--DKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGA 5588
            L+K+  ++     A   Q E       K IT + L+ID YE+TA + + R  +  Y       W W DDR G W   S  +N+ I+ ++++G+            Y   F ++ Q NEE+   RP+ML    +P                    SK  D ++ EN          S    K  S     +G+  +  L+++M+  LI   +  +      D L A   L +RL    KY++    L + +  I  L       G+T  LVT    LLR   E P  L+HT+  ++    + GA
Sbjct: 1557 LIKLLEVVQPCLQAAKEQKEV---QTPKWITPVLLLIDFYEKTAISSKRRAQMTKYLQSNSNNWRWFDDRSGRWCSYSASNNSTIDSAWKSGETSVRFT-AGRRRYTVQFTTMVQVNEETGNRRPVMLTLLRVPRLNKNSKNSNGQELEKTLEESKEMDIKRKENKGNDTPLALESTNTEKETSLEETKIGEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYAMMFAELKSTR-MILNLTQSSGFNGFT-PLVTL---LLRHIIEDPCTLRHTMEKVVRSAATSGA 1850          

HSP 5 Score: 58.5362 bits (140), Expect = 4.822e-7
Identity = 31/92 (33.70%), Postives = 56/92 (60.87%), Query Frame = 3
Query: 2511 KDNKTEEMNQFSCDDD--AVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWA 2780
            + N+TE   Q    ++   + LMDYI NV KF+E  +S+   +    Q+  +++GL  ++ IL +P+LP DFP+S ACQ++  + + +L+ +
Sbjct:  745 QQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESILSNNTTDDHC-QEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLS 835          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Human
Match: HUWE1 (HECT, UBA and WWE domain containing E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:30892])

HSP 1 Score: 593.193 bits (1528), Expect = 5.981e-169
Identity = 297/532 (55.83%), Postives = 370/532 (69.55%), Query Frame = 3
Query: 10662 ILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHS----------DCSEIHEEHNKSDNSNVSD-PLSHLNTSLVVDDTFMNSPAFSENGKHNP-----FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            +L++  S   +W +L + L  +++S +  AV+V Q  VE+F L H+          D  E    H K +   +S  PL+    S  +D  F   P+        P     FL F E H+ VLN ILR+ T    D   F+ L+ Y ++LDFD+KR+YF+ ++ +L  D   R E+  V V R  +FEDSY  LHRK+ EE K R  I F  EEGQD GGLLREWY+ +S E+FNP YALF+ SP D VTYTINP+S+ N NHLSYFKFVGR +AKA++DN+LL CYFTR+FYKHILG S+RYTD+E EDY F++GL +LL+NDVST+  D TFS ++ EFG  E RDL PNG+ ILVTEENK EYV LVCQ +MTGAIR+QL +FLEGFYEIIPK LISIF E+ELELLI GLP ID++DLK NT Y+KY   S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF+ LEGMNG  KFQI     ST+ LP+AHTCFN +DLP YE+F+KL   LL AI+ECSEG+G+
Sbjct: 3837 LLSEQLSLDELWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPVRDTRESQLAHIKDEPPPLSPAPLTPATPS-SLDPFFSREPSSMHISSSLPPDTQKFLRFAETHRTVLNQILRQSTTHLAD-GPFAVLVDYIRVLDFDVKRKYFRQELERL--DEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGL 4364          

HSP 2 Score: 385.956 bits (990), Expect = 4.306e-106
Identity = 236/677 (34.86%), Postives = 364/677 (53.77%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGH--WTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYM---PYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQ-----PESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKC---LSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKIC-------LDSEIDQ--MTKKSVALNT---------QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            MK+DR K+         +C  L  +L    +  L+ E+++I  W+ GKCEL  W D+LDR D ILA+    V +  W L  D+P  E L   ++A+L FT  LIE+S  R+LY S EH+  L  +S+M ++ A+L L Y FSKRSNY +RL S  R  +L RL  +AE+WGGK++GFGLAECC   +M   P SA T+ +EF  D       G E          +K +      TL  +H++      ESPSE+ME+L + Y++     QM LF  +RL   F    +R   +  R+ A+SIL Y+N +++     L   ++EELVDVL++ D++ + IKA +LRTLT+I+H  +      ++ + TG  SYHG  P ++R  I  ++     PY       + TA+ SFLYHLA  +         LV  G+++++ ++I +   E D I+F TRAVRV D I     L+ ++    S +   + RL+ E+ +C       +  +I +   T++   + T         QR   +KSMLN +K+ I D  +S+ ++  MDG LP  L+ I  N    + P L L + EV+T FV+  PS +S++Q+  LT  +L  L  + +P  R+ L +LP + SAL +N RG+    + +  ++  K L    ++ AMR +R
Sbjct:    1 MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDRFDGILADAGQTVENMSWMLVCDRPEREQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLAECCRDLHMMKYPPSATTLHFEFYAD------PGAE----------VKIEKRTTSNTLHYIHIEQLDKISESPSEIMESLTKMYSIPK-DKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSII-DCTGTASYHGFLPVLVRNCIQAMIDPSMDPYP----HQFATALFSFLYHLASYDAGGEA----LVSCGMMEALLKVIKFLGDEQDQITFVTRAVRVVDLIT---NLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQRPNTTQEGEEMETDMDGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISN-AEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRR 647          

HSP 3 Score: 76.6406 bits (187), Expect = 1.338e-12
Identity = 81/300 (27.00%), Postives = 139/300 (46.33%), Query Frame = 3
Query: 8454 IAEGIDPTFLEALPQSMRREVIIEH-------RRA---NRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETA-NAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLL------SVTGRRRARQLTSGLSDLLSQMNRG-RWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKIS 9299
            + EG+DP+FL ALP  +RREV+          R A   N     + G      V  E +A LP  IQEE+LA  R E    E A NA              SS T +   +F+ +L   LRR +L DM+ S +A +  ++A EA+ +R+E    Q + +   L       +++   R+   TS LS      NRG ++ +  ++     + G ++ HN  + ++  T           + L+  + L+ L+ LL          K+ ++ ++++L++L  H Q R W+  ++++IL + S
Sbjct: 2955 LPEGVDPSFLAALPDDIRREVLQNQLGIRPPTRTAPSTNSSAPAVVGNPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQNA--------------SSDTPMDPVTFIQTLPSDLRRSVLEDMEDSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHSSTSALSAILRSPAFTSRLSG-----NRGVQYTRLAVQRGGTFQMGGSSSHNRPSGSNVDTLL-----RLRGRLLLDHEALSCLLVLLFVDEP-----KLNTSRLHRVLRNLCYHAQTRHWVIRSLLSILQRSS 3225          

HSP 4 Score: 67.3958 bits (163), Expect = 9.740e-10
Identity = 78/303 (25.74%), Postives = 123/303 (40.59%), Query Frame = 3
Query: 4794 LVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVI-YEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIML----LP--------------------SKSKDQRKFENL---------SEYEHKIISCVPDPLGDEEVVELSDNMLQFLI--SIKKIDNVYKWDCLQAACYLLIRLC--DKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGA 5588
            L+K+  ++     A   Q E       K IT + L+ID YE+TA + + R  +  Y       W W DDR G W   S  +N+ I+ ++++G+            Y   F ++ Q NEE+   RP+ML    +P                    SK  D ++ EN          S    K  S     +G+  +  L+++M+  LI   +  +      D L A   L +RL    KY++    L + +  I  L       G+T  LVT    LLR   E P  L+HT+  ++    + GA
Sbjct: 1548 LIKLLEVVQPCLQAAKEQKEV---QTPKWITPVLLLIDFYEKTAISSKRRAQMTKYLQSNSNNWRWFDDRSGRWCSYSASNNSTIDSAWKSGETSVRFT-AGRRRYTVQFTTMVQVNEETGNRRPVMLTLLRVPRLNKNSKNSNGQELEKTLEESKEMDIKRKENKGNDTPLALESTNTEKETSLEETKIGEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYAMMFAELKSTR-MILNLTQSSGFNGFT-PLVTL---LLRHIIEDPCTLRHTMEKVVRSAATSGA 1841          

HSP 5 Score: 58.151 bits (139), Expect = 4.862e-7
Identity = 31/92 (33.70%), Postives = 56/92 (60.87%), Query Frame = 3
Query: 2511 KDNKTEEMNQFSCDDD--AVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWA 2780
            + N+TE   Q    ++   + LMDYI NV KF+E  +S+   +    Q+  +++GL  ++ IL +P+LP DFP+S ACQ++  + + +L+ +
Sbjct:  745 QQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESILSNNTTDDHC-QEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLS 835          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Human
Match: ITCH (itchy E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:13890])

HSP 1 Score: 332.028 bits (850), Expect = 4.238e-96
Identity = 170/418 (40.67%), Postives = 253/418 (60.53%), Query Frame = 3
Query: 10953 FVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFK-VSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            FV+ +++   +I  R    ALD     A ++     DF  K +YF+    QL     +  +   + V+R  LFEDS+ ++   + ++ ++R  + F  EEG D GG+ REW+  +SHE+ NP Y LF+    D     INPASY+N +HL YF+F+GRFIA A+F  K +   F+  FYK IL   +   DLE  D +F+  L ++ +N++    L+  FS+     G+ ++ DL PNG  ILVTEENK EY+R+V + +++  + +Q  +F EGF EI+P+  +  F+ KELE+L+CG+ EIDLND + + +Y  Y   S QI WFWQ ++  D E R R +QFVTGT ++P+GGF+ L G NGP KF I       N LP +HTCFN +DLP Y+++++L + LL AI E +EG+G
Sbjct:  345 FVDHNRRTTTYIDPRTGKSALDNGPQIAYVR-----DFKAKVQYFRFWCQQL-----AMPQHIKITVTRKTLFEDSFQQIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECDLEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYARTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVG-KENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEE-TEGFG 750          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Celegans
Match: eel-1 (Enhancer of EfL-1 mutant phenotype [Source:UniProtKB/TrEMBL;Acc:U4PBK1])

HSP 1 Score: 534.643 bits (1376), Expect = 1.260e-151
Identity = 266/521 (51.06%), Postives = 353/521 (67.75%), Query Frame = 3
Query: 10662 ILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHN--PFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLR--NDGDSRYEEE--LVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            I  +  S  S+W+ LS+ L  + K+ +P AV+  Q   E+F L H+  S+ ++   K   +   +  +  +++     + ++     E+   +    +EF EKH++VLN  LR+  A       F+ L ++PKLLDFD+KR+YF+ ++ +L   N    RY      VQVSR R+F DS+  L R    EWK RF I F  EEGQD GGLLREW+  ++ EIFNPNYALF  +P D VTY IN ASY+N  HL YFKFVGR IAK++F++K L CYFTRAFYKHIL + +RY DLE ED  FF+ L+FLL+N +  + LD TFS ++ EFG    RDL PNG +I V + NK EYV+LVCQ KMTG+IR+QL +FL GFYEIIPK+LIS+FNE+ELELLI GLP +D++D+  NT Y  +   S  IQWFW+AL SF++ED+A+F+QFVTGTSKVPL GF+ LEGMNG  KF I + S   + LPAAHTCFN +DLPQYE+++KL + LL AIREC+EG+G
Sbjct: 3662 ISERLSSLESLWNSLSECLLRLGKASDPHAVLALQPAAEAFFLVHA--SQQNKLKAKDAEAKRKESQAASSSAAAAVASSVSHDGLREDLDPDTAKLIEFAEKHRQVLNQALRQNNAVLSAGGPFAILTQFPKLLDFDVKRKYFRKELTKLEPSNSRMPRYRRNDVSVQVSRNRVFSDSFRELFRLRPSEWKNRFYIIFQGEEGQDAGGLLREWFSVITREIFNPNYALFITAPGDMVTYMINKASYINPEHLDYFKFVGRLIAKSVFEHKYLDCYFTRAFYKHILNLPVRYQDLESEDPAFFKSLDFLLQNPIDDLALDLTFSTEVEEFGVRSVRDLKPNGRKIEVNDANKDEYVKLVCQMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPTVDIDDMAANTDYKGFQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLEGMNGVQKFSIHMDSRGGDRLPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGFG 4180          

HSP 2 Score: 134.035 bits (336), Expect = 2.247e-30
Identity = 137/492 (27.85%), Postives = 219/492 (44.51%), Query Frame = 3
Query:   96 LAALGENDLINEIKKINVWH--YGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFS-RLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTE-YMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMA-----------LFARLRLCVYFGKPEQRKLLIYTRMQALSILCY-----TNEVEDKCLSWD-IVEELVDVLKLPDRE---------FLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKF----QPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKIC 1469
            +A   + D I  I K    H   GK EL  W +VL+R D IL + V K     L+ D   +  L    +AI+ FT  L E +  R +Y S + ILAL  +++MD+L  +L L     KRS + S R+    +  + +RL +IA+ WGGK     +AEC   E  +P     M + F             D+ Q ++ +  +PK  +            ES  EL+   + + +   +SD +            L +R+R+ V F     R   +  R+ ++S L Y     T+E     L +   +EE+V++LK  DRE            I+  AL TL +I+   K      +L+ ++   SYHG    M R+ + +L  +      +P  S       TA+ SF+YHLA       T    LVG+GL  ++  +I +H    + I+F TR  R+ D   L   ++ +S    + ++  V+R+  EI  C
Sbjct:   29 VATKNDEDFIAAINKGREVHAVMGKTELYKWTEVLNRCDEILEKAVHKNEFGNLQCDH--DTVLKNHAVAIVRFTVLLFECTSSRRIYKSVDRILALLESTDMDLLAEVLRLLQVMGKRSKFLSTRIPQKEQHALAQRLTAIAQCWGGKLRTVKMAECLKREPKLP-----MLFPFTYT----------DAKQRTI-IVEQPKFQKD-----------ESVGELITRTVAQISPPVSSDSVPSQQFSKEDLYCLLSRVRMLVTFEDWHHRFKCLIVRLLSVSTLVYCRLGGTDETTLSSLLYSGFIEEIVEMLK-SDREADTQQDHNLHDAIQTEALSTLCSIVTYEKEPKITQILEALSA-GSYHGFLSVMTRQIVDELKSNNLGKTGKPSVS-----LATALFSFIYHLASIEPGGDT----LVGSGLTQTLLSVIGFHELPIECITFGTRCARIID---LFTTIDVTSFKANNGMEICVNRVVHEINEC 477          

HSP 3 Score: 93.5893 bits (231), Expect = 4.468e-18
Identity = 49/151 (32.45%), Postives = 84/151 (55.63%), Query Frame = 3
Query: 1521 QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMM 1973
            QR G IK +L  IKR I D ++ + +K  M+G+LP+ L  I  N    ++P L   S  +ITNFVY  P  +S++Q R +   I ++L  + LP ++D + TL  + +A+ +N RG+ + K     ++  + +   +F+  +R KR  E+ 
Sbjct:  576 QRSGLIKGLLTFIKRAIGDVQFQDIMKHLMEGDLPEALMHILSN-AEYYSPSLFHQSAHLITNFVYQFPEELSSIQRRHVPYVIFQSLLRKELPNSKDVITTLGNVFTAMCLNERGLRQFKSYDPFNQIFRIVLSVKFLVTLRKKRSAEVF 725          

HSP 4 Score: 60.077 bits (144), Expect = 6.113e-8
Identity = 51/183 (27.87%), Postives = 81/183 (44.26%), Query Frame = 3
Query: 8451 LIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQ------------------------QLTG---------IQLPENVDAEIMAQLPAHIQEEILA-HYRRENSTSET---ANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQM 8888
            +I +G+DP FL ALP+ MR EVI +++R  R  +                        Q  G         + L E +D   +  LP  +QEE+LA H RR     E     NAP          P++      V    + SL  + R ++LA+MD +++A L +++ +EAR+ R +  +  M
Sbjct: 2975 IIPDGVDPAFLAALPEEMRAEVIRDYQRQQRAERASRPVPAAQPVAVNPNAPAGGEAAQGEGQAEQPAAAVVPLVEPIDPVFLNALPPELQEEVLAEHERRLREAEEQQRRQNAP--------PAPVVEMDGAAV----IASLPANERAQVLAEMDDAELAGLPADMQNEARRARAQHVEPNM 3145          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Celegans
Match: eel-1 (Enhancer of EfL-1 mutant phenotype [Source:UniProtKB/TrEMBL;Acc:U4PBK1])

HSP 1 Score: 534.643 bits (1376), Expect = 1.262e-151
Identity = 266/521 (51.06%), Postives = 353/521 (67.75%), Query Frame = 3
Query: 10662 ILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHN--PFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLR--NDGDSRYEEE--LVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            I  +  S  S+W+ LS+ L  + K+ +P AV+  Q   E+F L H+  S+ ++   K   +   +  +  +++     + ++     E+   +    +EF EKH++VLN  LR+  A       F+ L ++PKLLDFD+KR+YF+ ++ +L   N    RY      VQVSR R+F DS+  L R    EWK RF I F  EEGQD GGLLREW+  ++ EIFNPNYALF  +P D VTY IN ASY+N  HL YFKFVGR IAK++F++K L CYFTRAFYKHIL + +RY DLE ED  FF+ L+FLL+N +  + LD TFS ++ EFG    RDL PNG +I V + NK EYV+LVCQ KMTG+IR+QL +FL GFYEIIPK+LIS+FNE+ELELLI GLP +D++D+  NT Y  +   S  IQWFW+AL SF++ED+A+F+QFVTGTSKVPL GF+ LEGMNG  KF I + S   + LPAAHTCFN +DLPQYE+++KL + LL AIREC+EG+G
Sbjct: 3665 ISERLSSLESLWNSLSECLLRLGKASDPHAVLALQPAAEAFFLVHA--SQQNKLKAKDAEAKRKESQAASSSAAAAVASSVSHDGLREDLDPDTAKLIEFAEKHRQVLNQALRQNNAVLSAGGPFAILTQFPKLLDFDVKRKYFRKELTKLEPSNSRMPRYRRNDVSVQVSRNRVFSDSFRELFRLRPSEWKNRFYIIFQGEEGQDAGGLLREWFSVITREIFNPNYALFITAPGDMVTYMINKASYINPEHLDYFKFVGRLIAKSVFEHKYLDCYFTRAFYKHILNLPVRYQDLESEDPAFFKSLDFLLQNPIDDLALDLTFSTEVEEFGVRSVRDLKPNGRKIEVNDANKDEYVKLVCQMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPTVDIDDMAANTDYKGFQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLEGMNGVQKFSIHMDSRGGDRLPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGFG 4183          

HSP 2 Score: 134.42 bits (337), Expect = 2.084e-30
Identity = 137/492 (27.85%), Postives = 219/492 (44.51%), Query Frame = 3
Query:   96 LAALGENDLINEIKKINVWH--YGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFS-RLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTE-YMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMA-----------LFARLRLCVYFGKPEQRKLLIYTRMQALSILCY-----TNEVEDKCLSWD-IVEELVDVLKLPDRE---------FLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKF----QPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKIC 1469
            +A   + D I  I K    H   GK EL  W +VL+R D IL + V K     L+ D   +  L    +AI+ FT  L E +  R +Y S + ILAL  +++MD+L  +L L     KRS + S R+    +  + +RL +IA+ WGGK     +AEC   E  +P     M + F             D+ Q ++ +  +PK  +            ES  EL+   + + +   +SD +            L +R+R+ V F     R   +  R+ ++S L Y     T+E     L +   +EE+V++LK  DRE            I+  AL TL +I+   K      +L+ ++   SYHG    M R+ + +L  +      +P  S       TA+ SF+YHLA       T    LVG+GL  ++  +I +H    + I+F TR  R+ D   L   ++ +S    + ++  V+R+  EI  C
Sbjct:   29 VATKNDEDFIAAINKGREVHAVMGKTELYKWTEVLNRCDEILEKAVHKNEFGNLQCDH--DTVLKNHAVAIVRFTVLLFECTSSRRIYKSVDRILALLESTDMDLLAEVLRLLQVMGKRSKFLSTRIPQKEQHALAQRLTAIAQCWGGKLRTVKMAECLKREPKLP-----MLFPFTYT----------DAKQRTI-IVEQPKFQKD-----------ESVGELITRTVAQISPPVSSDSVPSQQFSKEDLYCLLSRVRMLVTFEDWHHRFKCLIVRLLSVSTLVYCRLGGTDETTLSSLLYSGFIEEIVEMLK-SDREADTQQDHNLHDAIQTEALSTLCSIVTYEKEPKITQILEALSA-GSYHGFLSVMTRQIVDELKSNNLGKTGKPSVS-----LATALFSFIYHLASIEPGGDT----LVGSGLTQTLLSVIGFHELPIECITFGTRCARIID---LFTTIDVTSFKANNGMEICVNRVVHEINEC 477          

HSP 3 Score: 93.5893 bits (231), Expect = 4.358e-18
Identity = 49/151 (32.45%), Postives = 84/151 (55.63%), Query Frame = 3
Query: 1521 QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMM 1973
            QR G IK +L  IKR I D ++ + +K  M+G+LP+ L  I  N    ++P L   S  +ITNFVY  P  +S++Q R +   I ++L  + LP ++D + TL  + +A+ +N RG+ + K     ++  + +   +F+  +R KR  E+ 
Sbjct:  576 QRSGLIKGLLTFIKRAIGDVQFQDIMKHLMEGDLPEALMHILSN-AEYYSPSLFHQSAHLITNFVYQFPEELSSIQRRHVPYVIFQSLLRKELPNSKDVITTLGNVFTAMCLNERGLRQFKSYDPFNQIFRIVLSVKFLVTLRKKRSAEVF 725          

HSP 4 Score: 60.077 bits (144), Expect = 6.113e-8
Identity = 51/183 (27.87%), Postives = 81/183 (44.26%), Query Frame = 3
Query: 8451 LIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQ------------------------QLTG---------IQLPENVDAEIMAQLPAHIQEEILA-HYRRENSTSET---ANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQM 8888
            +I +G+DP FL ALP+ MR EVI +++R  R  +                        Q  G         + L E +D   +  LP  +QEE+LA H RR     E     NAP          P++      V    + SL  + R ++LA+MD +++A L +++ +EAR+ R +  +  M
Sbjct: 2978 IIPDGVDPAFLAALPEEMRAEVIRDYQRQQRAERASRPVPAAQPVAVNPNAPAGGEAAQGEGQAEQPAAAVVPLVEPIDPVFLNALPPELQEEVLAEHERRLREAEEQQRRQNAP--------PAPVVEMDGAAV----IASLPANERAQVLAEMDDAELAGLPADMQNEARRARAQHVEPNM 3148          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Celegans
Match: eel-1 (Enhancer of EfL-1 mutant phenotype [Source:UniProtKB/TrEMBL;Acc:U4PBK1])

HSP 1 Score: 534.643 bits (1376), Expect = 1.282e-151
Identity = 266/521 (51.06%), Postives = 353/521 (67.75%), Query Frame = 3
Query: 10662 ILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHN--PFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLR--NDGDSRYEEE--LVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            I  +  S  S+W+ LS+ L  + K+ +P AV+  Q   E+F L H+  S+ ++   K   +   +  +  +++     + ++     E+   +    +EF EKH++VLN  LR+  A       F+ L ++PKLLDFD+KR+YF+ ++ +L   N    RY      VQVSR R+F DS+  L R    EWK RF I F  EEGQD GGLLREW+  ++ EIFNPNYALF  +P D VTY IN ASY+N  HL YFKFVGR IAK++F++K L CYFTRAFYKHIL + +RY DLE ED  FF+ L+FLL+N +  + LD TFS ++ EFG    RDL PNG +I V + NK EYV+LVCQ KMTG+IR+QL +FL GFYEIIPK+LIS+FNE+ELELLI GLP +D++D+  NT Y  +   S  IQWFW+AL SF++ED+A+F+QFVTGTSKVPL GF+ LEGMNG  KF I + S   + LPAAHTCFN +DLPQYE+++KL + LL AIREC+EG+G
Sbjct: 3663 ISERLSSLESLWNSLSECLLRLGKASDPHAVLALQPAAEAFFLVHA--SQQNKLKAKDAEAKRKESQAASSSAAAAVASSVSHDGLREDLDPDTAKLIEFAEKHRQVLNQALRQNNAVLSAGGPFAILTQFPKLLDFDVKRKYFRKELTKLEPSNSRMPRYRRNDVSVQVSRNRVFSDSFRELFRLRPSEWKNRFYIIFQGEEGQDAGGLLREWFSVITREIFNPNYALFITAPGDMVTYMINKASYINPEHLDYFKFVGRLIAKSVFEHKYLDCYFTRAFYKHILNLPVRYQDLESEDPAFFKSLDFLLQNPIDDLALDLTFSTEVEEFGVRSVRDLKPNGRKIEVNDANKDEYVKLVCQMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPTVDIDDMAANTDYKGFQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLEGMNGVQKFSIHMDSRGGDRLPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGFG 4181          

HSP 2 Score: 133.265 bits (334), Expect = 3.938e-30
Identity = 137/492 (27.85%), Postives = 219/492 (44.51%), Query Frame = 3
Query:   96 LAALGENDLINEIKKINVWH--YGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFS-RLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTE-YMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMA-----------LFARLRLCVYFGKPEQRKLLIYTRMQALSILCY-----TNEVEDKCLSWD-IVEELVDVLKLPDRE---------FLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKF----QPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKIC 1469
            +A   + D I  I K    H   GK EL  W +VL+R D IL + V K     L+ D   +  L    +AI+ FT  L E +  R +Y S + ILAL  +++MD+L  +L L     KRS + S R+    +  + +RL +IA+ WGGK     +AEC   E  +P     M + F             D+ Q ++ +  +PK             + ES  EL+   + + +   +SD +            L +R+R+ V F     R   +  R+ ++S L Y     T+E     L +   +EE+V++LK  DRE            I+  AL TL +I+   K      +L+ ++   SYHG    M R+ + +L  +      +P  S       TA+ SF+YHLA       T    LVG+GL  ++  +I +H    + I+F TR  R+ D   L   ++ +S    + ++  V+R+  EI  C
Sbjct:   29 VATKNDEDFIAAINKGREVHAVMGKTELYKWTEVLNRCDEILEKAVHKNEFGNLQCDH--DTVLKNHAVAIVRFTVLLFECTSSRRIYKSVDRILALLESTDMDLLAEVLRLLQVMGKRSKFLSTRIPQKEQHALAQRLTAIAQCWGGKLRTVKMAECLKREPKLP-----MLFPFTYT----------DAKQRTI-IVEQPK-------------KDESVGELITRTVAQISPPVSSDSVPSQQFSKEDLYCLLSRVRMLVTFEDWHHRFKCLIVRLLSVSTLVYCRLGGTDETTLSSLLYSGFIEEIVEMLK-SDREADTQQDHNLHDAIQTEALSTLCSIVTYEKEPKITQILEALSA-GSYHGFLSVMTRQIVDELKSNNLGKTGKPSVS-----LATALFSFIYHLASIEPGGDT----LVGSGLTQTLLSVIGFHELPIECITFGTRCARIID---LFTTIDVTSFKANNGMEICVNRVVHEINEC 475          

HSP 3 Score: 93.5893 bits (231), Expect = 4.544e-18
Identity = 49/151 (32.45%), Postives = 84/151 (55.63%), Query Frame = 3
Query: 1521 QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMM 1973
            QR G IK +L  IKR I D ++ + +K  M+G+LP+ L  I  N    ++P L   S  +ITNFVY  P  +S++Q R +   I ++L  + LP ++D + TL  + +A+ +N RG+ + K     ++  + +   +F+  +R KR  E+ 
Sbjct:  574 QRSGLIKGLLTFIKRAIGDVQFQDIMKHLMEGDLPEALMHILSN-AEYYSPSLFHQSAHLITNFVYQFPEELSSIQRRHVPYVIFQSLLRKELPNSKDVITTLGNVFTAMCLNERGLRQFKSYDPFNQIFRIVLSVKFLVTLRKKRSAEVF 723          

HSP 4 Score: 60.077 bits (144), Expect = 5.961e-8
Identity = 51/183 (27.87%), Postives = 81/183 (44.26%), Query Frame = 3
Query: 8451 LIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQ------------------------QLTG---------IQLPENVDAEIMAQLPAHIQEEILA-HYRRENSTSET---ANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQM 8888
            +I +G+DP FL ALP+ MR EVI +++R  R  +                        Q  G         + L E +D   +  LP  +QEE+LA H RR     E     NAP          P++      V    + SL  + R ++LA+MD +++A L +++ +EAR+ R +  +  M
Sbjct: 2976 IIPDGVDPAFLAALPEEMRAEVIRDYQRQQRAERASRPVPAAQPVAVNPNAPAGGEAAQGEGQAEQPAAAVVPLVEPIDPVFLNALPPELQEEVLAEHERRLREAEEQQRRQNAP--------PAPVVEMDGAAV----IASLPANERAQVLAEMDDAELAGLPADMQNEARRARAQHVEPNM 3146          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Celegans
Match: eel-1 (Enhancer of EfL-1 mutant phenotype [Source:UniProtKB/TrEMBL;Acc:U4PBK1])

HSP 1 Score: 534.643 bits (1376), Expect = 1.302e-151
Identity = 266/521 (51.06%), Postives = 353/521 (67.75%), Query Frame = 3
Query: 10662 ILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHN--PFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLR--NDGDSRYEEE--LVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            I  +  S  S+W+ LS+ L  + K+ +P AV+  Q   E+F L H+  S+ ++   K   +   +  +  +++     + ++     E+   +    +EF EKH++VLN  LR+  A       F+ L ++PKLLDFD+KR+YF+ ++ +L   N    RY      VQVSR R+F DS+  L R    EWK RF I F  EEGQD GGLLREW+  ++ EIFNPNYALF  +P D VTY IN ASY+N  HL YFKFVGR IAK++F++K L CYFTRAFYKHIL + +RY DLE ED  FF+ L+FLL+N +  + LD TFS ++ EFG    RDL PNG +I V + NK EYV+LVCQ KMTG+IR+QL +FL GFYEIIPK+LIS+FNE+ELELLI GLP +D++D+  NT Y  +   S  IQWFW+AL SF++ED+A+F+QFVTGTSKVPL GF+ LEGMNG  KF I + S   + LPAAHTCFN +DLPQYE+++KL + LL AIREC+EG+G
Sbjct: 3660 ISERLSSLESLWNSLSECLLRLGKASDPHAVLALQPAAEAFFLVHA--SQQNKLKAKDAEAKRKESQAASSSAAAAVASSVSHDGLREDLDPDTAKLIEFAEKHRQVLNQALRQNNAVLSAGGPFAILTQFPKLLDFDVKRKYFRKELTKLEPSNSRMPRYRRNDVSVQVSRNRVFSDSFRELFRLRPSEWKNRFYIIFQGEEGQDAGGLLREWFSVITREIFNPNYALFITAPGDMVTYMINKASYINPEHLDYFKFVGRLIAKSVFEHKYLDCYFTRAFYKHILNLPVRYQDLESEDPAFFKSLDFLLQNPIDDLALDLTFSTEVEEFGVRSVRDLKPNGRKIEVNDANKDEYVKLVCQMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPTVDIDDMAANTDYKGFQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLEGMNGVQKFSIHMDSRGGDRLPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGFG 4178          

HSP 2 Score: 133.265 bits (334), Expect = 3.905e-30
Identity = 137/492 (27.85%), Postives = 219/492 (44.51%), Query Frame = 3
Query:   96 LAALGENDLINEIKKINVWH--YGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFS-RLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTE-YMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMA-----------LFARLRLCVYFGKPEQRKLLIYTRMQALSILCY-----TNEVEDKCLSWD-IVEELVDVLKLPDRE---------FLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKF----QPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKIC 1469
            +A   + D I  I K    H   GK EL  W +VL+R D IL + V K     L+ D   +  L    +AI+ FT  L E +  R +Y S + ILAL  +++MD+L  +L L     KRS + S R+    +  + +RL +IA+ WGGK     +AEC   E  +P     M + F             D+ Q ++ +  +PK             + ES  EL+   + + +   +SD +            L +R+R+ V F     R   +  R+ ++S L Y     T+E     L +   +EE+V++LK  DRE            I+  AL TL +I+   K      +L+ ++   SYHG    M R+ + +L  +      +P  S       TA+ SF+YHLA       T    LVG+GL  ++  +I +H    + I+F TR  R+ D   L   ++ +S    + ++  V+R+  EI  C
Sbjct:   29 VATKNDEDFIAAINKGREVHAVMGKTELYKWTEVLNRCDEILEKAVHKNEFGNLQCDH--DTVLKNHAVAIVRFTVLLFECTSSRRIYKSVDRILALLESTDMDLLAEVLRLLQVMGKRSKFLSTRIPQKEQHALAQRLTAIAQCWGGKLRTVKMAECLKREPKLP-----MLFPFTYT----------DAKQRTI-IVEQPK-------------KDESVGELITRTVAQISPPVSSDSVPSQQFSKEDLYCLLSRVRMLVTFEDWHHRFKCLIVRLLSVSTLVYCRLGGTDETTLSSLLYSGFIEEIVEMLK-SDREADTQQDHNLHDAIQTEALSTLCSIVTYEKEPKITQILEALSA-GSYHGFLSVMTRQIVDELKSNNLGKTGKPSVS-----LATALFSFIYHLASIEPGGDT----LVGSGLTQTLLSVIGFHELPIECITFGTRCARIID---LFTTIDVTSFKANNGMEICVNRVVHEINEC 475          

HSP 3 Score: 93.5893 bits (231), Expect = 4.659e-18
Identity = 49/151 (32.45%), Postives = 84/151 (55.63%), Query Frame = 3
Query: 1521 QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMM 1973
            QR G IK +L  IKR I D ++ + +K  M+G+LP+ L  I  N    ++P L   S  +ITNFVY  P  +S++Q R +   I ++L  + LP ++D + TL  + +A+ +N RG+ + K     ++  + +   +F+  +R KR  E+ 
Sbjct:  574 QRSGLIKGLLTFIKRAIGDVQFQDIMKHLMEGDLPEALMHILSN-AEYYSPSLFHQSAHLITNFVYQFPEELSSIQRRHVPYVIFQSLLRKELPNSKDVITTLGNVFTAMCLNERGLRQFKSYDPFNQIFRIVLSVKFLVTLRKKRSAEVF 723          

HSP 4 Score: 60.077 bits (144), Expect = 5.961e-8
Identity = 51/183 (27.87%), Postives = 81/183 (44.26%), Query Frame = 3
Query: 8451 LIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQ------------------------QLTG---------IQLPENVDAEIMAQLPAHIQEEILA-HYRRENSTSET---ANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQM 8888
            +I +G+DP FL ALP+ MR EVI +++R  R  +                        Q  G         + L E +D   +  LP  +QEE+LA H RR     E     NAP          P++      V    + SL  + R ++LA+MD +++A L +++ +EAR+ R +  +  M
Sbjct: 2973 IIPDGVDPAFLAALPEEMRAEVIRDYQRQQRAERASRPVPAAQPVAVNPNAPAGGEAAQGEGQAEQPAAAVVPLVEPIDPVFLNALPPELQEEVLAEHERRLREAEEQQRRQNAP--------PAPVVEMDGAAV----IASLPANERAQVLAEMDDAELAGLPADMQNEARRARAQHVEPNM 3143          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Celegans
Match: eel-1 (Enhancer of EfL-1 mutant phenotype [Source:UniProtKB/TrEMBL;Acc:U4PBK1])

HSP 1 Score: 534.258 bits (1375), Expect = 1.732e-151
Identity = 264/518 (50.97%), Postives = 352/518 (67.95%), Query Frame = 3
Query: 10662 ILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHN--PFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDS-RYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            I  +  S  S+W+ LS+ L  + K+ +P AV+  Q   E+F L H+  S+ ++   K   +   +  +  +++     + ++     E+   +    +EF EKH++VLN  LR+  A       F+ L ++PKLLDFD+KR+YF+ ++ +L       R  +  VQVSR R+F DS+  L R    EWK RF I F  EEGQD GGLLREW+  ++ EIFNPNYALF  +P D VTY IN ASY+N  HL YFKFVGR IAK++F++K L CYFTRAFYKHIL + +RY DLE ED  FF+ L+FLL+N +  + LD TFS ++ EFG    RDL PNG +I V + NK EYV+LVCQ KMTG+IR+QL +FL GFYEIIPK+LIS+FNE+ELELLI GLP +D++D+  NT Y  +   S  IQWFW+AL SF++ED+A+F+QFVTGTSKVPL GF+ LEGMNG  KF I + S   + LPAAHTCFN +DLPQYE+++KL + LL AIREC+EG+G
Sbjct: 3660 ISERLSSLESLWNSLSECLLRLGKASDPHAVLALQPAAEAFFLVHA--SQQNKLKAKDAEAKRKESQAASSSAAAAVASSVSHDGLREDLDPDTAKLIEFAEKHRQVLNQALRQNNAVLSAGGPFAILTQFPKLLDFDVKRKYFRKELTKLEPSMPRYRRNDVSVQVSRNRVFSDSFRELFRLRPSEWKNRFYIIFQGEEGQDAGGLLREWFSVITREIFNPNYALFITAPGDMVTYMINKASYINPEHLDYFKFVGRLIAKSVFEHKYLDCYFTRAFYKHILNLPVRYQDLESEDPAFFKSLDFLLQNPIDDLALDLTFSTEVEEFGVRSVRDLKPNGRKIEVNDANKDEYVKLVCQMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPTVDIDDMAANTDYKGFQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLEGMNGVQKFSIHMDSRGGDRLPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGFG 4175          

HSP 2 Score: 133.265 bits (334), Expect = 4.105e-30
Identity = 137/492 (27.85%), Postives = 219/492 (44.51%), Query Frame = 3
Query:   96 LAALGENDLINEIKKINVWH--YGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFS-RLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTE-YMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMA-----------LFARLRLCVYFGKPEQRKLLIYTRMQALSILCY-----TNEVEDKCLSWD-IVEELVDVLKLPDRE---------FLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKF----QPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKIC 1469
            +A   + D I  I K    H   GK EL  W +VL+R D IL + V K     L+ D   +  L    +AI+ FT  L E +  R +Y S + ILAL  +++MD+L  +L L     KRS + S R+    +  + +RL +IA+ WGGK     +AEC   E  +P     M + F             D+ Q ++ +  +PK             + ES  EL+   + + +   +SD +            L +R+R+ V F     R   +  R+ ++S L Y     T+E     L +   +EE+V++LK  DRE            I+  AL TL +I+   K      +L+ ++   SYHG    M R+ + +L  +      +P  S       TA+ SF+YHLA       T    LVG+GL  ++  +I +H    + I+F TR  R+ D   L   ++ +S    + ++  V+R+  EI  C
Sbjct:   29 VATKNDEDFIAAINKGREVHAVMGKTELYKWTEVLNRCDEILEKAVHKNEFGNLQCDH--DTVLKNHAVAIVRFTVLLFECTSSRRIYKSVDRILALLESTDMDLLAEVLRLLQVMGKRSKFLSTRIPQKEQHALAQRLTAIAQCWGGKLRTVKMAECLKREPKLP-----MLFPFTYT----------DAKQRTI-IVEQPK-------------KDESVGELITRTVAQISPPVSSDSVPSQQFSKEDLYCLLSRVRMLVTFEDWHHRFKCLIVRLLSVSTLVYCRLGGTDETTLSSLLYSGFIEEIVEMLK-SDREADTQQDHNLHDAIQTEALSTLCSIVTYEKEPKITQILEALSA-GSYHGFLSVMTRQIVDELKSNNLGKTGKPSVS-----LATALFSFIYHLASIEPGGDT----LVGSGLTQTLLSVIGFHELPIECITFGTRCARIID---LFTTIDVTSFKANNGMEICVNRVVHEINEC 475          

HSP 3 Score: 93.5893 bits (231), Expect = 4.581e-18
Identity = 49/151 (32.45%), Postives = 84/151 (55.63%), Query Frame = 3
Query: 1521 QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMM 1973
            QR G IK +L  IKR I D ++ + +K  M+G+LP+ L  I  N    ++P L   S  +ITNFVY  P  +S++Q R +   I ++L  + LP ++D + TL  + +A+ +N RG+ + K     ++  + +   +F+  +R KR  E+ 
Sbjct:  574 QRSGLIKGLLTFIKRAIGDVQFQDIMKHLMEGDLPEALMHILSN-AEYYSPSLFHQSAHLITNFVYQFPEELSSIQRRHVPYVIFQSLLRKELPNSKDVITTLGNVFTAMCLNERGLRQFKSYDPFNQIFRIVLSVKFLVTLRKKRSAEVF 723          

HSP 4 Score: 60.077 bits (144), Expect = 5.961e-8
Identity = 51/183 (27.87%), Postives = 81/183 (44.26%), Query Frame = 3
Query: 8451 LIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQ------------------------QLTG---------IQLPENVDAEIMAQLPAHIQEEILA-HYRRENSTSET---ANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQM 8888
            +I +G+DP FL ALP+ MR EVI +++R  R  +                        Q  G         + L E +D   +  LP  +QEE+LA H RR     E     NAP          P++      V    + SL  + R ++LA+MD +++A L +++ +EAR+ R +  +  M
Sbjct: 2973 IIPDGVDPAFLAALPEEMRAEVIRDYQRQQRAERASRPVPAAQPVAVNPNAPAGGEAAQGEGQAEQPAAAVVPLVEPIDPVFLNALPPELQEEVLAEHERRLREAEEQQRRQNAP--------PAPVVEMDGAAV----IASLPANERAQVLAEMDDAELAGLPADMQNEARRARAQHVEPNM 3143          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Fly
Match: HUWE1 (gene:FBgn0030674 transcript:FBtr0339689)

HSP 1 Score: 572.007 bits (1473), Expect = 8.847e-163
Identity = 296/572 (51.75%), Postives = 375/572 (65.56%), Query Frame = 3
Query: 10647 KVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKS-------------------------------------DNSNVSDPLS------------HLNTSLVVD---DTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            K     L+Q      +W+ LS+ L A+++SK+  AV+V Q  VE+F L H+      ++  +S                                     D S+ + P S              NT LV +    T M++           FL+F EKH+ VLN ILR+ +   L    F+ L+ + ++LDFD+KR+YFQ ++ +L  D   R EE  V V R  +FEDS+  L+R   EEWK RF I F +EEGQD GGLLREWY+ +S EIFNP YALF VSP D VTY INP+S+ N NHLSYFKFVGR IAKA+ DNKLL CYFTR+FYKHILG  +++TD+E +DY+F++GL++L+KND+ST+  + TFS ++ EFG T+ RDL PNG    VTEENK EYV+LVCQ KM+G+IRQQL +FLEGFY+IIPK+LISIFNE+ELELLI GLP+ID+ DLK NT Y+KYT  S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF  LEGMNG  KFQI     ST+ LP AHTCFN +DLP Y+++DKL  CLL AI ECSEG+G
Sbjct: 4557 KSTKPTLSQILCLDVLWNTLSECLVALEESKDEFAVLVLQPTVEAFFLIHASHRGASKKSGRSFMPNAAGFGLRAAAGAGAIGGLGAAAPSAQEYSPFMDDVSSANTPSSASFDDEPRMQDASTNTPLVTNPSTSTAMSAHEAQLRQDRQKFLQFAEKHRTVLNQILRQ-SPTHLSDGPFAVLVDHTRILDFDVKRKYFQTELERL--DEGIRREEHTVSVRRVTVFEDSFRVLYRLGPEEWKNRFYIVFEDEEGQDAGGLLREWYVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPNHLSYFKFVGRVIAKAVHDNKLLECYFTRSFYKHILGKQVKHTDMESQDYEFYKGLDYLMKNDISTLGYELTFSTEVQEFGVTQIRDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQQLDAFLEGFYDIIPKHLISIFNEQELELLISGLPDIDIEDLKANTEYHKYTSKSAQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFGSLEGMNGIQKFQIHRDDRSTDRLPCAHTCFNQLDLPMYKSYDKLRSCLLKAIHECSEGFG 5125          

HSP 2 Score: 202.216 bits (513), Expect = 7.572e-51
Identity = 150/504 (29.76%), Postives = 248/504 (49.21%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAAL-GENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVG--HWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLH--LQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVE---DKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIH-------CGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEID 1487
            MK+D  K+         EC +L   L       +L+  +  ++VW YGKCEL  W ++LDR D IL E    V    + L+ D    E  +  ++ +L FT  LIEHS  R+LY S EH+  L  + NMDI+ A+L L Y FSKRSN+  RL    +++++ +L +IAE WG   +G  L +CC+        G  + EF+               Q  +D ++    H  +L + ++       S  E+++ +  + +  + + +M +  R+RL   F   + R   +  R+QA+SIL Y+N ++   DK L     EEL +++   D   + I+A  LRTLT+++H         +  S    + + TG     G  P ++R+ I +L              +  T++ S LYHLA + E+  T    LV +G++ S+  +I W   + ++I+F TRAVRV D I     ++ +  +Q + ++  +DRL+ EIK C  +  D
Sbjct:    1 MKVDTVKLKKGSSELTAECRELIDELTKRRTRAELLEFLDTVHVWIYGKCELYHWIEILDRFDKILEEASRHVNGNEFVLQCDTNFQETDVTLLLHVLNFTTLLIEHSFSRHLYNSIEHLTVLLSSQNMDIVLAVLNLLYMFSKRSNFIPRLPFEKKELLIVKLFNIAERWGDPNYGLSLKDCCI--------GEPKLEFLY--------------QLCID-YVDEHGHAAQLEIPDMMDLCHTASAPEVIKTIAGQISKPSEAIKMRIAHRVRLISGFNNYKLRLQFVQARLQAVSILIYSNALQDNTDKVLYAGFGEELCELIDKEDVHLVEIRAAVLRTLTSMLHFDRNPNVPSRAGSRLMKIVHYTGAERQGGTLPLLVRDCIDNLTTHGL---TERYPLILATSLFSLLYHLA-SYEMGGT---ALVKSGMMQSLLCVISWPGVDLEHITFVTRAVRVIDLIT---NIDIARFHQNNGLNVFIDRLEKEIKSCCKALAD 471          

HSP 3 Score: 95.5153 bits (236), Expect = 1.393e-18
Identity = 56/169 (33.14%), Postives = 92/169 (54.44%), Query Frame = 3
Query: 1455 EIKICLDSEI-DQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            E K  L S++   +  K  +  TQR   +KSMLN +K+ I D+     ++  M+  L   LR I  N    + P L L + +V+T +V+N PS +S++Q+  +T  +L+ L ++ +P  R+ L +LP + SAL +N RG+ E       DK +K L    ++ AMR +R
Sbjct:  599 ERKAELSSQLPSSLAPKKPSCVTQRAALLKSMLNFLKKSIQDHAHFSNMRNIMETSLTQSLRHIIAN-AEYYGPSLFLLATDVVTVYVFNEPSLLSSLQDLGITSVMLKALLQKDVPATREVLGSLPNVFSALCLNERGLFEFLSYDPFDKVLKVLLSPDYLVAMRRRR 766          

HSP 4 Score: 92.0485 bits (227), Expect = 1.381e-17
Identity = 90/300 (30.00%), Postives = 136/300 (45.33%), Query Frame = 3
Query: 8454 IAEGIDPTFLEALPQSMRREVIIEHRRANRVRQ--QLTGIQLPEN----VDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDL---LSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKP-----------LVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLK 9293
            + EG+DP+FL ALP  MR EVI EH R  R+RQ  Q   IQ+  +    V+ E +A LP +IQ E+L   R E    +   A    NPE            V  ++F  +L  +LR+ IL DM++SQIA+L  ELA EA+ +R+   D + R           R  A   ++ LS     L  ++  RW   +I Y   S   Q   H +  +      A   PN+   KP           L+  D L  L+  L       + M++     ++++++L  H   R WI   +++I+ K
Sbjct: 3647 VPEGVDPSFLAALPSEMREEVIQEHLRMQRIRQRAQQNAIQIAHDSLVEVNPEFLAALPLNIQSEVLMQQRIE----QQRQAAQTANPED----------PVDTAAFFQNLPENLRQAILTDMEESQIASLPPELAAEAQFLRR---DWESRN--------GARMDAHPPSNALSRFQTTLQSLDDTRW-HSSIWYDA-SGNAQPQHHQHTTIVHQHPHAHHAPNMG--KPLALLMMEDENILLDPDSLATLLLFLFVEDQKVNSMRL-----HRVIRNLCHHEPTRDWIISALISIIQK 3912          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Fly
Match: HUWE1 (gene:FBgn0030674 transcript:FBtr0339690)

HSP 1 Score: 572.007 bits (1473), Expect = 9.487e-163
Identity = 296/572 (51.75%), Postives = 375/572 (65.56%), Query Frame = 3
Query: 10647 KVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKS-------------------------------------DNSNVSDPLS------------HLNTSLVVD---DTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            K     L+Q      +W+ LS+ L A+++SK+  AV+V Q  VE+F L H+      ++  +S                                     D S+ + P S              NT LV +    T M++           FL+F EKH+ VLN ILR+ +   L    F+ L+ + ++LDFD+KR+YFQ ++ +L  D   R EE  V V R  +FEDS+  L+R   EEWK RF I F +EEGQD GGLLREWY+ +S EIFNP YALF VSP D VTY INP+S+ N NHLSYFKFVGR IAKA+ DNKLL CYFTR+FYKHILG  +++TD+E +DY+F++GL++L+KND+ST+  + TFS ++ EFG T+ RDL PNG    VTEENK EYV+LVCQ KM+G+IRQQL +FLEGFY+IIPK+LISIFNE+ELELLI GLP+ID+ DLK NT Y+KYT  S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF  LEGMNG  KFQI     ST+ LP AHTCFN +DLP Y+++DKL  CLL AI ECSEG+G
Sbjct: 4531 KSTKPTLSQILCLDVLWNTLSECLVALEESKDEFAVLVLQPTVEAFFLIHASHRGASKKSGRSFMPNAAGFGLRAAAGAGAIGGLGAAAPSAQEYSPFMDDVSSANTPSSASFDDEPRMQDASTNTPLVTNPSTSTAMSAHEAQLRQDRQKFLQFAEKHRTVLNQILRQ-SPTHLSDGPFAVLVDHTRILDFDVKRKYFQTELERL--DEGIRREEHTVSVRRVTVFEDSFRVLYRLGPEEWKNRFYIVFEDEEGQDAGGLLREWYVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPNHLSYFKFVGRVIAKAVHDNKLLECYFTRSFYKHILGKQVKHTDMESQDYEFYKGLDYLMKNDISTLGYELTFSTEVQEFGVTQIRDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQQLDAFLEGFYDIIPKHLISIFNEQELELLISGLPDIDIEDLKANTEYHKYTSKSAQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFGSLEGMNGIQKFQIHRDDRSTDRLPCAHTCFNQLDLPMYKSYDKLRSCLLKAIHECSEGFG 5099          

HSP 2 Score: 202.601 bits (514), Expect = 6.783e-51
Identity = 150/504 (29.76%), Postives = 248/504 (49.21%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAAL-GENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVG--HWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLH--LQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVE---DKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIH-------CGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEID 1487
            MK+D  K+         EC +L   L       +L+  +  ++VW YGKCEL  W ++LDR D IL E    V    + L+ D    E  +  ++ +L FT  LIEHS  R+LY S EH+  L  + NMDI+ A+L L Y FSKRSN+  RL    +++++ +L +IAE WG   +G  L +CC+        G  + EF+               Q  +D ++    H  +L + ++       S  E+++ +  + +  + + +M +  R+RL   F   + R   +  R+QA+SIL Y+N ++   DK L     EEL +++   D   + I+A  LRTLT+++H         +  S    + + TG     G  P ++R+ I +L              +  T++ S LYHLA + E+  T    LV +G++ S+  +I W   + ++I+F TRAVRV D I     ++ +  +Q + ++  +DRL+ EIK C  +  D
Sbjct:    1 MKVDTVKLKKGSSELTAECRELIDELTKRRTRAELLEFLDTVHVWIYGKCELYHWIEILDRFDKILEEASRHVNGNEFVLQCDTNFQETDVTLLLHVLNFTTLLIEHSFSRHLYNSIEHLTVLLSSQNMDIVLAVLNLLYMFSKRSNFIPRLPFEKKELLIVKLFNIAERWGDPNYGLSLKDCCI--------GEPKLEFLY--------------QLCID-YVDEHGHAAQLEIPDMMDLCHTASAPEVIKTIAGQISKPSEAIKMRIAHRVRLISGFNNYKLRLQFVQARLQAVSILIYSNALQDNTDKVLYAGFGEELCELIDKEDVHLVEIRAAVLRTLTSMLHFDRNPNVPSRAGSRLMKIVHYTGAERQGGTLPLLVRDCIDNLTTHGL---TERYPLILATSLFSLLYHLA-SYEMGGT---ALVKSGMMQSLLCVISWPGVDLEHITFVTRAVRVIDLIT---NIDIARFHQNNGLNVFIDRLEKEIKSCCKALAD 471          

HSP 3 Score: 95.5153 bits (236), Expect = 1.428e-18
Identity = 56/169 (33.14%), Postives = 92/169 (54.44%), Query Frame = 3
Query: 1455 EIKICLDSEI-DQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            E K  L S++   +  K  +  TQR   +KSMLN +K+ I D+     ++  M+  L   LR I  N    + P L L + +V+T +V+N PS +S++Q+  +T  +L+ L ++ +P  R+ L +LP + SAL +N RG+ E       DK +K L    ++ AMR +R
Sbjct:  599 ERKAELSSQLPSSLAPKKPSCVTQRAALLKSMLNFLKKSIQDHAHFSNMRNIMETSLTQSLRHIIAN-AEYYGPSLFLLATDVVTVYVFNEPSLLSSLQDLGITSVMLKALLQKDVPATREVLGSLPNVFSALCLNERGLFEFLSYDPFDKVLKVLLSPDYLVAMRRRR 766          

HSP 4 Score: 92.0485 bits (227), Expect = 1.464e-17
Identity = 90/300 (30.00%), Postives = 136/300 (45.33%), Query Frame = 3
Query: 8454 IAEGIDPTFLEALPQSMRREVIIEHRRANRVRQ--QLTGIQLPEN----VDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDL---LSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKP-----------LVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLK 9293
            + EG+DP+FL ALP  MR EVI EH R  R+RQ  Q   IQ+  +    V+ E +A LP +IQ E+L   R E    +   A    NPE            V  ++F  +L  +LR+ IL DM++SQIA+L  ELA EA+ +R+   D + R           R  A   ++ LS     L  ++  RW   +I Y   S   Q   H +  +      A   PN+   KP           L+  D L  L+  L       + M++     ++++++L  H   R WI   +++I+ K
Sbjct: 3621 VPEGVDPSFLAALPSEMREEVIQEHLRMQRIRQRAQQNAIQIAHDSLVEVNPEFLAALPLNIQSEVLMQQRIE----QQRQAAQTANPED----------PVDTAAFFQNLPENLRQAILTDMEESQIASLPPELAAEAQFLRR---DWESRN--------GARMDAHPPSNALSRFQTTLQSLDDTRW-HSSIWYDA-SGNAQPQHHQHTTIVHQHPHAHHAPNMG--KPLALLMMEDENILLDPDSLATLLLFLFVEDQKVNSMRL-----HRVIRNLCHHEPTRDWIISALISIIQK 3886          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Fly
Match: HUWE1 (gene:FBgn0030674 transcript:FBtr0339688)

HSP 1 Score: 572.007 bits (1473), Expect = 1.010e-162
Identity = 296/572 (51.75%), Postives = 375/572 (65.56%), Query Frame = 3
Query: 10647 KVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKS-------------------------------------DNSNVSDPLS------------HLNTSLVVD---DTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            K     L+Q      +W+ LS+ L A+++SK+  AV+V Q  VE+F L H+      ++  +S                                     D S+ + P S              NT LV +    T M++           FL+F EKH+ VLN ILR+ +   L    F+ L+ + ++LDFD+KR+YFQ ++ +L  D   R EE  V V R  +FEDS+  L+R   EEWK RF I F +EEGQD GGLLREWY+ +S EIFNP YALF VSP D VTY INP+S+ N NHLSYFKFVGR IAKA+ DNKLL CYFTR+FYKHILG  +++TD+E +DY+F++GL++L+KND+ST+  + TFS ++ EFG T+ RDL PNG    VTEENK EYV+LVCQ KM+G+IRQQL +FLEGFY+IIPK+LISIFNE+ELELLI GLP+ID+ DLK NT Y+KYT  S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF  LEGMNG  KFQI     ST+ LP AHTCFN +DLP Y+++DKL  CLL AI ECSEG+G
Sbjct: 4546 KSTKPTLSQILCLDVLWNTLSECLVALEESKDEFAVLVLQPTVEAFFLIHASHRGASKKSGRSFMPNAAGFGLRAAAGAGAIGGLGAAAPSAQEYSPFMDDVSSANTPSSASFDDEPRMQDASTNTPLVTNPSTSTAMSAHEAQLRQDRQKFLQFAEKHRTVLNQILRQ-SPTHLSDGPFAVLVDHTRILDFDVKRKYFQTELERL--DEGIRREEHTVSVRRVTVFEDSFRVLYRLGPEEWKNRFYIVFEDEEGQDAGGLLREWYVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPNHLSYFKFVGRVIAKAVHDNKLLECYFTRSFYKHILGKQVKHTDMESQDYEFYKGLDYLMKNDISTLGYELTFSTEVQEFGVTQIRDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQQLDAFLEGFYDIIPKHLISIFNEQELELLISGLPDIDIEDLKANTEYHKYTSKSAQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFGSLEGMNGIQKFQIHRDDRSTDRLPCAHTCFNQLDLPMYKSYDKLRSCLLKAIHECSEGFG 5114          

HSP 2 Score: 202.216 bits (513), Expect = 8.161e-51
Identity = 150/504 (29.76%), Postives = 248/504 (49.21%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAAL-GENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVG--HWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLH--LQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVE---DKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIH-------CGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEID 1487
            MK+D  K+         EC +L   L       +L+  +  ++VW YGKCEL  W ++LDR D IL E    V    + L+ D    E  +  ++ +L FT  LIEHS  R+LY S EH+  L  + NMDI+ A+L L Y FSKRSN+  RL    +++++ +L +IAE WG   +G  L +CC+        G  + EF+               Q  +D ++    H  +L + ++       S  E+++ +  + +  + + +M +  R+RL   F   + R   +  R+QA+SIL Y+N ++   DK L     EEL +++   D   + I+A  LRTLT+++H         +  S    + + TG     G  P ++R+ I +L              +  T++ S LYHLA + E+  T    LV +G++ S+  +I W   + ++I+F TRAVRV D I     ++ +  +Q + ++  +DRL+ EIK C  +  D
Sbjct:    1 MKVDTVKLKKGSSELTAECRELIDELTKRRTRAELLEFLDTVHVWIYGKCELYHWIEILDRFDKILEEASRHVNGNEFVLQCDTNFQETDVTLLLHVLNFTTLLIEHSFSRHLYNSIEHLTVLLSSQNMDIVLAVLNLLYMFSKRSNFIPRLPFEKKELLIVKLFNIAERWGDPNYGLSLKDCCI--------GEPKLEFLY--------------QLCID-YVDEHGHAAQLEIPDMMDLCHTASAPEVIKTIAGQISKPSEAIKMRIAHRVRLISGFNNYKLRLQFVQARLQAVSILIYSNALQDNTDKVLYAGFGEELCELIDKEDVHLVEIRAAVLRTLTSMLHFDRNPNVPSRAGSRLMKIVHYTGAERQGGTLPLLVRDCIDNLTTHGL---TERYPLILATSLFSLLYHLA-SYEMGGT---ALVKSGMMQSLLCVISWPGVDLEHITFVTRAVRVIDLIT---NIDIARFHQNNGLNVFIDRLEKEIKSCCKALAD 471          

HSP 3 Score: 95.5153 bits (236), Expect = 1.417e-18
Identity = 56/169 (33.14%), Postives = 92/169 (54.44%), Query Frame = 3
Query: 1455 EIKICLDSEI-DQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            E K  L S++   +  K  +  TQR   +KSMLN +K+ I D+     ++  M+  L   LR I  N    + P L L + +V+T +V+N PS +S++Q+  +T  +L+ L ++ +P  R+ L +LP + SAL +N RG+ E       DK +K L    ++ AMR +R
Sbjct:  599 ERKAELSSQLPSSLAPKKPSCVTQRAALLKSMLNFLKKSIQDHAHFSNMRNIMETSLTQSLRHIIAN-AEYYGPSLFLLATDVVTVYVFNEPSLLSSLQDLGITSVMLKALLQKDVPATREVLGSLPNVFSALCLNERGLFEFLSYDPFDKVLKVLLSPDYLVAMRRRR 766          

HSP 4 Score: 92.0485 bits (227), Expect = 1.452e-17
Identity = 90/300 (30.00%), Postives = 136/300 (45.33%), Query Frame = 3
Query: 8454 IAEGIDPTFLEALPQSMRREVIIEHRRANRVRQ--QLTGIQLPEN----VDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDL---LSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKP-----------LVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLK 9293
            + EG+DP+FL ALP  MR EVI EH R  R+RQ  Q   IQ+  +    V+ E +A LP +IQ E+L   R E    +   A    NPE            V  ++F  +L  +LR+ IL DM++SQIA+L  ELA EA+ +R+   D + R           R  A   ++ LS     L  ++  RW   +I Y   S   Q   H +  +      A   PN+   KP           L+  D L  L+  L       + M++     ++++++L  H   R WI   +++I+ K
Sbjct: 3636 VPEGVDPSFLAALPSEMREEVIQEHLRMQRIRQRAQQNAIQIAHDSLVEVNPEFLAALPLNIQSEVLMQQRIE----QQRQAAQTANPED----------PVDTAAFFQNLPENLRQAILTDMEESQIASLPPELAAEAQFLRR---DWESRN--------GARMDAHPPSNALSRFQTTLQSLDDTRW-HSSIWYDA-SGNAQPQHHQHTTIVHQHPHAHHAPNMG--KPLALLMMEDENILLDPDSLATLLLFLFVEDQKVNSMRL-----HRVIRNLCHHEPTRDWIISALISIIQK 3901          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Fly
Match: HUWE1 (gene:FBgn0030674 transcript:FBtr0340304)

HSP 1 Score: 572.007 bits (1473), Expect = 1.088e-162
Identity = 296/572 (51.75%), Postives = 375/572 (65.56%), Query Frame = 3
Query: 10647 KVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKS-------------------------------------DNSNVSDPLS------------HLNTSLVVD---DTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            K     L+Q      +W+ LS+ L A+++SK+  AV+V Q  VE+F L H+      ++  +S                                     D S+ + P S              NT LV +    T M++           FL+F EKH+ VLN ILR+ +   L    F+ L+ + ++LDFD+KR+YFQ ++ +L  D   R EE  V V R  +FEDS+  L+R   EEWK RF I F +EEGQD GGLLREWY+ +S EIFNP YALF VSP D VTY INP+S+ N NHLSYFKFVGR IAKA+ DNKLL CYFTR+FYKHILG  +++TD+E +DY+F++GL++L+KND+ST+  + TFS ++ EFG T+ RDL PNG    VTEENK EYV+LVCQ KM+G+IRQQL +FLEGFY+IIPK+LISIFNE+ELELLI GLP+ID+ DLK NT Y+KYT  S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF  LEGMNG  KFQI     ST+ LP AHTCFN +DLP Y+++DKL  CLL AI ECSEG+G
Sbjct: 4581 KSTKPTLSQILCLDVLWNTLSECLVALEESKDEFAVLVLQPTVEAFFLIHASHRGASKKSGRSFMPNAAGFGLRAAAGAGAIGGLGAAAPSAQEYSPFMDDVSSANTPSSASFDDEPRMQDASTNTPLVTNPSTSTAMSAHEAQLRQDRQKFLQFAEKHRTVLNQILRQ-SPTHLSDGPFAVLVDHTRILDFDVKRKYFQTELERL--DEGIRREEHTVSVRRVTVFEDSFRVLYRLGPEEWKNRFYIVFEDEEGQDAGGLLREWYVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPNHLSYFKFVGRVIAKAVHDNKLLECYFTRSFYKHILGKQVKHTDMESQDYEFYKGLDYLMKNDISTLGYELTFSTEVQEFGVTQIRDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQQLDAFLEGFYDIIPKHLISIFNEQELELLISGLPDIDIEDLKANTEYHKYTSKSAQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFGSLEGMNGIQKFQIHRDDRSTDRLPCAHTCFNQLDLPMYKSYDKLRSCLLKAIHECSEGFG 5149          

HSP 2 Score: 202.601 bits (514), Expect = 6.411e-51
Identity = 150/503 (29.82%), Postives = 248/503 (49.30%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAAL-GENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVG--HWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLH--LQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVE---DKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIH------CGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEID 1487
            MK+D  K+         EC +L   L       +L+  +  ++VW YGKCEL  W ++LDR D IL E    V    + L+ D    E  +  ++ +L FT  LIEHS  R+LY S EH+  L  + NMDI+ A+L L Y FSKRSN+  RL    +++++ +L +IAE WG   +G  L +CC+        G  + EF+               Q  +D ++    H  +L + ++       S  E+++ +  + +  + + +M +  R+RL   F   + R   +  R+QA+SIL Y+N ++   DK L     EEL +++   D   + I+A  LRTLT+++H        +  S    + + TG     G  P ++R+ I +L              +  T++ S LYHLA + E+  T    LV +G++ S+  +I W   + ++I+F TRAVRV D I     ++ +  +Q + ++  +DRL+ EIK C  +  D
Sbjct:    1 MKVDTVKLKKGSSELTAECRELIDELTKRRTRAELLEFLDTVHVWIYGKCELYHWIEILDRFDKILEEASRHVNGNEFVLQCDTNFQETDVTLLLHVLNFTTLLIEHSFSRHLYNSIEHLTVLLSSQNMDIVLAVLNLLYMFSKRSNFIPRLPFEKKELLIVKLFNIAERWGDPNYGLSLKDCCI--------GEPKLEFLY--------------QLCID-YVDEHGHAAQLEIPDMMDLCHTASAPEVIKTIAGQISKPSEAIKMRIAHRVRLISGFNNYKLRLQFVQARLQAVSILIYSNALQDNTDKVLYAGFGEELCELIDKEDVHLVEIRAAVLRTLTSMLHFDRNPNVPRAGSRLMKIVHYTGAERQGGTLPLLVRDCIDNLTTHGL---TERYPLILATSLFSLLYHLA-SYEMGGT---ALVKSGMMQSLLCVISWPGVDLEHITFVTRAVRVIDLIT---NIDIARFHQNNGLNVFIDRLEKEIKSCCKALAD 470          

HSP 3 Score: 95.5153 bits (236), Expect = 1.516e-18
Identity = 56/169 (33.14%), Postives = 92/169 (54.44%), Query Frame = 3
Query: 1455 EIKICLDSEI-DQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            E K  L S++   +  K  +  TQR   +KSMLN +K+ I D+     ++  M+  L   LR I  N    + P L L + +V+T +V+N PS +S++Q+  +T  +L+ L ++ +P  R+ L +LP + SAL +N RG+ E       DK +K L    ++ AMR +R
Sbjct:  598 ERKAELSSQLPSSLAPKKPSCVTQRAALLKSMLNFLKKSIQDHAHFSNMRNIMETSLTQSLRHIIAN-AEYYGPSLFLLATDVVTVYVFNEPSLLSSLQDLGITSVMLKALLQKDVPATREVLGSLPNVFSALCLNERGLFEFLSYDPFDKVLKVLLSPDYLVAMRRRR 765          

HSP 4 Score: 92.0485 bits (227), Expect = 1.478e-17
Identity = 90/300 (30.00%), Postives = 136/300 (45.33%), Query Frame = 3
Query: 8454 IAEGIDPTFLEALPQSMRREVIIEHRRANRVRQ--QLTGIQLPEN----VDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDL---LSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKP-----------LVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLK 9293
            + EG+DP+FL ALP  MR EVI EH R  R+RQ  Q   IQ+  +    V+ E +A LP +IQ E+L   R E    +   A    NPE            V  ++F  +L  +LR+ IL DM++SQIA+L  ELA EA+ +R+   D + R           R  A   ++ LS     L  ++  RW   +I Y   S   Q   H +  +      A   PN+   KP           L+  D L  L+  L       + M++     ++++++L  H   R WI   +++I+ K
Sbjct: 3671 VPEGVDPSFLAALPSEMREEVIQEHLRMQRIRQRAQQNAIQIAHDSLVEVNPEFLAALPLNIQSEVLMQQRIE----QQRQAAQTANPED----------PVDTAAFFQNLPENLRQAILTDMEESQIASLPPELAAEAQFLRR---DWESRN--------GARMDAHPPSNALSRFQTTLQSLDDTRW-HSSIWYDA-SGNAQPQHHQHTTIVHQHPHAHHAPNMG--KPLALLMMEDENILLDPDSLATLLLFLFVEDQKVNSMRL-----HRVIRNLCHHEPTRDWIISALISIIQK 3936          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Fly
Match: HUWE1 (gene:FBgn0030674 transcript:FBtr0339686)

HSP 1 Score: 571.622 bits (1472), Expect = 1.134e-162
Identity = 296/572 (51.75%), Postives = 375/572 (65.56%), Query Frame = 3
Query: 10647 KVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKS-------------------------------------DNSNVSDPLS------------HLNTSLVVD---DTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            K     L+Q      +W+ LS+ L A+++SK+  AV+V Q  VE+F L H+      ++  +S                                     D S+ + P S              NT LV +    T M++           FL+F EKH+ VLN ILR+ +   L    F+ L+ + ++LDFD+KR+YFQ ++ +L  D   R EE  V V R  +FEDS+  L+R   EEWK RF I F +EEGQD GGLLREWY+ +S EIFNP YALF VSP D VTY INP+S+ N NHLSYFKFVGR IAKA+ DNKLL CYFTR+FYKHILG  +++TD+E +DY+F++GL++L+KND+ST+  + TFS ++ EFG T+ RDL PNG    VTEENK EYV+LVCQ KM+G+IRQQL +FLEGFY+IIPK+LISIFNE+ELELLI GLP+ID+ DLK NT Y+KYT  S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF  LEGMNG  KFQI     ST+ LP AHTCFN +DLP Y+++DKL  CLL AI ECSEG+G
Sbjct: 4575 KSTKPTLSQILCLDVLWNTLSECLVALEESKDEFAVLVLQPTVEAFFLIHASHRGASKKSGRSFMPNAAGFGLRAAAGAGAIGGLGAAAPSAQEYSPFMDDVSSANTPSSASFDDEPRMQDASTNTPLVTNPSTSTAMSAHEAQLRQDRQKFLQFAEKHRTVLNQILRQ-SPTHLSDGPFAVLVDHTRILDFDVKRKYFQTELERL--DEGIRREEHTVSVRRVTVFEDSFRVLYRLGPEEWKNRFYIVFEDEEGQDAGGLLREWYVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPNHLSYFKFVGRVIAKAVHDNKLLECYFTRSFYKHILGKQVKHTDMESQDYEFYKGLDYLMKNDISTLGYELTFSTEVQEFGVTQIRDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQQLDAFLEGFYDIIPKHLISIFNEQELELLISGLPDIDIEDLKANTEYHKYTSKSAQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFGSLEGMNGIQKFQIHRDDRSTDRLPCAHTCFNQLDLPMYKSYDKLRSCLLKAIHECSEGFG 5143          

HSP 2 Score: 202.601 bits (514), Expect = 5.652e-51
Identity = 150/503 (29.82%), Postives = 248/503 (49.30%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAAL-GENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVG--HWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLH--LQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVE---DKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIH------CGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEID 1487
            MK+D  K+         EC +L   L       +L+  +  ++VW YGKCEL  W ++LDR D IL E    V    + L+ D    E  +  ++ +L FT  LIEHS  R+LY S EH+  L  + NMDI+ A+L L Y FSKRSN+  RL    +++++ +L +IAE WG   +G  L +CC+        G  + EF+               Q  +D ++    H  +L + ++       S  E+++ +  + +  + + +M +  R+RL   F   + R   +  R+QA+SIL Y+N ++   DK L     EEL +++   D   + I+A  LRTLT+++H        +  S    + + TG     G  P ++R+ I +L              +  T++ S LYHLA + E+  T    LV +G++ S+  +I W   + ++I+F TRAVRV D I     ++ +  +Q + ++  +DRL+ EIK C  +  D
Sbjct:    1 MKVDTVKLKKGSSELTAECRELIDELTKRRTRAELLEFLDTVHVWIYGKCELYHWIEILDRFDKILEEASRHVNGNEFVLQCDTNFQETDVTLLLHVLNFTTLLIEHSFSRHLYNSIEHLTVLLSSQNMDIVLAVLNLLYMFSKRSNFIPRLPFEKKELLIVKLFNIAERWGDPNYGLSLKDCCI--------GEPKLEFLY--------------QLCID-YVDEHGHAAQLEIPDMMDLCHTASAPEVIKTIAGQISKPSEAIKMRIAHRVRLISGFNNYKLRLQFVQARLQAVSILIYSNALQDNTDKVLYAGFGEELCELIDKEDVHLVEIRAAVLRTLTSMLHFDRNPNVPRAGSRLMKIVHYTGAERQGGTLPLLVRDCIDNLTTHGL---TERYPLILATSLFSLLYHLA-SYEMGGT---ALVKSGMMQSLLCVISWPGVDLEHITFVTRAVRVIDLIT---NIDIARFHQNNGLNVFIDRLEKEIKSCCKALAD 470          

HSP 3 Score: 95.5153 bits (236), Expect = 1.503e-18
Identity = 56/169 (33.14%), Postives = 92/169 (54.44%), Query Frame = 3
Query: 1455 EIKICLDSEI-DQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            E K  L S++   +  K  +  TQR   +KSMLN +K+ I D+     ++  M+  L   LR I  N    + P L L + +V+T +V+N PS +S++Q+  +T  +L+ L ++ +P  R+ L +LP + SAL +N RG+ E       DK +K L    ++ AMR +R
Sbjct:  598 ERKAELSSQLPSSLAPKKPSCVTQRAALLKSMLNFLKKSIQDHAHFSNMRNIMETSLTQSLRHIIAN-AEYYGPSLFLLATDVVTVYVFNEPSLLSSLQDLGITSVMLKALLQKDVPATREVLGSLPNVFSALCLNERGLFEFLSYDPFDKVLKVLLSPDYLVAMRRRR 765          

HSP 4 Score: 92.0485 bits (227), Expect = 1.567e-17
Identity = 90/300 (30.00%), Postives = 136/300 (45.33%), Query Frame = 3
Query: 8454 IAEGIDPTFLEALPQSMRREVIIEHRRANRVRQ--QLTGIQLPEN----VDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDL---LSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKP-----------LVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLK 9293
            + EG+DP+FL ALP  MR EVI EH R  R+RQ  Q   IQ+  +    V+ E +A LP +IQ E+L   R E    +   A    NPE            V  ++F  +L  +LR+ IL DM++SQIA+L  ELA EA+ +R+   D + R           R  A   ++ LS     L  ++  RW   +I Y   S   Q   H +  +      A   PN+   KP           L+  D L  L+  L       + M++     ++++++L  H   R WI   +++I+ K
Sbjct: 3665 VPEGVDPSFLAALPSEMREEVIQEHLRMQRIRQRAQQNAIQIAHDSLVEVNPEFLAALPLNIQSEVLMQQRIE----QQRQAAQTANPED----------PVDTAAFFQNLPENLRQAILTDMEESQIASLPPELAAEAQFLRR---DWESRN--------GARMDAHPPSNALSRFQTTLQSLDDTRW-HSSIWYDA-SGNAQPQHHQHTTIVHQHPHAHHAPNMG--KPLALLMMEDENILLDPDSLATLLLFLFVEDQKVNSMRL-----HRVIRNLCHHEPTRDWIISALISIIQK 3930          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Zebrafish
Match: huwe1 (HECT, UBA and WWE domain containing E3 ubiquitin protein ligase 1 [Source:ZFIN;Acc:ZDB-GENE-081104-387])

HSP 1 Score: 536.954 bits (1382), Expect = 4.540e-152
Identity = 274/493 (55.58%), Postives = 340/493 (68.97%), Query Frame = 3
Query: 10692 IWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHS----------DCSEIHEEHNKSDNSNVSD-PLSHLNTSLVVDDTFMNSPAFSENGKHNP-----FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNS 12119
            +W +L + L  +++S +  AV+V Q  VE+F L H+          D  E    H K +   +S  PL+    S  +D  F   P+      + P     FL F E H+ VLN ILR+ T    D   F+ L+ Y ++LDFD+KR+YF+ ++ +L  D   R E+  V V R  +FEDSY  LHRK+ E+ K R  I F  EEGQD GGLLREWY+ +S E+FNP YALF+ SP D VTYTINP+S+ N NHLSYFKFVGR +AKA++DN+LL CYFTR+FYKHILG S+RYTD+E EDY FF+GL +LL+NDVST+  + TFS ++ EFG  E RDL  NG+ ILVTEENK EYV LVCQ KMTGAIR+QL +FLEGFYEIIPK LISIF E+ELELLI GLP ID++DLK NT Y+KY  +S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF+ LEGMNG  KFQI     ST+ LP+AHT   S
Sbjct: 3975 LWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPVRDTRESQLSHIKDEPPPLSPAPLTPATPS-SLDPFFSREPSSMHISSNLPPDTQKFLRFAETHRTVLNQILRQSTTHLAD-GPFAVLVDYIRILDFDVKRKYFRQELERL--DEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEDMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRVVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYPFFQGLVYLLENDVSTLGYELTFSTEVQEFGVCEVRDLKANGANILVTEENKKEYVHLVCQMKMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKANTEYHKYQSSSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTSLTS 4463          

HSP 2 Score: 369.392 bits (947), Expect = 2.807e-101
Identity = 238/717 (33.19%), Postives = 364/717 (50.77%), Query Frame = 3
Query:   12 LYEMKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGH--WTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECC----VTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQ-----PESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKC---LSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNM---TGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQI----LLSFQLNG-------------------------------SSTNQKSTIDAIVD----------------RLKFEIKICLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            L  MK+DR K+         +C  L  +L    +  L+ E+++I  W+ GKCEL  W D+LDR D IL +    V +  W L  D+P N  L   ++A+L FT  LIE+S  R+LY S EH+  L  + +M ++ ++L L Y FSKRSNY +RL S  R  +L RL  +AE+WGGK++GFGLAECC    +++Y P SA T+ +EF  + SS     K+ S+                 TL  +H++      ESPSE+ME+L   YN+     Q+ LF  +RL   F   ++R   +  R+ A+SIL Y+N +++     L   ++EELVDVL++ D++ L IKA +LRTLT+I+H  +     P L N+   TG  SYHG  P ++R  I  ++    +PY       + TA+ SFLYHLA  +         LV  G+++++ ++I +   E D I+F TRAVRV D I    + +FQ +G                               S+  +   +D  +D                  + E      S      +  V    QR   +KSMLN +K+ I D  +S+ ++  MDG LP  L+ I  N    + P L L + EV+T FV+  PS +S++Q+  LT  +L  L  + +P  R+ L +LP + SAL +N RG++   + +  ++  K L    ++ AMR +R
Sbjct:    2 LVTMKVDRSKLKKTPTEAPADCRTLIEKLKGCSDEQLLLELQQIKTWNIGKCELYHWVDLLDRFDGILCDAGQTVENMSWLLVCDRPENGQLKALLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASCDMQVVLSVLNLLYVFSKRSNYITRLGSDKRSPLLARLQHLAESWGGKENGFGLAECCRDLPMSKY-PPSATTLHFEFYAEPSSEVKVEKKSSSN----------------TLHYIHIEQLDKISESPSEIMESLTAMYNIPK-DKQILLFTHIRLAHGFSNHKRRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQ-LDIKAASLRTLTSIVHLERT----PKLSNIIDCTGTASYHGFLPVLVRNCIQAMIDPLMEPYP----HQFATALFSFLYHLASYDAGGEA----LVSCGMMEALLKVIKFLGDEQDQITFVTRAVRVVDLITNLDMAAFQSHGGLSIFICRLEHEVDLSRKECPFVIKPKIQRPSTATETEDMDTDMDMSEVAMESSPGPSTSSGSRAETDSRAQSNASSTPRAGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISN-AEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGLHSFVQCQPFERLFKVLLSPDYLPAMRRRR 686          

HSP 3 Score: 68.5514 bits (166), Expect = 2.849e-10
Identity = 78/303 (25.74%), Postives = 134/303 (44.22%), Query Frame = 3
Query: 8454 IAEGIDPTFLEALPQSMRREVI-------------IEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLS------VTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFS-ERGQTNRHNNAA-VTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKIS 9299
            + EG+DP+FL ALP+ +RREV+             +           L G      V  E +A LP  IQEE+LA  R E    E +  P+      G  PL          +F+ +L   LRR +L DM+ S +A +  ++A EA  +R+E    Q + +   L        ++   R+   TS L       NRG      ++Y   + +RG T +   +A  + P +   +       + L+  + L+ L+ LL          K+ ++ ++++L++L  H Q R W+  ++++IL + S
Sbjct: 2974 LPEGVDPSFLAALPEDIRREVLQNQLGIRPPSRPPVASTLTTTASAVLGGGPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELSQQPT-----QGDQPLDP-------VTFIQTLPSELRRSVLEDMEDSVLAVMPPDIAAEAAALRREQEARQRQLMHERLFGHSSSSALSAILRSPAFTSRLGG-----NRG------VQYTRLAVQRGGTFQMGGSANHSRPSSSNVDSLLRLRGRLLLDHEALSCLLVLLFVDEP-----KLNTSRLHRVLRNLCYHSQTRGWVIRSLLSILQRSS 3248          

HSP 4 Score: 65.855 bits (159), Expect = 1.681e-9
Identity = 78/318 (24.53%), Postives = 121/318 (38.05%), Query Frame = 3
Query: 4782 MVTRLVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDV-IYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIML-------LPSKSK------------DQR-----------------------KFENLSEYEHKIISCVPDPLGDEEVV--ELSDNMLQFLIS--IKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSA--IPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGA 5588
            ++T L+K+  ++     A   Q +       K IT + L+ID YE+ A + + R  +  Y       W W DDR G W   S  +N+ I+ ++R G+            Y   F ++ Q NEE+   RP+ML       +P  +K            +QR                       +   L +      S + DP G   +V   L+++M+  LI   +  I      D L A   L +RL   +  A    A  KS   I  L       G+T      V  L R   E P  L+HT+  ++   V+ GA
Sbjct: 1592 VLTVLIKLLEVVQPCLQAAKEQKDI---QTPKWITPVLLLIDFYEKMAVSSKRRAQMNKYLQPNGNNWRWFDDRSGRWCSYSASNNSTIDSAWRAGETSVRFTA-GRRRYTVQFNTMVQVNEETGNRRPVMLTVQRVPRIPKATKSGSVTDTEREESEQRAKTEETQTDTDSSSVAVEMAPPKEESELKDSTPAAPSVLQDPSGSSGIVVQGLTEDMITILIRACVSMISVPVDPDTLHATLRLCLRLTRTHHYAM-MFAELKSTRMILNLTQSSGFNGFT----PLVTLLFRHIIEDPATLRHTMEKVVRSAVTSGA 1900          

HSP 5 Score: 57.7658 bits (138), Expect = 4.552e-7
Identity = 27/73 (36.99%), Postives = 48/73 (65.75%), Query Frame = 3
Query: 2562 VYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWA 2780
            + LMDYI NV KF+E  +S+   +    Q+  +++GL  ++ IL +P+LP DFP+S ACQ++  + + +L+ +
Sbjct:  800 IPLMDYILNVMKFVESILSNNTTDDHC-QEFVNQKGLLPLVSILGLPNLPIDFPTSAACQAVAGVCKSILTLS 871          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Zebrafish
Match: BX664745.2 (HECT, UBA and WWE domain containing E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:559439])

HSP 1 Score: 372.089 bits (954), Expect = 2.420e-102
Identity = 236/714 (33.05%), Postives = 363/714 (50.84%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGH--WTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECC----VTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQ-----PESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKC---LSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNM---TGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQI----LLSFQLNG-------------------------------SSTNQKSTIDAIVD----------------RLKFEIKICLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            MK+DR K+         +C  L  +L    +  L+ E+++I  W+ GKCEL  W D+LDR D IL +    V +  W L  D+P N  L   ++A+L FT  LIE+S  R+LY S EH+  L  + +M ++ ++L L Y FSKRSNY +RL S  R  +L RL  +AE+WGGK++GFGLAECC    +++Y P SA T+ +EF  + SS     K+ S+                 TL  +H++      ESPSE+ME+L   YN+     Q+ LF  +RL   F   ++R   +  R+ A+SIL Y+N +++     L   ++EELVDVL++ D++ + IKA +LRTLT+I+H  +     P L N+   TG  SYHG  P ++R  I  ++    +PY       + TA+ SFLYHLA  +         LV  G+++++ ++I +   E D I+F TRAVRV D I    + +FQ +G                               S+  +   +D  +D                  + E      S      +  V    QR   +KSMLN +K+ I D  +S+ ++  MDG LP  L+ I  N    + P L L + EV+T FV+  PS +S++Q+  LT  +L  L  + +P  R+ L +LP + SAL +N RG++   + +  ++  K L    ++ AMR +R
Sbjct:    1 MKVDRSKLKKTPTEAPADCRTLIEKLKGCSDEQLLLELQQIKTWNIGKCELYHWVDLLDRFDGILCDAGQTVENMSWLLVCDRPENGQLKALLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASCDMQVVLSVLNLLYVFSKRSNYITRLGSDKRSPLLARLQHLAESWGGKENGFGLAECCRDLPMSKY-PPSATTLHFEFYAEPSSEVKVEKKSSSN----------------TLHYIHIEQLDKISESPSEIMESLTAMYNIPK-DKQILLFTHIRLAHGFSNHKRRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQLVDIKAASLRTLTSIVHLERT----PKLSNIIDCTGTASYHGFLPVLVRNCIQAMIDPLMEPYP----HQFATALFSFLYHLASYDAGGEA----LVSCGMMEALLKVIKFLGDEQDQITFVTRAVRVVDLITNLDMAAFQSHGGLSIFICRLEHEVDLSRKECPFVIKPKIQRPSTATETEDMDTDMDMSEVAMESSPGPSTSSGSRAETDSRAQSNASSTPRAGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISN-AEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGLHSFVQCQPFERLFKVLLSPDYLPAMRRRR 683          

HSP 2 Score: 66.2402 bits (160), Expect = 1.242e-9
Identity = 85/355 (23.94%), Postives = 135/355 (38.03%), Query Frame = 3
Query: 4770 KNHDMVTRLVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDV-IYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIML-------LPSKSK-----DQRKFEN------------------------------LSEYEHKIISCVPDPLGDEEVV--ELSDNMLQFLI--SIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSA--IPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFE 5687
            ++  ++T L+K+  ++     A   Q +       K IT + L+ID YE+ A + + R  +  Y       W W DDR G W   S  +N+ I+ ++R G+            Y   F ++ Q NEE+   RP+ML       +P  +K     D  + E+                              L +      S + DP G   +V   L+++M+  LI   +  I      D L A   L +RL   +  A    A  KS   I  L       G+T  LVT    L R   E P  L+HT+  ++   V+ GA             S+++ Y +    P   R+ E
Sbjct: 1614 ESSGVLTVLIKLLEVVQPCLQAAKEQKDI---QTPKWITPVLLLIDFYEKMAVSSKRRAQMNKYLQPNGNNWRWFDDRSGRWCSYSASNNSTIDSAWRAGETSVRFT-AGRRRYTVQFNTMVQVNEETGNRRPVMLTVQRVPRIPKATKSGSVTDTEREESEQRAKTEETQTDTDSSSVAVEMAPPKEESELKDSTPAAPSVLQDPSGSSGIVVQGLTEDMITILIRACVSMISVPVDPDTLHATLRLCLRLTRTHHYAM-MFAELKSTRMILNLTQSSGFNGFT-PLVTL---LFRHIIEDPATLRHTMEKVVRSAVTSGAGSTTSGVVSGSLGSREINYILRVLGPAACRNPE 1959          

HSP 3 Score: 58.151 bits (139), Expect = 3.535e-7
Identity = 27/73 (36.99%), Postives = 48/73 (65.75%), Query Frame = 3
Query: 2562 VYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWA 2780
            + LMDYI NV KF+E  +S+   +    Q+  +++GL  ++ IL +P+LP DFP+S ACQ++  + + +L+ +
Sbjct:  797 IPLMDYILNVMKFVESILSNNTTDDHC-QEFVNQKGLLPLVSILGLPNLPIDFPTSAACQAVAGVCKSILTLS 868          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Zebrafish
Match: huwe1 (HECT, UBA and WWE domain containing E3 ubiquitin protein ligase 1 [Source:ZFIN;Acc:ZDB-GENE-081104-387])

HSP 1 Score: 372.089 bits (954), Expect = 2.435e-102
Identity = 236/714 (33.05%), Postives = 363/714 (50.84%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGH--WTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECC----VTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQ-----PESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKC---LSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNM---TGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQI----LLSFQLNG-------------------------------SSTNQKSTIDAIVD----------------RLKFEIKICLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            MK+DR K+         +C  L  +L    +  L+ E+++I  W+ GKCEL  W D+LDR D IL +    V +  W L  D+P N  L   ++A+L FT  LIE+S  R+LY S EH+  L  + +M ++ ++L L Y FSKRSNY +RL S  R  +L RL  +AE+WGGK++GFGLAECC    +++Y P SA T+ +EF  + SS     K+ S+                 TL  +H++      ESPSE+ME+L   YN+     Q+ LF  +RL   F   ++R   +  R+ A+SIL Y+N +++     L   ++EELVDVL++ D++ + IKA +LRTLT+I+H  +     P L N+   TG  SYHG  P ++R  I  ++    +PY       + TA+ SFLYHLA  +         LV  G+++++ ++I +   E D I+F TRAVRV D I    + +FQ +G                               S+  +   +D  +D                  + E      S      +  V    QR   +KSMLN +K+ I D  +S+ ++  MDG LP  L+ I  N    + P L L + EV+T FV+  PS +S++Q+  LT  +L  L  + +P  R+ L +LP + SAL +N RG++   + +  ++  K L    ++ AMR +R
Sbjct:    1 MKVDRSKLKKTPTEAPADCRTLIEKLKGCSDEQLLLELQQIKTWNIGKCELYHWVDLLDRFDGILCDAGQTVENMSWLLVCDRPENGQLKALLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASCDMQVVLSVLNLLYVFSKRSNYITRLGSDKRSPLLARLQHLAESWGGKENGFGLAECCRDLPMSKY-PPSATTLHFEFYAEPSSEVKVEKKSSSN----------------TLHYIHIEQLDKISESPSEIMESLTAMYNIPK-DKQILLFTHIRLAHGFSNHKRRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQLVDIKAASLRTLTSIVHLERT----PKLSNIIDCTGTASYHGFLPVLVRNCIQAMIDPLMEPYP----HQFATALFSFLYHLASYDAGGEA----LVSCGMMEALLKVIKFLGDEQDQITFVTRAVRVVDLITNLDMAAFQSHGGLSIFICRLEHEVDLSRKECPFVIKPKIQRPSTATETEDMDTDMDMSEVAMESSPGPSTSSGSRAETDSRAQSNASSTPRAGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISN-AEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGLHSFVQCQPFERLFKVLLSPDYLPAMRRRR 683          

HSP 2 Score: 66.2402 bits (160), Expect = 1.242e-9
Identity = 85/355 (23.94%), Postives = 135/355 (38.03%), Query Frame = 3
Query: 4770 KNHDMVTRLVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDV-IYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIML-------LPSKSK-----DQRKFEN------------------------------LSEYEHKIISCVPDPLGDEEVV--ELSDNMLQFLI--SIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSA--IPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFE 5687
            ++  ++T L+K+  ++     A   Q +       K IT + L+ID YE+ A + + R  +  Y       W W DDR G W   S  +N+ I+ ++R G+            Y   F ++ Q NEE+   RP+ML       +P  +K     D  + E+                              L +      S + DP G   +V   L+++M+  LI   +  I      D L A   L +RL   +  A    A  KS   I  L       G+T  LVT    L R   E P  L+HT+  ++   V+ GA             S+++ Y +    P   R+ E
Sbjct: 1621 ESSGVLTVLIKLLEVVQPCLQAAKEQKDI---QTPKWITPVLLLIDFYEKMAVSSKRRAQMNKYLQPNGNNWRWFDDRSGRWCSYSASNNSTIDSAWRAGETSVRFT-AGRRRYTVQFNTMVQVNEETGNRRPVMLTVQRVPRIPKATKSGSVTDTEREESEQRAKTEETQTDTDSSSVAVEMAPPKEESELKDSTPAAPSVLQDPSGSSGIVVQGLTEDMITILIRACVSMISVPVDPDTLHATLRLCLRLTRTHHYAM-MFAELKSTRMILNLTQSSGFNGFT-PLVTL---LFRHIIEDPATLRHTMEKVVRSAVTSGAGSTTSGVVSGSLGSREINYILRVLGPAACRNPE 1966          

HSP 3 Score: 58.151 bits (139), Expect = 3.536e-7
Identity = 27/73 (36.99%), Postives = 48/73 (65.75%), Query Frame = 3
Query: 2562 VYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWA 2780
            + LMDYI NV KF+E  +S+   +    Q+  +++GL  ++ IL +P+LP DFP+S ACQ++  + + +L+ +
Sbjct:  797 IPLMDYILNVMKFVESILSNNTTDDHC-QEFVNQKGLLPLVSILGLPNLPIDFPTSAACQAVAGVCKSILTLS 868          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Zebrafish
Match: hace1 (HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:572430])

HSP 1 Score: 328.946 bits (842), Expect = 8.393e-94
Identity = 181/459 (39.43%), Postives = 273/459 (59.48%), Query Frame = 3
Query: 10878 SLVVDDTFMNSPAFSENGKHNP-FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLD----------FDIKRRYFQAKVAQLRNDGDSRY----EEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNK-YTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            S V+   +M       +G  +P F+EFV KH +VL   + R      +  +F  LL+ P+L+           F  +  +F   +   + D D  +    E +++ V R  LF  S   + + + E+ KQ   ++F  EEG  G G++REW+  +S+EI NP+YALF  S DG T+  N  S VN +HL+YF+F G+ +  A++  +L+  YFTR+FYKHILGI + Y D+   D ++ + L+++L ND+S + L+ TFS++   FG  E   L P G+ I VT++NK EYV+LV + +MT AI+ Q+++FL+GF+  IP +LI +F+E ELELL+ G+PEID+ D K NT Y   Y    P IQWFW+ +E+  QE+R   +QFVTG+S+VP GGF+ L G +G  KF ++    ++N LP + TC N + LP+Y + D L   LL A+   S GY M
Sbjct:  449 SAVIQAFYMCCSCQMPHGMTSPRFIEFVCKHDEVLKCFVTRNPKIIFNHFHF--LLECPELMSRFMHIIKGQPFKDRCEWFYEHLLAGQPDSDMVHRPVNENDILLVHRDSLFRSSCEVVSKSSNEKLKQGIAVRFHGEEGM-GQGVVREWFDILSNEIINPDYALFTQSADGTTFQPNSNSSVNPDHLNYFRFAGQILGLALYHRQLVNIYFTRSFYKHILGIPVSYQDVSSIDPEYAKNLQWILDNDISDLGLELTFSVETDVFGTMEEVPLKPGGTTIQVTQDNKEEYVQLVTELRMTRAIQPQINAFLQGFHTFIPPSLIQLFDEYELELLLSGMPEIDVMDWKRNTEYTSGYDLQEPVIQWFWEVVENLTQEERVLLLQFVTGSSRVPHGGFAFLMGGSGLQKFTVAAVPYTSNLLPTSSTCINMLKLPEYPSKDVLRDRLLVALHCGSYGYTM 904          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Zebrafish
Match: smurf2 (SMAD specific E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:563633])

HSP 1 Score: 321.627 bits (823), Expect = 1.163e-92
Identity = 162/348 (46.55%), Postives = 221/348 (63.51%), Query Frame = 3
Query: 11145 VQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGV-TYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRE 12185
            ++VSR  +FE+SY ++ +   ++  +R  +KF  EEG D GG+ REW   +SHE+ NP Y LF+ S D + T  INP S VN  HLSYF FVGR +  A+F    +   FT  FYK +LG  I   D+E  D      L ++L ND+ T  LD TF ++ + +G+    +L PNG  I VT++ K EYVRL    +    I  Q  +  +GF E+IP++L+  F+EKELEL++CGL +ID+ND K NT     TP S  ++WFW+A+ES+D+E RAR +QFVTG+S+VPL GF  L+G  GP  F I     STN+LP AHTCFN ID+P YE++DKL+  LLTAI E
Sbjct:  412 IEVSREEIFEESYRQVMKMRPKDLWKRLMVKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLDDMESVDPDLHNSLVWILDNDI-TGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVTQDTKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKAFDEKELELIVCGLGKIDINDWKSNTRLKHCTPDSNIVKWFWRAVESYDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDASTNNLPKAHTCFNRIDIPPYESYDKLYDKLLTAIEE 758          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Xenopus
Match: itch (itchy E3 ubiquitin protein ligase [Source:NCBI gene;Acc:780194])

HSP 1 Score: 335.495 bits (859), Expect = 4.331e-97
Identity = 175/418 (41.87%), Postives = 252/418 (60.29%), Query Frame = 3
Query: 10953 FVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFK-VSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            FV+ ++K   +I  R    ALD     A ++     DF  K +YF+    QL      +     + V+R  LFEDS+ ++    A++ ++R  I    EEG D GG+ REW+  +SHE+ NP Y LF+    D     INPASY+N +HL YF+F+GRFIA A+F  K +   F+  FYK IL   +   DLE  D +F+  L ++  N++    L+  FS+     G+ ++ DL P+GS I VTEENK EY+RLV + +++  + +Q  +F EGF EI+P+  +  F+ KELE+L+CG+ EIDLND + NT+Y  YT  S QI WFWQ ++  D E R R +QFVTGT ++P+GGF+ L G NGP KF I       N LP +HTCFN +DLP Y+++++L + LL AI E +EG+G
Sbjct:  365 FVDHNRKTTTYIDPRTGKSALDNGPHIAYVR-----DFKAKVQYFRFWCQQLYMPQHVK-----ITVNRKTLFEDSFQQIMSFNAQDLRRRLWIIIPGEEGLDYGGVAREWFFLLSHEVMNPMYCLFEYAGKDNYCLQINPASYINPDHLRYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESVDPEFYNSLIWIKDNNIEECGLEMFFSVDKEILGEVKSHDLKPDGSNIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRNTIYRHYTRTSKQIIWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVG-KENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEE-TEGFG 770          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Xenopus
Match: itch (itchy E3 ubiquitin protein ligase [Source:NCBI gene;Acc:780194])

HSP 1 Score: 335.495 bits (859), Expect = 1.295e-96
Identity = 175/418 (41.87%), Postives = 252/418 (60.29%), Query Frame = 3
Query: 10953 FVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFK-VSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            FV+ ++K   +I  R    ALD     A ++     DF  K +YF+    QL      +     + V+R  LFEDS+ ++    A++ ++R  I    EEG D GG+ REW+  +SHE+ NP Y LF+    D     INPASY+N +HL YF+F+GRFIA A+F  K +   F+  FYK IL   +   DLE  D +F+  L ++  N++    L+  FS+     G+ ++ DL P+GS I VTEENK EY+RLV + +++  + +Q  +F EGF EI+P+  +  F+ KELE+L+CG+ EIDLND + NT+Y  YT  S QI WFWQ ++  D E R R +QFVTGT ++P+GGF+ L G NGP KF I       N LP +HTCFN +DLP Y+++++L + LL AI E +EG+G
Sbjct:  414 FVDHNRKTTTYIDPRTGKSALDNGPHIAYVR-----DFKAKVQYFRFWCQQLYMPQHVK-----ITVNRKTLFEDSFQQIMSFNAQDLRRRLWIIIPGEEGLDYGGVAREWFFLLSHEVMNPMYCLFEYAGKDNYCLQINPASYINPDHLRYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESVDPEFYNSLIWIKDNNIEECGLEMFFSVDKEILGEVKSHDLKPDGSNIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRNTIYRHYTRTSKQIIWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVG-KENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEE-TEGFG 819          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Xenopus
Match: itch (itchy E3 ubiquitin protein ligase [Source:NCBI gene;Acc:780194])

HSP 1 Score: 336.265 bits (861), Expect = 1.296e-96
Identity = 175/418 (41.87%), Postives = 252/418 (60.29%), Query Frame = 3
Query: 10953 FVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFK-VSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            FV+ ++K   +I  R    ALD     A ++     DF  K +YF+    QL      +     + V+R  LFEDS+ ++    A++ ++R  I    EEG D GG+ REW+  +SHE+ NP Y LF+    D     INPASY+N +HL YF+F+GRFIA A+F  K +   F+  FYK IL   +   DLE  D +F+  L ++  N++    L+  FS+     G+ ++ DL P+GS I VTEENK EY+RLV + +++  + +Q  +F EGF EI+P+  +  F+ KELE+L+CG+ EIDLND + NT+Y  YT  S QI WFWQ ++  D E R R +QFVTGT ++P+GGF+ L G NGP KF I       N LP +HTCFN +DLP Y+++++L + LL AI E +EG+G
Sbjct:  446 FVDHNRKTTTYIDPRTGKSALDNGPHIAYVR-----DFKAKVQYFRFWCQQLYMPQHVK-----ITVNRKTLFEDSFQQIMSFNAQDLRRRLWIIIPGEEGLDYGGVAREWFFLLSHEVMNPMYCLFEYAGKDNYCLQINPASYINPDHLRYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESVDPEFYNSLIWIKDNNIEECGLEMFFSVDKEILGEVKSHDLKPDGSNIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRNTIYRHYTRTSKQIIWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVG-KENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEE-TEGFG 851          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Xenopus
Match: crybb2 (crystallin beta B2 [Source:Xenbase;Acc:XB-GENE-5866500])

HSP 1 Score: 320.857 bits (821), Expect = 4.558e-96
Identity = 161/350 (46.00%), Postives = 229/350 (65.43%), Query Frame = 3
Query: 11145 VQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGV-TYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECS 12191
            V+VSR  +FE+SY ++ +   ++ K+R  +KF  EEG D GG+ REW   + HE+ NP Y LF+ S D + T  INP S +N +HLSYF FVGR +  A+F    +   FT  FYK +LG  I+ +DLE  D +  + L ++L+ND++++ LD TF ++ + FG+    +L PNG  + VTEENK EYVRL    +    I  Q  +  +GF E+IP++L+  F +KELEL+I GL +ID++D K NT        S  +QWFWQA+ESFD+E RAR +QFVTG+++VPL GF  L+G  GP  F I L   +T++LP AHTCFN ID+P YE+++KL++ LLTA+ E S
Sbjct:   91 VEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYTLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITSV-LDHTFCVEHNAFGRLLQHELKPNGKNLQVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFEQKELELIIGGLDKIDISDWKANTRLKHCLANSNIVQWFWQAVESFDEERRARLLQFVTGSTRVPLQGFKALQGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETS 439          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Xenopus
Match: crybb2 (crystallin beta B2 [Source:Xenbase;Acc:XB-GENE-5866500])

HSP 1 Score: 321.242 bits (822), Expect = 9.395e-93
Identity = 161/350 (46.00%), Postives = 229/350 (65.43%), Query Frame = 3
Query: 11145 VQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGV-TYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECS 12191
            V+VSR  +FE+SY ++ +   ++ K+R  +KF  EEG D GG+ REW   + HE+ NP Y LF+ S D + T  INP S +N +HLSYF FVGR +  A+F    +   FT  FYK +LG  I+ +DLE  D +  + L ++L+ND++++ LD TF ++ + FG+    +L PNG  + VTEENK EYVRL    +    I  Q  +  +GF E+IP++L+  F +KELEL+I GL +ID++D K NT        S  +QWFWQA+ESFD+E RAR +QFVTG+++VPL GF  L+G  GP  F I L   +T++LP AHTCFN ID+P YE+++KL++ LLTA+ E S
Sbjct:  375 VEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYTLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITSV-LDHTFCVEHNAFGRLLQHELKPNGKNLQVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFEQKELELIIGGLDKIDISDWKANTRLKHCLANSNIVQWFWQAVESFDEERRARLLQFVTGSTRVPLQGFKALQGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETS 723          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Mouse
Match: Huwe1 (HECT, UBA and WWE domain containing 1 [Source:MGI Symbol;Acc:MGI:1926884])

HSP 1 Score: 585.489 bits (1508), Expect = 8.326e-167
Identity = 295/522 (56.51%), Postives = 365/522 (69.92%), Query Frame = 3
Query: 10692 IWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHS----------DCSEIHEEHNKSDNSNVSD-PLSHLNTSLVVDDTFMNSPAFSENGKHNP-----FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            +W +L + L  +++S +  AV+V Q  VE+F L H+          D  E    H K +   +S  PL+    S  +D  F   P+        P     FL F E H+ VLN ILR+ T    D   F+ L+ Y ++LDFD+KR+YF+ ++ +L  D   R E+  V V R  +FEDSY  LHRK+ EE K R  I F  EEGQD GGLLREWY+ +S E+FNP YALF+ SP D VTYTINP+S+ N NHLSYFKFVGR +AKA++DN+LL CYFTR+FYKHILG S+RYTD+E EDY F++GL +LL+NDVST+  D TFS ++ EFG  E RDL PNG+ ILVTEENK EYV LVCQ +MTGAIR+QL +FLEGFYEIIPK LISIF E+ELELLI GLP ID++DLK NT Y+KY   S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF+ LEGMNG  KFQI     ST+ LP+AHTCFN +DLP YE+F+KL   LL AI+ECSEG+G+
Sbjct: 3860 LWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPVRDTRESQLAHIKDEPPPLSPAPLTPATPS-SLDPFFSREPSSMHISSSLPPDTQKFLRFAETHRTVLNQILRQSTTHLAD-GPFAVLVDYIRVLDFDVKRKYFRQELERL--DEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGL 4377          

HSP 2 Score: 385.185 bits (988), Expect = 5.559e-106
Identity = 236/677 (34.86%), Postives = 363/677 (53.62%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGH--WTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYM---PYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQ-----PESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKC---LSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKIC-------LDSEIDQ--MTKKSVALNT---------QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            MK+DR K+         +C  L  +L    +  L+ E+++I  W+ GKCEL  W D+LDR D ILA+    V +  W L  D+P  E L   ++A+L FT  LIE+S  R+LY S EH+  L  +S+M ++ A+L L Y FSKRSNY +RL S  R  +L RL  +AE+WGGK++GFGLAECC    M   P SA T+ +EF  D       G E          +K +      TL  +H++      ESPSE+ME+L + Y++     QM LF  +RL   F    +R   +  R+ A+SIL Y+N +++     L   ++EELVDVL++ D++ + IKA +LRTLT+I+H  +      ++ + TG  SYHG  P ++R  I  ++     PY       + TA+ SFLYHLA  +         LV  G+++++ ++I +   E D I+F TRAVRV D I     L+ ++    S +   + RL+ E+ +C       +  +I +   T++   + T         QR   +KSMLN +K+ I D  +S+ ++  MDG LP  L+ I  N    + P L L + EV+T FV+  PS +S++Q+  LT  +L  L  + +P  R+ L +LP + SAL +N RG+    + +  ++  K L    ++ AMR +R
Sbjct:    1 MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDRFDGILADAGQTVENMSWMLVCDRPEKEQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLAECCRDLQMLKYPPSATTLHFEFYAD------PGAE----------VKIEKRTTSNTLHYIHIEQLDKISESPSEIMESLTKMYSIPK-DKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSII-DCTGTASYHGFLPVLVRNCIQAMIDPSMDPYP----HQFATALFSFLYHLASYDAGGEA----LVSCGMMEALLKVIKFLGDEQDQITFVTRAVRVVDLIT---NLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQRPSTTQEGEEMETDMDGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISN-AEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRR 647          

HSP 3 Score: 73.9442 bits (180), Expect = 6.744e-12
Identity = 85/323 (26.32%), Postives = 143/323 (44.27%), Query Frame = 3
Query: 8454 IAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPE--------------------NVDAEIMAQLPAHIQEEILAHYRRENSTSETA-NAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLL------SVTGRRRARQLTSGLSDLLSQMNRG-RWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNIL-------LKISLPKENT 9317
            + EG+DP+FL ALP  +RREV+          Q   GI+ P                      V  E +A LP  IQEE+LA  R E    E A NA              SS T +   +F+ +L   LRR +L DM+ S +A +  ++A EA+ +R+E    Q + +   L       +++   R+   TS LS      NRG ++ +  ++     + G ++ HN  + ++  T           + L+  + L+ L+ LL          K+ ++ ++++L++L  H Q R W+  ++++IL       L I  PK +T
Sbjct: 2965 LPEGVDPSFLAALPDDIRREVL----------QNQLGIRPPTRSAPSSNSSAPAVVGNPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQNA--------------SSDTPMDPVTFIQTLPSDLRRSVLEDMEDSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHSSTSALSAILRSPAFTSRLSG-----NRGVQYTRLAVQRGGTFQMGGSSSHNRPSGSNVDTLL-----RLRGRLLLDHEALSCLLVLLFVDEP-----KLNTSRLHRVLRNLCYHAQTRHWVIRSLLSILQRSSESELCIETPKLST 3248          

HSP 4 Score: 68.5514 bits (166), Expect = 2.920e-10
Identity = 78/303 (25.74%), Postives = 126/303 (41.58%), Query Frame = 3
Query: 4794 LVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVI-YEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIML----LP-----SKSKDQRKFENL------SEYEHKIISCVPDPL------------------GDEEVVELSDNMLQFLI--SIKKIDNVYKWDCLQAACYLLIRLC--DKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGA 5588
            L+K+  ++     A   Q E       K IT + L+ID YE+TA + + R  +  Y       W W DDR G W   S  +N+ I+ ++++G+            Y   F ++ Q NEE+   RP+ML    +P     SKS + ++ E        ++ +HK       PL                  G+  +  L+++M+  LI   +  +      D L A   L +RL    KY++    L + +  I  L       G+T  LVT    LLR   E P  L+HT+  ++    + GA
Sbjct: 1557 LIKLLEVVQPCLQAAKEQKEV---QTPKWITPVLLLIDFYEKTAISSKRRAQMTKYLQSNSNNWRWFDDRSGRWCSYSASNNSTIDSAWKSGETSVRFT-AGRRRYTVQFTTMVQVNEETGNRRPVMLTLLRVPRLSKNSKSSNGQELEKTLEESKETDIKHKENKGNDIPLALESTNTEKEASLDETKIGEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYAMMFAELKSTR-MILNLTQSSGFNGFT-PLVTL---LLRHIIEDPCTLRHTMEKVVRSAATSGA 1850          

HSP 5 Score: 58.5362 bits (140), Expect = 2.824e-7
Identity = 31/93 (33.33%), Postives = 56/93 (60.22%), Query Frame = 3
Query: 2508 GKDNKTEEMNQFSCDDD--AVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWA 2780
             + N+TE   Q    ++   + LMDYI NV KF+E  +S+   +    Q+  +++GL  ++ IL +P+LP DFP+S ACQ++  + + +L+ +
Sbjct:  744 AQQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESILSNNTTDDHC-QEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLS 835          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Mouse
Match: Huwe1 (HECT, UBA and WWE domain containing 1 [Source:MGI Symbol;Acc:MGI:1926884])

HSP 1 Score: 585.489 bits (1508), Expect = 8.681e-167
Identity = 295/522 (56.51%), Postives = 365/522 (69.92%), Query Frame = 3
Query: 10692 IWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHS----------DCSEIHEEHNKSDNSNVSD-PLSHLNTSLVVDDTFMNSPAFSENGKHNP-----FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            +W +L + L  +++S +  AV+V Q  VE+F L H+          D  E    H K +   +S  PL+    S  +D  F   P+        P     FL F E H+ VLN ILR+ T    D   F+ L+ Y ++LDFD+KR+YF+ ++ +L  D   R E+  V V R  +FEDSY  LHRK+ EE K R  I F  EEGQD GGLLREWY+ +S E+FNP YALF+ SP D VTYTINP+S+ N NHLSYFKFVGR +AKA++DN+LL CYFTR+FYKHILG S+RYTD+E EDY F++GL +LL+NDVST+  D TFS ++ EFG  E RDL PNG+ ILVTEENK EYV LVCQ +MTGAIR+QL +FLEGFYEIIPK LISIF E+ELELLI GLP ID++DLK NT Y+KY   S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF+ LEGMNG  KFQI     ST+ LP+AHTCFN +DLP YE+F+KL   LL AI+ECSEG+G+
Sbjct: 3859 LWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPVRDTRESQLAHIKDEPPPLSPAPLTPATPS-SLDPFFSREPSSMHISSSLPPDTQKFLRFAETHRTVLNQILRQSTTHLAD-GPFAVLVDYIRVLDFDVKRKYFRQELERL--DEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGL 4376          

HSP 2 Score: 385.185 bits (988), Expect = 5.605e-106
Identity = 236/677 (34.86%), Postives = 363/677 (53.62%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGH--WTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYM---PYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQ-----PESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKC---LSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKIC-------LDSEIDQ--MTKKSVALNT---------QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            MK+DR K+         +C  L  +L    +  L+ E+++I  W+ GKCEL  W D+LDR D ILA+    V +  W L  D+P  E L   ++A+L FT  LIE+S  R+LY S EH+  L  +S+M ++ A+L L Y FSKRSNY +RL S  R  +L RL  +AE+WGGK++GFGLAECC    M   P SA T+ +EF  D       G E          +K +      TL  +H++      ESPSE+ME+L + Y++     QM LF  +RL   F    +R   +  R+ A+SIL Y+N +++     L   ++EELVDVL++ D++ + IKA +LRTLT+I+H  +      ++ + TG  SYHG  P ++R  I  ++     PY       + TA+ SFLYHLA  +         LV  G+++++ ++I +   E D I+F TRAVRV D I     L+ ++    S +   + RL+ E+ +C       +  +I +   T++   + T         QR   +KSMLN +K+ I D  +S+ ++  MDG LP  L+ I  N    + P L L + EV+T FV+  PS +S++Q+  LT  +L  L  + +P  R+ L +LP + SAL +N RG+    + +  ++  K L    ++ AMR +R
Sbjct:    1 MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDRFDGILADAGQTVENMSWMLVCDRPEKEQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLAECCRDLQMLKYPPSATTLHFEFYAD------PGAE----------VKIEKRTTSNTLHYIHIEQLDKISESPSEIMESLTKMYSIPK-DKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSII-DCTGTASYHGFLPVLVRNCIQAMIDPSMDPYP----HQFATALFSFLYHLASYDAGGEA----LVSCGMMEALLKVIKFLGDEQDQITFVTRAVRVVDLIT---NLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQRPSTTQEGEEMETDMDGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISN-AEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRR 647          

HSP 3 Score: 73.9442 bits (180), Expect = 6.360e-12
Identity = 85/323 (26.32%), Postives = 143/323 (44.27%), Query Frame = 3
Query: 8454 IAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPE--------------------NVDAEIMAQLPAHIQEEILAHYRRENSTSETA-NAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLL------SVTGRRRARQLTSGLSDLLSQMNRG-RWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNIL-------LKISLPKENT 9317
            + EG+DP+FL ALP  +RREV+          Q   GI+ P                      V  E +A LP  IQEE+LA  R E    E A NA              SS T +   +F+ +L   LRR +L DM+ S +A +  ++A EA+ +R+E    Q + +   L       +++   R+   TS LS      NRG ++ +  ++     + G ++ HN  + ++  T           + L+  + L+ L+ LL          K+ ++ ++++L++L  H Q R W+  ++++IL       L I  PK +T
Sbjct: 2964 LPEGVDPSFLAALPDDIRREVL----------QNQLGIRPPTRSAPSSNSSAPAVVGNPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQNA--------------SSDTPMDPVTFIQTLPSDLRRSVLEDMEDSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHSSTSALSAILRSPAFTSRLSG-----NRGVQYTRLAVQRGGTFQMGGSSSHNRPSGSNVDTLL-----RLRGRLLLDHEALSCLLVLLFVDEP-----KLNTSRLHRVLRNLCYHAQTRHWVIRSLLSILQRSSESELCIETPKLST 3247          

HSP 4 Score: 68.5514 bits (166), Expect = 2.800e-10
Identity = 78/303 (25.74%), Postives = 126/303 (41.58%), Query Frame = 3
Query: 4794 LVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVI-YEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIML----LP-----SKSKDQRKFENL------SEYEHKIISCVPDPL------------------GDEEVVELSDNMLQFLI--SIKKIDNVYKWDCLQAACYLLIRLC--DKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGA 5588
            L+K+  ++     A   Q E       K IT + L+ID YE+TA + + R  +  Y       W W DDR G W   S  +N+ I+ ++++G+            Y   F ++ Q NEE+   RP+ML    +P     SKS + ++ E        ++ +HK       PL                  G+  +  L+++M+  LI   +  +      D L A   L +RL    KY++    L + +  I  L       G+T  LVT    LLR   E P  L+HT+  ++    + GA
Sbjct: 1557 LIKLLEVVQPCLQAAKEQKEV---QTPKWITPVLLLIDFYEKTAISSKRRAQMTKYLQSNSNNWRWFDDRSGRWCSYSASNNSTIDSAWKSGETSVRFT-AGRRRYTVQFTTMVQVNEETGNRRPVMLTLLRVPRLSKNSKSSNGQELEKTLEESKETDIKHKENKGNDIPLALESTNTEKEASLDETKIGEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYAMMFAELKSTR-MILNLTQSSGFNGFT-PLVTL---LLRHIIEDPCTLRHTMEKVVRSAATSGA 1850          

HSP 5 Score: 58.5362 bits (140), Expect = 2.823e-7
Identity = 31/93 (33.33%), Postives = 56/93 (60.22%), Query Frame = 3
Query: 2508 GKDNKTEEMNQFSCDDD--AVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWA 2780
             + N+TE   Q    ++   + LMDYI NV KF+E  +S+   +    Q+  +++GL  ++ IL +P+LP DFP+S ACQ++  + + +L+ +
Sbjct:  744 AQQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESILSNNTTDDHC-QEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLS 835          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Mouse
Match: Itch (itchy, E3 ubiquitin protein ligase [Source:MGI Symbol;Acc:MGI:1202301])

HSP 1 Score: 334.724 bits (857), Expect = 3.919e-96
Identity = 171/418 (40.91%), Postives = 254/418 (60.77%), Query Frame = 3
Query: 10953 FVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFK-VSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            FV+ +++   +I  R    ALD     A ++     DF  K +YF+    QL     +  +   + V+R  LFEDS+ ++   + ++ ++R  + F  EEG D GG+ REW+  +SHE+ NP Y LF+    D     INPASY+N +HL YF+F+GRFIA A+F  K +   F+  FYK IL   +   DLE  D +F+  L ++ +N++    L+  FS+     G+ ++ DL PNG  ILVTEENK EY+R+V + +++  + +Q  +F EGF EI+P+  +  F+ KELE+L+CG+ EIDLND + + +Y  YT  S QI WFWQ ++  D E R R +QFVTGT ++P+GGF+ L G NGP KF I       N LP +HTCFN +DLP Y+++++L + LL AI E +EG+G
Sbjct:  457 FVDHNRRATTYIDPRTGKSALDNGPQIAYVR-----DFKAKVQYFRFWCQQL-----AMPQHIKITVTRKTLFEDSFQQIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECGLEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYTRTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVG-KENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEE-TEGFG 862          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Mouse
Match: Itch (itchy, E3 ubiquitin protein ligase [Source:MGI Symbol;Acc:MGI:1202301])

HSP 1 Score: 334.724 bits (857), Expect = 3.919e-96
Identity = 171/418 (40.91%), Postives = 254/418 (60.77%), Query Frame = 3
Query: 10953 FVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFK-VSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            FV+ +++   +I  R    ALD     A ++     DF  K +YF+    QL     +  +   + V+R  LFEDS+ ++   + ++ ++R  + F  EEG D GG+ REW+  +SHE+ NP Y LF+    D     INPASY+N +HL YF+F+GRFIA A+F  K +   F+  FYK IL   +   DLE  D +F+  L ++ +N++    L+  FS+     G+ ++ DL PNG  ILVTEENK EY+R+V + +++  + +Q  +F EGF EI+P+  +  F+ KELE+L+CG+ EIDLND + + +Y  YT  S QI WFWQ ++  D E R R +QFVTGT ++P+GGF+ L G NGP KF I       N LP +HTCFN +DLP Y+++++L + LL AI E +EG+G
Sbjct:  457 FVDHNRRATTYIDPRTGKSALDNGPQIAYVR-----DFKAKVQYFRFWCQQL-----AMPQHIKITVTRKTLFEDSFQQIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECGLEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYTRTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVG-KENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEE-TEGFG 862          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Mouse
Match: Nedd4l (neural precursor cell expressed, developmentally down-regulated gene 4-like [Source:MGI Symbol;Acc:MGI:1933754])

HSP 1 Score: 319.316 bits (817), Expect = 1.427e-94
Identity = 175/388 (45.10%), Postives = 247/388 (63.66%), Query Frame = 3
Query: 11049 PKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHR-KTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYV-NNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVY-NKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGY 12200
            P   +F  K  YF+ K+ +   D  +R+E   +++ R  +FE+SY R+   K  +  K R  I+F +E+G D GG+ REW+  +S E+FNP Y LF+ S  D  T  INP S + N +HLSYF F+GR    A+F  KLL  +F R FYK +LG  I   D+E  D +++  L+++L+ND +   LD  F I    FGQT   DL PNGS+I+VT ENK EY+ LV Q +    +++Q+++FLEGF E++P +LI IF+E ELELL+CGL ++D+ND + +++Y N Y P  P IQWFW+A+   D E R R +QFVTGTS+VP+ GF++L G NGP  F I     S   LP AHTCFN +DLP YE F+ L + LL A+ E ++G+
Sbjct:  144 PYSREFKQKYDYFRKKLKK-PADIPNRFE---MKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTE--LDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWG-SPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAV-ENAQGF 523          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. UniProt/SwissProt
Match: sp|Q7Z6Z7|HUWE1_HUMAN (E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3)

HSP 1 Score: 593.578 bits (1529), Expect = 2.336e-168
Identity = 297/532 (55.83%), Postives = 370/532 (69.55%), Query Frame = 3
Query: 10662 ILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHS----------DCSEIHEEHNKSDNSNVSD-PLSHLNTSLVVDDTFMNSPAFSENGKHNP-----FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            +L++  S   +W +L + L  +++S +  AV+V Q  VE+F L H+          D  E    H K +   +S  PL+    S  +D  F   P+        P     FL F E H+ VLN ILR+ T    D   F+ L+ Y ++LDFD+KR+YF+ ++ +L  D   R E+  V V R  +FEDSY  LHRK+ EE K R  I F  EEGQD GGLLREWY+ +S E+FNP YALF+ SP D VTYTINP+S+ N NHLSYFKFVGR +AKA++DN+LL CYFTR+FYKHILG S+RYTD+E EDY F++GL +LL+NDVST+  D TFS ++ EFG  E RDL PNG+ ILVTEENK EYV LVCQ +MTGAIR+QL +FLEGFYEIIPK LISIF E+ELELLI GLP ID++DLK NT Y+KY   S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF+ LEGMNG  KFQI     ST+ LP+AHTCFN +DLP YE+F+KL   LL AI+ECSEG+G+
Sbjct: 3846 LLSEQLSLDELWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPVRDTRESQLAHIKDEPPPLSPAPLTPATPS-SLDPFFSREPSSMHISSSLPPDTQKFLRFAETHRTVLNQILRQSTTHLAD-GPFAVLVDYIRVLDFDVKRKYFRQELERL--DEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGL 4373          

HSP 2 Score: 385.956 bits (990), Expect = 2.310e-105
Identity = 236/677 (34.86%), Postives = 364/677 (53.77%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGH--WTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYM---PYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQ-----PESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKC---LSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKIC-------LDSEIDQ--MTKKSVALNT---------QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            MK+DR K+         +C  L  +L    +  L+ E+++I  W+ GKCEL  W D+LDR D ILA+    V +  W L  D+P  E L   ++A+L FT  LIE+S  R+LY S EH+  L  +S+M ++ A+L L Y FSKRSNY +RL S  R  +L RL  +AE+WGGK++GFGLAECC   +M   P SA T+ +EF  D       G E          +K +      TL  +H++      ESPSE+ME+L + Y++     QM LF  +RL   F    +R   +  R+ A+SIL Y+N +++     L   ++EELVDVL++ D++ + IKA +LRTLT+I+H  +      ++ + TG  SYHG  P ++R  I  ++     PY       + TA+ SFLYHLA  +         LV  G+++++ ++I +   E D I+F TRAVRV D I     L+ ++    S +   + RL+ E+ +C       +  +I +   T++   + T         QR   +KSMLN +K+ I D  +S+ ++  MDG LP  L+ I  N    + P L L + EV+T FV+  PS +S++Q+  LT  +L  L  + +P  R+ L +LP + SAL +N RG+    + +  ++  K L    ++ AMR +R
Sbjct:    1 MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDRFDGILADAGQTVENMSWMLVCDRPEREQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLAECCRDLHMMKYPPSATTLHFEFYAD------PGAE----------VKIEKRTTSNTLHYIHIEQLDKISESPSEIMESLTKMYSIPK-DKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSII-DCTGTASYHGFLPVLVRNCIQAMIDPSMDPYP----HQFATALFSFLYHLASYDAGGEA----LVSCGMMEALLKVIKFLGDEQDQITFVTRAVRVVDLIT---NLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQRPNTTQEGEEMETDMDGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISN-AEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRR 647          

HSP 3 Score: 77.0258 bits (188), Expect = 5.483e-12
Identity = 81/300 (27.00%), Postives = 139/300 (46.33%), Query Frame = 3
Query: 8454 IAEGIDPTFLEALPQSMRREVIIEH-------RRA---NRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETA-NAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLL------SVTGRRRARQLTSGLSDLLSQMNRG-RWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKIS 9299
            + EG+DP+FL ALP  +RREV+          R A   N     + G      V  E +A LP  IQEE+LA  R E    E A NA              SS T +   +F+ +L   LRR +L DM+ S +A +  ++A EA+ +R+E    Q + +   L       +++   R+   TS LS      NRG ++ +  ++     + G ++ HN  + ++  T           + L+  + L+ L+ LL          K+ ++ ++++L++L  H Q R W+  ++++IL + S
Sbjct: 2964 LPEGVDPSFLAALPDDIRREVLQNQLGIRPPTRTAPSTNSSAPAVVGNPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQNA--------------SSDTPMDPVTFIQTLPSDLRRSVLEDMEDSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHSSTSALSAILRSPAFTSRLSG-----NRGVQYTRLAVQRGGTFQMGGSSSHNRPSGSNVDTLL-----RLRGRLLLDHEALSCLLVLLFVDEP-----KLNTSRLHRVLRNLCYHAQTRHWVIRSLLSILQRSS 3234          

HSP 4 Score: 67.3958 bits (163), Expect = 4.639e-9
Identity = 78/303 (25.74%), Postives = 123/303 (40.59%), Query Frame = 3
Query: 4794 LVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVI-YEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIML----LP--------------------SKSKDQRKFENL---------SEYEHKIISCVPDPLGDEEVVELSDNMLQFLI--SIKKIDNVYKWDCLQAACYLLIRLC--DKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGA 5588
            L+K+  ++     A   Q E       K IT + L+ID YE+TA + + R  +  Y       W W DDR G W   S  +N+ I+ ++++G+            Y   F ++ Q NEE+   RP+ML    +P                    SK  D ++ EN          S    K  S     +G+  +  L+++M+  LI   +  +      D L A   L +RL    KY++    L + +  I  L       G+T  LVT    LLR   E P  L+HT+  ++    + GA
Sbjct: 1557 LIKLLEVVQPCLQAAKEQKEV---QTPKWITPVLLLIDFYEKTAISSKRRAQMTKYLQSNSNNWRWFDDRSGRWCSYSASNNSTIDSAWKSGETSVRFT-AGRRRYTVQFTTMVQVNEETGNRRPVMLTLLRVPRLNKNSKNSNGQELEKTLEESKEMDIKRKENKGNDTPLALESTNTEKETSLEETKIGEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYAMMFAELKSTR-MILNLTQSSGFNGFT-PLVTL---LLRHIIEDPCTLRHTMEKVVRSAATSGA 1850          

HSP 5 Score: 58.5362 bits (140), Expect = 2.315e-6
Identity = 31/92 (33.70%), Postives = 56/92 (60.87%), Query Frame = 3
Query: 2511 KDNKTEEMNQFSCDDD--AVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWA 2780
            + N+TE   Q    ++   + LMDYI NV KF+E  +S+   +    Q+  +++GL  ++ IL +P+LP DFP+S ACQ++  + + +L+ +
Sbjct:  745 QQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESILSNNTTDDHC-QEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLS 835          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. UniProt/SwissProt
Match: sp|Q7TMY8|HUWE1_MOUSE (E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus OX=10090 GN=Huwe1 PE=1 SV=5)

HSP 1 Score: 585.489 bits (1508), Expect = 6.072e-166
Identity = 295/522 (56.51%), Postives = 365/522 (69.92%), Query Frame = 3
Query: 10692 IWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHS----------DCSEIHEEHNKSDNSNVSD-PLSHLNTSLVVDDTFMNSPAFSENGKHNP-----FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            +W +L + L  +++S +  AV+V Q  VE+F L H+          D  E    H K +   +S  PL+    S  +D  F   P+        P     FL F E H+ VLN ILR+ T    D   F+ L+ Y ++LDFD+KR+YF+ ++ +L  D   R E+  V V R  +FEDSY  LHRK+ EE K R  I F  EEGQD GGLLREWY+ +S E+FNP YALF+ SP D VTYTINP+S+ N NHLSYFKFVGR +AKA++DN+LL CYFTR+FYKHILG S+RYTD+E EDY F++GL +LL+NDVST+  D TFS ++ EFG  E RDL PNG+ ILVTEENK EYV LVCQ +MTGAIR+QL +FLEGFYEIIPK LISIF E+ELELLI GLP ID++DLK NT Y+KY   S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF+ LEGMNG  KFQI     ST+ LP+AHTCFN +DLP YE+F+KL   LL AI+ECSEG+G+
Sbjct: 3859 LWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPVRDTRESQLAHIKDEPPPLSPAPLTPATPS-SLDPFFSREPSSMHISSSLPPDTQKFLRFAETHRTVLNQILRQSTTHLAD-GPFAVLVDYIRVLDFDVKRKYFRQELERL--DEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGL 4376          

HSP 2 Score: 385.185 bits (988), Expect = 3.921e-105
Identity = 236/677 (34.86%), Postives = 363/677 (53.62%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGH--WTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYM---PYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQ-----PESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKC---LSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKIC-------LDSEIDQ--MTKKSVALNT---------QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKR 1958
            MK+DR K+         +C  L  +L    +  L+ E+++I  W+ GKCEL  W D+LDR D ILA+    V +  W L  D+P  E L   ++A+L FT  LIE+S  R+LY S EH+  L  +S+M ++ A+L L Y FSKRSNY +RL S  R  +L RL  +AE+WGGK++GFGLAECC    M   P SA T+ +EF  D       G E          +K +      TL  +H++      ESPSE+ME+L + Y++     QM LF  +RL   F    +R   +  R+ A+SIL Y+N +++     L   ++EELVDVL++ D++ + IKA +LRTLT+I+H  +      ++ + TG  SYHG  P ++R  I  ++     PY       + TA+ SFLYHLA  +         LV  G+++++ ++I +   E D I+F TRAVRV D I     L+ ++    S +   + RL+ E+ +C       +  +I +   T++   + T         QR   +KSMLN +K+ I D  +S+ ++  MDG LP  L+ I  N    + P L L + EV+T FV+  PS +S++Q+  LT  +L  L  + +P  R+ L +LP + SAL +N RG+    + +  ++  K L    ++ AMR +R
Sbjct:    1 MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDRFDGILADAGQTVENMSWMLVCDRPEKEQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLAECCRDLQMLKYPPSATTLHFEFYAD------PGAE----------VKIEKRTTSNTLHYIHIEQLDKISESPSEIMESLTKMYSIPK-DKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSII-DCTGTASYHGFLPVLVRNCIQAMIDPSMDPYP----HQFATALFSFLYHLASYDAGGEA----LVSCGMMEALLKVIKFLGDEQDQITFVTRAVRVVDLIT---NLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQRPSTTQEGEEMETDMDGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISN-AEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRR 647          

HSP 3 Score: 73.9442 bits (180), Expect = 4.448e-11
Identity = 85/323 (26.32%), Postives = 143/323 (44.27%), Query Frame = 3
Query: 8454 IAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPE--------------------NVDAEIMAQLPAHIQEEILAHYRRENSTSETA-NAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLL------SVTGRRRARQLTSGLSDLLSQMNRG-RWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNIL-------LKISLPKENT 9317
            + EG+DP+FL ALP  +RREV+          Q   GI+ P                      V  E +A LP  IQEE+LA  R E    E A NA              SS T +   +F+ +L   LRR +L DM+ S +A +  ++A EA+ +R+E    Q + +   L       +++   R+   TS LS      NRG ++ +  ++     + G ++ HN  + ++  T           + L+  + L+ L+ LL          K+ ++ ++++L++L  H Q R W+  ++++IL       L I  PK +T
Sbjct: 2964 LPEGVDPSFLAALPDDIRREVL----------QNQLGIRPPTRSAPSSNSSAPAVVGNPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQNA--------------SSDTPMDPVTFIQTLPSDLRRSVLEDMEDSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHSSTSALSAILRSPAFTSRLSG-----NRGVQYTRLAVQRGGTFQMGGSSSHNRPSGSNVDTLL-----RLRGRLLLDHEALSCLLVLLFVDEP-----KLNTSRLHRVLRNLCYHAQTRHWVIRSLLSILQRSSESELCIETPKLST 3247          

HSP 4 Score: 68.5514 bits (166), Expect = 1.958e-9
Identity = 78/303 (25.74%), Postives = 126/303 (41.58%), Query Frame = 3
Query: 4794 LVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVI-YEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIML----LP-----SKSKDQRKFENL------SEYEHKIISCVPDPL------------------GDEEVVELSDNMLQFLI--SIKKIDNVYKWDCLQAACYLLIRLC--DKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGA 5588
            L+K+  ++     A   Q E       K IT + L+ID YE+TA + + R  +  Y       W W DDR G W   S  +N+ I+ ++++G+            Y   F ++ Q NEE+   RP+ML    +P     SKS + ++ E        ++ +HK       PL                  G+  +  L+++M+  LI   +  +      D L A   L +RL    KY++    L + +  I  L       G+T  LVT    LLR   E P  L+HT+  ++    + GA
Sbjct: 1557 LIKLLEVVQPCLQAAKEQKEV---QTPKWITPVLLLIDFYEKTAISSKRRAQMTKYLQSNSNNWRWFDDRSGRWCSYSASNNSTIDSAWKSGETSVRFT-AGRRRYTVQFTTMVQVNEETGNRRPVMLTLLRVPRLSKNSKSSNGQELEKTLEESKETDIKHKENKGNDIPLALESTNTEKEASLDETKIGEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYAMMFAELKSTR-MILNLTQSSGFNGFT-PLVTL---LLRHIIEDPCTLRHTMEKVVRSAATSGA 1850          

HSP 5 Score: 58.5362 bits (140), Expect = 1.975e-6
Identity = 31/93 (33.33%), Postives = 56/93 (60.22%), Query Frame = 3
Query: 2508 GKDNKTEEMNQFSCDDD--AVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWA 2780
             + N+TE   Q    ++   + LMDYI NV KF+E  +S+   +    Q+  +++GL  ++ IL +P+LP DFP+S ACQ++  + + +L+ +
Sbjct:  744 AQQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESILSNNTTDDHC-QEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLS 835          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. UniProt/SwissProt
Match: sp|P51593|HUWE1_RAT (E3 ubiquitin-protein ligase HUWE1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Huwe1 PE=1 SV=2)

HSP 1 Score: 474.937 bits (1221), Expect = 1.224e-150
Identity = 224/321 (69.78%), Postives = 264/321 (82.24%), Query Frame = 3
Query: 11247 EEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            EEGQD GGLLREWY+ +S E+FNP YALF+ SP D VTYTINP+S+ N NHLSYFKFVGR +AKA++DN+LL CYFTR+FYKHILG S+RYTD+E EDY F++GL +LL+NDVST+  D TFS ++ EFG  E RDL PNG+ ILVTEENK EYV LVCQ +MTGAIR+QL +FLEGFYEIIPK LISIF E+ELELLI GLP ID++DLK NT Y+KY   S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF+ LEGMNG  KFQI     ST+ LP+AHTCFN +DLP YE+F+KL   LL AI+ECSEG+G+
Sbjct:    1 EEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGL 321          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. UniProt/SwissProt
Match: sp|Q8GY23|UPL1_ARATH (E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana OX=3702 GN=UPL1 PE=1 SV=3)

HSP 1 Score: 416.001 bits (1068), Expect = 1.417e-114
Identity = 209/428 (48.83%), Postives = 286/428 (66.82%), Query Frame = 3
Query: 10944 FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEEL-VQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISE-----FGQTETRD--LIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            F +F EKH+++LN  +R+  +  L + + S +LK P+L+DFD K+ YF++++   R+  D      L + V RA + EDSY +L  ++ ++ K R  ++F  EEG D GGL REWY  +S  IF+    LF    +  T+  NP S     HLSYFKFVGR +AKA+FD +LL  YFTR+FYKHILG+ + Y D+E  D  +++ L++LL+NDVS + LD TFS+   E     + +TE  D  L P G  I VTEE K EYV LV    +T AIR Q+++FLEGF E+IP+ L+SIFN+KELELLI GLPEID +DLK NT Y  YT  SP I WFW+ +++F +ED ARF+QFVTGTSKVPL GF  L+G++GP + QI  A  +   LP+AHTCFN +DLP+Y++ ++L + LL AI E SEG+G
Sbjct: 3258 FSKFAEKHRRLLNSFIRQNPS--LLEKSLSMMLKAPRLIDFDNKKAYFRSRI---RHQHDQHISGPLRISVRRAYVLEDSYNQLRMRSPQDLKGRLNVQFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNDATFQPNPNSVYQTEHLSYFKFVGRMVAKALFDGQLLDVYFTRSFYKHILGVKVTYHDIEAVDPDYYKNLKWLLENDVSDI-LDLTFSMDADEEKHILYEKTEVTDYELKPGGRNIRVTEETKHEYVDLVAGHILTNAIRPQINAFLEGFNELIPRELVSIFNDKELELLISGLPEIDFDDLKANTEYTSYTAGSPVIHWFWEVVKAFSKEDMARFLQFVTGTSKVPLEGFKALQGISGPQRLQIHKAYGAPERLPSAHTCFNQLDLPEYQSKEQLQERLLLAIHEASEGFG 3679          

HSP 2 Score: 83.5741 bits (205), Expect = 6.213e-14
Identity = 120/636 (18.87%), Postives = 251/636 (39.47%), Query Frame = 3
Query:  117 DLINEIKKINVWHYGKCELGLWADVLDRLDNILAE--GVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWE-HILALFGTSNMDILHALLGLFYNFSKR--SNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCV---TEYMPYSAG-TMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSW-----DIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQ-MTKKSVALNTQRVGFIKSMLN-----------LIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAM 1946
            +LI+E      W + K +   W D+ +  D    +   V K  H     ++         ++ +L     ++E+   ++ Y S+E H+  L  +++ D++ A L     F KR    Y  R  S N K+      S+A+ WGGK+ G GL  C      + +    G T+ +EF     S S           + V   P          ++ +  ES  EL+  L+  +N+   S + AL  R+R    F     R+     R+ A  +L   +   +  +S+     + V ELV ++   D     I+   L +L A+    +  +  P +        + G    +M++ I  +V          +   ++ A    L  L      +S+    +   GL+ ++  +I     +P ++   + AV + +  +       +       +D  + RLK E+    D   ++  +  S   +T+++ + +++++               L      +  L  + +  LP+ L +IF      F   +   +  V+++ ++  P+  +A+    LT   L  ++++ +  + + +  +P  L AL +N  G+  +K+   +  ++K  T   ++ A+
Sbjct:   28 ELIHEPLACFRWEFDKGDFHHWVDLFNYFDTFFEKHVQVRKDLHIEENFEESDPPFPKDAVLQVLRVIRVVLENCTNKHFYSSYEQHLSLLLASTDADVVEACLQTLAAFLKRQIGKYSIRDASLNSKLF-----SLAQGWGGKEEGLGLTSCAAENSCDQVSLQLGRTLHFEFYPSDESPSEL------PGGLQVIHVP----------DVSICAESDLELLNKLVIDHNVP-PSLRFALLTRMRFARAFSSLATRQQFTCIRLYAFVVLVQASGDTENVVSFFNGEPEFVNELVTLVSYEDTVPEKIRILCLLSLVAL---SQDRTRQPTVLTAVTSGGHRGLLSGLMQKAIDSVV---------CITSKWSLAFAEALLSLVTVLVSSSSGCSAMREAGLIPTLVPLI--KDTDPQHLHLVSAAVHILEAFMDYSNPAAALFRDLGGLDDTIFRLKLEVSRTEDDVKEKNCSSDSNGPDTEQLPYSEALISYHRRLLLKALLRAISLGTYAPGNTNLYGSEESLLPECLCIIF-RRAKDFGGGVFSLAATVMSDLIHKDPTCFNALDSAGLTSTFLDAISDEVI-CSAEAITCIPQCLDALCLNNSGLQAVKDRNALRCFVKIFTSPSYLRAL 625          

HSP 3 Score: 63.929 bits (154), Expect = 4.545e-8
Identity = 69/259 (26.64%), Postives = 109/259 (42.08%), Query Frame = 3
Query: 8415 NDEDIDNLSMEQLIAE--GIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLP-------ENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLS-DLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALL 9161
            NDE ++  S++    E   IDPTFLEALP+ +R EV+          QQ   +Q P       +++D E +A LP  IQ E+LA  R +    ++                   +  + ++S + +L   LR E+L    ++ +A L S L  EA+ +R    D  M   QA         R     +GL  + L+ M+RG         V   +R  ++  +   V +   +           PLV+ D L +LI LL
Sbjct: 2590 NDEQVEEGSLDGRAPEVNAIDPTFLEALPEDLRAEVL--------ASQQAQSVQPPTYEPPPVDDIDPEFLAALPPDIQTEVLAQQRAQRMVQQSQG----------------QAVDMDNASIIATLPADLREEVLLTSSEAVLAALPSPLLAEAQMLR----DRAMSHYQARSSVFGSSHRLNNRRNGLGYNRLTGMDRGVG-------VTIGQRAVSSSADGLKVKEIEGD-----------PLVNADALKSLIRLL 2802          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. UniProt/SwissProt
Match: sp|Q8H0T4|UPL2_ARATH (E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana OX=3702 GN=UPL2 PE=1 SV=3)

HSP 1 Score: 416.001 bits (1068), Expect = 1.518e-114
Identity = 209/428 (48.83%), Postives = 288/428 (67.29%), Query Frame = 3
Query: 10944 FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEEL-VQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISE-----FGQTETRD--LIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            F +FVEKH+++LN  +R+  +  L + +FS +LK P+L+DFD K+ YF++++   R+  D      L + V RA + EDSY +L  ++ ++ K R  ++F  EEG D GGL REWY  +S  IF+    LF    +  T+  NP S     HLSYFKFVGR +AKA+FD +LL  YFTR+FYKHILG+ + Y D+E  D  +++ L++LL+NDVS + LD TFS+   E     + +TE  D  L P G  I VTEE K EYV LV    +T AIR Q+++FLEG  E+IP+ L+SIFN+KELELLI GLPEID +DLK NT Y  YT  SP I+WFW+ +++F +ED ARF+QFVTGTSKVPL GF  L+G++GP + QI  A  S   LP+AHTCFN +DLP+Y++ +++ + LL AI E +EG+G
Sbjct: 3235 FSKFVEKHRRLLNSFVRQNPS--LLEKSFSMMLKAPRLIDFDNKKAYFRSRI---RHQHDQHISGPLRISVRRAYVLEDSYNQLRMRSPQDLKGRLNVQFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNDATFQPNPNSVYQTEHLSYFKFVGRMVAKALFDGQLLDVYFTRSFYKHILGVKVTYHDIEAVDPDYYKNLKWLLENDVSDI-LDLTFSMDADEEKHILYEKTEVTDYELKPGGRNIRVTEETKHEYVDLVADHILTSAIRPQINAFLEGLNELIPRELVSIFNDKELELLISGLPEIDFDDLKANTEYTSYTVGSPVIRWFWEVVKAFSKEDMARFLQFVTGTSKVPLEGFKALQGISGPQRLQIHKAYGSPERLPSAHTCFNQLDLPEYQSKEQVQERLLLAIHEANEGFG 3656          

HSP 2 Score: 74.3294 bits (181), Expect = 3.240e-11
Identity = 123/640 (19.22%), Postives = 253/640 (39.53%), Query Frame = 3
Query:  117 DLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLK--LDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWE-HILALFGTSNMDILHALLGLFYNFSKR--SNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAEC-----CVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSW-----DIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIK---------ICL------DSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAM 1946
            +LI E      W + K +   W D+    D    + V       ++   D+         ++ +L     ++E+   +  Y S+E H+  L  +++ D++ A L     F KR    Y  R  S N K+      S+A+ WGGK+ G GL  C     C   ++     T+ +EF     S S           + V   P          ++ ++ ES  EL+  L+  +N+   S + AL  RLR    F     R+     R+ A  +L   +   +  +S+     + V ELV ++   D     I+   L++L A+    +  +  P +        + G    +M++ I  ++ +      S     +  A+LS +  L  +    S+    +   GL+ ++  +I     +P ++   + AV + +  +       +       +D  + RLK E+          +C       + + +Q+      ++  R   +K++L  I  L      +  L  + +  LP+ L +IF      F   +   +  V+++ ++  P+  +A+    LT   L  ++++ +  + + +  +P  L AL +N  G+  +K+   +  ++K  +   ++ A+
Sbjct:   28 ELIQEPLASFRWEFDKGDFHHWVDLFYHFDTFFEKHVKVRKDLRIEEEFDESDPPFPKDAVLQVLRVIRLVLENCTNKQFYTSYEQHLSLLLASTDADVVEACLQTLAAFLKRPTGKYSIRDASLNLKLF-----SLAQGWGGKEEGLGLTSCATEHSCDQLFLQLGC-TLLFEFYASDESPSEL------PGGLQVIHVP----------DVSMRSESDLELLNKLVIDHNVP-PSLRFALLTRLRFARAFSSLATRQQYTCIRLYAFIVLVQASGDTENVVSFFNGEPEFVNELVTLVSYEDTVPAKIRILCLQSLVAL---SQDRTRQPTVLTAVTSGGHRGLLSGLMQKAIDSVICN-----TSKWSLAFAEALLSLVTVLVSS----SSGCSAMREAGLIPTLVPLI--KDTDPQHLHLVSTAVHILEVFMDYSNPAAALFRDLGGLDDTIFRLKQEVSRTEDDVKEIVCCSGSNGPEDDTEQLPYSEALISYHRRLLLKALLRAIS-LGTYAPGNTNLYGSEESLLPECLCIIF-RRAKDFGGGVFSLAATVMSDLIHKDPTCFNALDSAGLTSAFLDAISDEVI-CSAEAITCIPQCLDALCLNNSGLQAVKDRNALRCFVKIFSSPSYLKAL 627          

HSP 3 Score: 63.5438 bits (153), Expect = 5.462e-8
Identity = 71/258 (27.52%), Postives = 107/258 (41.47%), Query Frame = 3
Query: 8415 NDEDIDNLSMEQLIAE--GIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLP-------ENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALL 9161
            NDE +D  S++    E   IDPTFLEALP+ +R EV+          QQ   +Q P       +++D E +A LP  IQ E+LA  R +    ++   P                  + ++S + +L   LR E+L    ++ +A L   L  EA+ +R    D  MR  QA         R     +GL   L+ M RG         V   +R  ++  +   V +   +           PLV+ D L +LI LL
Sbjct: 2574 NDEQVDEGSLDGRAPEVNAIDPTFLEALPEDLRAEVL--------ASQQAQSVQPPTYEPPSVDDIDPEFLAALPPEIQREVLAQQRAQRMLQQSQGQP----------------VDMDNASIIATLPADLREEVLLTSSEAVLAALPPPLLAEAQMLR----DRAMRHYQARSRVFGSSHRLNNRRNGLGYRLTGMERGVG-------VTIGQRDVSSSADGLKVKEIEGD-----------PLVNADALKSLIRLL 2785          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. TrEMBL
Match: A0A183SSY5 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 PE=4 SV=1)

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 565/1564 (36.13%), Postives = 814/1564 (52.05%), Query Frame = 3
Query: 7914 ISMITNFRRWIVEARTLYGREITDLVMLARARVYQSVYHSVSSKLTE----ASVDEKEVVDSKTNMVKTANSNPDNVDNERN------SITDQTDIGRDVSMEQDLMMQPDIMIESLDEPNE---SVIGEEMV--------------TPTPSETMESRDEPIDNIEIEQPNEVISRVDQSLXXXXXXXXXXXXXNDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSS-TGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTD---PVTEAGEWPNLSAY-KPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKIS---LPKENTDSKPKIFXXXXXXXXXILCTPIGSGSCTDMSRSSSIQDDTFRQYPNNKSLFFHSFERGFALTDQVFVPSISKIYKHKNKSGIQSLEMPEITIHESVSGSVAKALIDSLSSISTMHTKEFFP----TSQSKKV------PTNFWFTLAWYMSLKSVSLEDQCPETHLPPNEE----------YDYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKSFSMKEKPVAAEWSIATNDGDNHESSTPTAS----TGNETPLSITKEKSETKAVNVSDPHLNRVNVKTISHL--------VNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMIXXXXXXXXXXXXPSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHXXXXXXXXXXRKV------DNSI--------LTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDC----SEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFM-------NSPAFSENGKH-------------------------------------NPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRN-DGD-SRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMST-NHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
             S++TNFR  I   R LYG+E+ D+++L+R   Y+   H++  +  E     +  +  V ++  +   T  +  DN     +      S  DQ  +G   S ++ +            EPN+   SV  E  +               P+ SETM     P      EQP    ++ +    +     +     +    D  ++  ++AEG+DP+FL+ALP+ +RRE++ +HRR  ++R QL+ +QLPE+V AE ++ LP +IQEE+L   R+E      ++     N          ++ T   +++FL SL PS+RRE+LADM+  QI  L  +L  EAR +R+E      RA+Q    S+ G  R R  T+     LS    GRWD R   Y       +  R+  A V     P   +G     S   + L+  +GLT ++ LL+ SS  P   +     + ++L++L  HP IR WI CTI+++L ++S   LP + T    ++    S S  S L  P+          ++S+    F         FFH      AL  Q+  P++ +     + S   S       +H      V   L+D+++ ++     +FFP     SQ ++       P++    L    +  +   E+     H   +             DYF+ L  L+R P++     + EKLLS +  +++ + K      +P     S  T    N E+  P ++    T +E   S     + T +  V      R+  K +S L        +  +C    +++T   T++ R  S RL+I +++ N  T   ++  L      +   ++  L  V++E                PS   + P     T   S S   L+S   P   NA    S R     + +    ++S+P    ++L++ S++P T +  +   L  + +L+  +      D S         +      S +W  LSQ LD ++ + + + V++ Q LVES  L HS        +      S    VS  +S +   L  +            SPAF  N  H                                     +P     E H+  LNHILR  +   L +S+F A L YP+ LDFDIKRR+F+ ++  + N DG  SR+E+E V VSR R+FEDSY RLHRK+A EWK +F I+F NEEGQD GGLLREWYL MS EIFNPNY LF+VSP D VTYTINPAS++N+NHLSYFKFVGRFI KAI+DNKLL CYFTR+FYKH+LG+ +R+ DLE EDY F++GLEFLLK+DVS +  D TFS +I+EFG+ ETRDLI +G  I+VTE NK+EYVRLVCQE+MTGAIRQQL++FLEGFYEIIPK+LISIFNE+ELELLI GLP ID+ DLK NT Y+KY P SPQ++WFW+ALESFDQEDRARF+QF+TGTSKVPLGGF+ LEGM+GPTKFQIS A +S+ NHLP+AHTCFN+++LP YE++++L + LLTAIRECSEGYGM
Sbjct: 2780 FSILTNFRHLIDVCRILYGQEVMDMILLSR---YEVGVHAIRRRGDEFRERLAAHQASVNNAAASAETTTEATADNSSAAAHVPLLAPSTEDQAFVGAAASDDRYIRASVQSEWAPPHEPNDLASSVRPEASMEHQSASQSEREVAEPPSSSETMSVPSNP------EQPTAGDAQSNVPTPSAAPPLIVTEEIHVPVTDEETIASMVAEGMDPSFLDALPEDVRRELLADHRRTRQLRSQLSSMQLPEHVSAEFLSSLPPNIQEEVLTQVRQETQRQTGSDETQGQNTARAGEAANGAAATPENNAAFLASLPPSVRREVLADMEDFQIDLLPPDLQQEARTLRREHEAQFARAVQGR--SLPGLFRPRLDTTYFWQTLSGF--GRWDSRAGSY------NRLIRNGGAPVLGSRGPSAFSGLQSFFSGRNRHLIDHEGLTCILTLLVVSSACPVQRRHTVPALKRVLRNLASHPGIRNWIICTILSLLKRLSEKPLPPDLTVGGSRL----SPSMQSALRGPM----------ANSLFAAGFEAALGCWVRFFHPLPAFNALPPQL--PAVDESAPGPSTSEPVSTTDVVYIVHPQAVNLVCSTLLDAIADLARNCPPQFFPLAPHVSQRQESISDTTQPSDGSHDLPALPNANTTLSENSATAKHKRNSSASVDVDTDVCCLDYFSQLASLLRHPVISCRPPLQEKLLSILVGVVREFCKRSRALHQP-----STTTAPLINRENVEPASAMAEGTTSEASSSQYAGGAMTSSSAVGGDAPERIPKKPVSDLMLCPQHAVIECLCELVVAAKT---TEQARSLSVRLVILIAQANAKTNAQMLHYLCKAASDLSAIISRQLKAVINEV-----------DSLPPSNKASLPSSSKTTIPLSASMTRLSSVSDPEVSNA-GDPSDRFLAPTLVASLPSSSSVPPATASELELSSLQPLTTSRSEQSRLCCVLHLILHMLSCGSEDTSTNDAHTKVTMESINGLSQLWEHLSQTLDRLETTNDANTVLLLQPLVESLCLAHSTVLRENGSVRRLSRVSTIGVVSSGISFIPNLLPPEADLYELPPITNTSPAFGRNSTHVDSEPLSPASTIDLNRPMSPPLSTLNNATDAVSETASSPIAHLAETHRASLNHILRNFSG-NLSESSFVAFLSYPRALDFDIKRRFFRQRLQAIANRDGSVSRFEDEPVVVSRGRIFEDSYARLHRKSAAEWKHKFVIRFQNEEGQDAGGLLREWYLLMSREIFNPNYCLFRVSPADRVTYTINPASFINSNHLSYFKFVGRFIGKAIYDNKLLECYFTRSFYKHMLGVRVRFVDLESEDYDFYKGLEFLLKHDVSELGYDVTFSTEINEFGKNETRDLIEDGRNIIVTEANKNEYVRLVCQERMTGAIRQQLNAFLEGFYEIIPKSLISIFNEQELELLISGLPNIDIEDLKANTTYSKYQPNSPQVRWFWRALESFDQEDRARFLQFITGTSKVPLGGFANLEGMHGPTKFQISRAVVSSINHLPSAHTCFNTLELPPYESYEQLRERLLTAIRECSEGYGM 4287          

HSP 2 Score: 743.421 bits (1918), Expect = 0.000e+0
Identity = 488/1442 (33.84%), Postives = 748/1442 (51.87%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPK---CHRR------KLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILC-----------------------YTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQG-----NLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSE--IDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDXXXXXXXXXXXXXXYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMPLQENVDSQEIASTAGPS-GVYSSDSNQAADLLAVMTAVEEADREV-----------EQIMEMSGDEDDGVAD----------------------------NEMTQAID------AEEDRTPSDGCGKDNKTEEMNQFSCDDDAV----YLMDYICNVCKFMERFM-SDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQLYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLR---------QDILAELKSGIIDYARLLPLLNWEAMVLMNLLFEDEEACLEDLKR----LCINERGTCADNEHNEER------CFLTKKSS---LSTCQQLFSDNPRSEKIIKRMLQITQKAANDMVELLVTLTKFCCVKPDYSXXXXXXXXXXXGSIPTGKNKMALLNKIAEHCKSLLERESPYTLQAGQDSW-PEDPHSELPVEKACQKILSDIKFL---HPMKYFCFTTIHRILTGGDLNKKPFLGFFYAFQMNNGLEVFFECANELLDTIRYIQYLDPNANSSVKIMLESFLITVDRMTQIRRITQEFVDSTDKELRDKFDIDLYQRMIRAYMLEP 3998
            MKIDRKKI NRCG+DQ EC  LA  L+ L +++ I E+++I VW+YGKCELGLWAD+LDRLD IL    T+VG WT+K+D P NE L+  ++ +LEFTGHLIEHSIYR LYGSW HIL LFG+SNMDIL A+LGL YNFSKRSNYFSRLD+ N+K++L+RL SIAE WGG +  F LA CC   + P  AG + +E+  DV++  +  K+D         + P+   C          + + +L    ESPS++ME L++K+ +    ++MALFAR+RL VYF  PE+R   I  R+QA+S LC                       YT E+ D+ L   +V+ELVDVL+LPD +F+ IKACALRT+TAI    ++      +   TGM+S+HG  PT +R+WI  LV         +V Q YT A+LSFLYHLA   E   +  G      L  +G+LDSM ++I WH    D +S+ TRAVRVTDQIL++     ++TN+++ ++ +VDRL +E+ + L ++  +D    +++ LNTQR G +KS+LNL+KRL LD +W++ ++ +M+G LP IL  I+ N    F P L LF+ME +TN++Y +PS +S MQE  +T  IL  LT QPLP NRDFLV LP++L+ L++N RG   ++   I++KY++TL    +++ M+ +R+R+  +    S   +      +  T+ QMSN++ EL R++  + KP +++S+ + F+ V  +G  Q AP+L                     +P T+  +E+          +  ST G +  V+SS++   + +     AV +A               E ++ +SG ED+G A+                               T  ID      +E   T +DG   D K   +++ S   DA      L +YI N+CKF+ER + S Q     + +Q  ++ GL+ + D+LT+P LPYDFP S AC S+ KIFE L+S+ + ND      +   + + + D L K+      + L  +    S  F D  A          E GV  LH LV +S+++ +  +I + L    R         ++IL +L         L   ++WEA++L+  L ++ +   +        L ++   T A+ +  + +       F+   S    L  C Q+     +++ +   +L +     N + EL  TLT+FC   P  S   R         +P    K ++L ++A+             L  G   W P D             +L++  FL   + ++Y      H +L     +K P +  F AF M NG++  F   N+L        +L    + ++  +LE +   V R++ I  +  E    ++ +    F+ + Y   +    L+P
Sbjct:    2 MKIDRKKIGNRCGYDQNECMLLAKHLSTLSDDEFIQELRRIKVWNYGKCELGLWADILDRLDGILENAATRVGAWTIKVDLPENEKLVEDVVTVLEFTGHLIEHSIYRCLYGSWNHILTLFGSSNMDILLAVLGLTYNFSKRSNYFSRLDAANKKMILDRLISIAETWGGSESHFDLASCCQPNHFPPMAGKIYFEYQPDVANSLNHEKKDEVAGISRSVLLPRLVVCPNTMSLSGPDVIIEDLKGCRESPSQIMEALLKKHPVP-LPNRMALFARIRLAVYFSDPEKRLKCIRARLQAISTLCMLCRPQFPSLFQLFTYVMLFFSCYTFEINDRLLYPSLVDELVDVLQLPDGDFMEIKACALRTMTAIFSSHRVNVNLMSILESTGMSSFHGALPTRIRKWIQGLVDGSCDAAGGSVNQQYTIALLSFLYHLASFEENIGSGSGQNHATTLSTSGILDSMLQLIAWHVPRNDCLSYVTRAVRVTDQILMN-----AATNRQTVVNRLVDRLGYEVDLVLSNQGKLDATGGQALLLNTQRSGLMKSILNLLKRLCLDTDWNDAVRTSMEGNLPQILCSIYKNSVFHFTPHLALFAMETVTNYIYTYPSRISNMQENGITCGILSALTTQPLPQNRDFLVHLPSILNTLALNTRGRAALRSCGILNKYLETLVSPDYLSTMKARRVRDFHSQISYSLAPSAGQVFSTNLTASQMSNSIQELLRSHNEL-KPAVFQSLVECFRKVVRLGCSQSAPIL--------------------PSPETLGSSELESEGSCRSFNQSYSTHGRNLNVFSSENRPDSRMTVTSAAVIDATNPTANRTPGGVLLDEDLVMLSGSEDNGSAEDDDENDDMPDVGLTASRTAVSSSTIFRTTARTAHIDTTDSSVSESHSTTTDGDTPDQKPSALSEASISSDAPESFQNLPEYILNLCKFVERLLPSMQHVTEGMCRQFVNQGGLQVLCDLLTMPGLPYDFPVSAACASLCKIFEQLVSYLSLND------LLKPVLQALQDGLSKVS-----NFLASETTEYSLLFTDCSA---------NETGV--LHGLVCISSILCVLVQIINHLKPEHRCGFASLWAQRNILGQL-------GELYHKVSWEAVILLKALCDENKDLTQPGSSTSYPLPVDANETSANTQTAQSKPPFSMPAFVEALSVYRILKPCLQVHQPT-KTKSLAHYILHVCSYFINSVTELCTTLTRFCVASP--SQPQRRLLMSSFDQVPLSA-KTSVLTQVAQ-------------LAIGALCWRPPD------------AVLNNSDFLLFVYAVRYSSVRLAHLLLFDAS-SKSPQILMFNAFYMLNGIQSLFSIFNDLASFNSSTDFL----SGALSTVLEEWFACVYRLSNIVAVKAEVKKMSETDAV-HFNTNKYANYVNRLSLKP 1352          

HSP 3 Score: 94.3597 bits (233), Expect = 8.429e-15
Identity = 117/495 (23.64%), Postives = 207/495 (41.82%), Query Frame = 3
Query: 4518 DIITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSGKEISGANIEDSPNGLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLFKSFMAVP-----------HQTETFKTS----VLKHITQLWL----IIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLPSK----SKDQRKFEN----LSEYEHKIISC-VPDPLGDEEVVELSDNMLQFLISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQ--QFETPQLLQ-----HTISDILDKNVSKGAC----VLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIELNCQTEKQV-----LKTYSISKSPSLTSKATQPLM----ELEKKQIAIVRFLVES 5858
            +I+ +I +++L + Q  + +E ++A    +   S       L  L+   S        + D+  GLH++ LL+ + RF        + ++  L  +      +  + P            +   + +S     L+    L++    I+DQYER   A+R+RK  +  Y+ C +W W D+R  +WHP +       + ++ NG  +A    +  N Y   F ++TQ N  S   RP++L+P      S D  +       +++YE  II+   PD L  +    L   +L+     +  +     +CL +   LL+RL    S       A    +  L  + H   ++ Q   FV  ++RQ  QF +  L       HT+  IL  ++S        +LHK         +DLFY +    PL+ +  E  + LM +   L    EK +      K++SI     L + A   ++    EL  +Q  IV F++E+
Sbjct: 1532 EILHQISELMLCSKQETQCIENLVAAVTTNLFAS-------LGVLLPTPSSP------VTDTGVGLHLIALLFTRCRFVCAQMVHKYSLILVLTALITDDVDTLRSHPLPVLLNLGESSAKPSAYMSSQSLVALEGDEDLFMLAAIILDQYERAVAAIRLRKKSVELYKDCHSWSWFDERANLWHPQAPDLFQAADAAFHNGATRAQWSID-RNRYAIEFPTMTQVNLSSMHRRPVLLMPCSLSPTSSDSPRPTGSTTQVTDYEGMIINMEPPDGLSADLRRSLCLALLRRF--DRSTEKPLSAECLNSFLRLLLRLT-ASSFEDAETVANADGLRVLFALSHPFEFSSQYSAFVGHIIRQASQFSSEFLFAYVSNLHTL--ILFDDLSTVTVTMQQILHKFAEGVCSSCRDLFYLLSLCAPLVAKAEELAIRLMKETFSLVVD-EKSIEDGVPPKSFSIVN--PLETPANDAIIDVSPELNNRQKHIVVFIIEA 2004          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. TrEMBL
Match: A0A4Z2CZ75 (E3 ubiquitin-protein ligase HUWE1 (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_006247 PE=4 SV=1)

HSP 1 Score: 774.622 bits (1999), Expect = 0.000e+0
Identity = 446/1113 (40.07%), Postives = 649/1113 (58.31%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVS-SLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNE---VNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDXXXXXXXXXXXXXXYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLG----------NGKPGSIQKALNHHHNNEHSNPITIDDNEIMPLQENVDS-----QEIASTAGPSGVYSSDSNQAADLLAVMTAVEEADREVEQIMEMSGDEDDGVADNEMTQAIDAEEDR--TPSDG----------------CGKDNKTEEMNQFSCDDDA---------------VYLMDYICNVCKFMERFMS-DQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQ--LYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLRQDILAE-LKSGIID-YARLLPLLNWEAMVLMNLLFEDEEACLEDL 3188
            MKIDRKK  NRCG+DQ EC  LA  L+   ++ LI+E+K+INVW+YGKCELGLWADVLDRLD IL   VTKVG W L+LD PGN  L+  ++ ILEFTGHLIEHSIYRYLYGSW HILALFG+SN+D+L A+LGL YNFSKRSNYF RLD +N++++L+RL SIAE WGG ++GFGLA CC  ++ P +AG + +E+  +   S SSA +   N  S     K       + L+ LH + ++PSE+ME L+  + +   S QMALF+R+RL  YF  P QR   I  R+QALSIL YT EV+++ L   +++ELV+VL LPD +++GIKACALRT+TAI++  +L   W  L   TG++SYHG  P + R+WI  LV  + +  A +  Q +TTA+LSFLYHLAC  E     +T    L  +G+LDSM ++I WHT   DY+S+ TRAVRVTDQILLS      S++++  +  +VDRLK+E+++ L     Q +  S  LNTQR G +KS+LNL+KRL LD EW + L + MD  LP +LR +F+N +T F P L LF+ME ITN++Y +PS +SAMQ++ +T DIL+ LTEQPLP NRDFLV LP LL+ L++N RGI  I  S II +Y+ TL  + ++T M+ KR+R+ ++         +  +  ++ T+  MSNA+ EL R++    KP++++ +    + V N+G K PA LL           N  P S + ++N                 I    E V        +I+   G S   +S     +++ + +  V E D     ++ +SG ED+   D++    ID  + R  +P  G                 G  + + +    S  +D                ++L D++ N+CKF+E+ +        ++  Q  S+ GL+ + D++ +P LPYDFP S +C S+ KIFE L +     D I   +  F+  +   D L+ L   Q  + SILL++Y++   E                     +LH+LV +S+V+ I  ++ + +   +R  +    L  G +    RL   ++WEA +++ +LF D++    D+
Sbjct:    1 MKIDRKKTVNRCGYDQNECMLLAKHLSVCPDDQLISELKQINVWNYGKCELGLWADVLDRLDTILENAVTKVGKWMLRLDAPGNSSLVDDVVTILEFTGHLIEHSIYRYLYGSWTHILALFGSSNLDVLLAVLGLSYNFSKRSNYFIRLDPSNKQMILDRLVSIAETWGGAENGFGLAACCDPKHFPETAGNVYFEYRSEQPLSRSSAPQ---NLPSPSDQTKSLNSSGTVILQALHRRNQTPSEIMEELLAIHPVP-ASQQMALFSRVRLATYFADPSQRHKCIRARLQALSILSYTFEVDERHLYPSLLDELVEVLGLPDDQYMGIKACALRTMTAIVNSHRLGINWGSLVGSTGLSSYHGILPNLTRKWIQGLVDGRIKAPAGSTNQHFTTALLSFLYHLACYEENVAPGNTQNTTLSSSGVLDSMTQLISWHTPHNDYLSYVTRAVRVTDQILLSI-----SSSRQHVVSILVDRLKYEVEVVL-----QSSTSSDTLNTQRSGLMKSILNLLKRLCLDAEWGDALHSVMDDNLPSVLRQVFLNGSTHFTPHLSLFAMETITNYLYTYPSRISAMQDKNITSDILKALTEQPLPQNRDFLVQLPALLNTLALNSRGIEAILSSGIISRYLNTLVSTEYLTTMKTKRVRDFISQIPYDMNCNSGQNLSNSLTASLMSNAIQELLRSH-TELKPVVFKCVISCLRHVVNLG-KTPATLLSENVSCNPAVYNILPSSTRDSVNF---------------GIRSFAEVVSEPVHHRTQISPDCGTSQPTTSAPLSLSNIQSAI-GVNEDD-----VVMLSGGEDE---DDDYNSDIDGNQGRQASPRSGTVQGGTMVSGALVSMISGLGSSSSKCENVSLVNDPSNTIRNESCALVTPNLFLSDFMLNLCKFLEKLLPFGSHTTDAMYPQFVSQGGLQVLCDLIHMPGLPYDFPVSASCASLCKIFEDLANSVNLTDVI---KPLFQFLESSLDMLRSLHDSQYPVTSILLREYLSGERE---------------------MLHELVTISSVVCILVQMIEHIKTEIRLPLANSWLTQGCLKTLGRLYLGVSWEAGIILKVLFGDKDITESDM 1049          

HSP 2 Score: 316.62 bits (810), Expect = 5.310e-82
Identity = 206/616 (33.44%), Postives = 321/616 (52.11%), Query Frame = 3
Query: 10026 PLSITKEKSETKAV---NVSDPHLNRVNVKTISHLVNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMIXXXXXXXXXXXXPSGSTASPIKKSNTFTESISS----DILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHXXXXXXXXXXRKV---DNSILTQFQSPSS-------------IWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCH----------------------SDCS------------------EIHEEHNKSDNSNVSDPLSHL----------------NTSLVVDDTFMNSPAFSENGK---HNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDS--RYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQ 11618
            P SI++ +  +K +   ++S+  +N +  + I  L  ++ A       P  ++  R+ + +L+ +L++ N   K+ I+RLL+  +  ++  ++  L  ++ E   +     +    + P   +  P   S+ +   IS     D+L        +    S+ SR   ++               F+ L++ S + FT    D   L  +  L+ +V   D+S++     P S              W+ L Q  + +Q   + +AV++ Q L+E F L H                      + CS                   I      ++ S+ +D L+HL                   L V D+ +++   + +      NP +EF +K+++ L+ +LR+  A  + +S F+  L YP++LDFD+KRR+F+ ++  L N   S  RY+++ + VSR R+FEDSY RLHR++  EWK +F I+F NEEGQD GG LREW+L MS EIFNPNY LF+VSP D VTYTINP+SY+N+NHLSYFKFVGRFIAKAI DNKLL CYFTRAFYKHILG+ +R +DLE EDY+FF+GLEFLL ++VS +  + TFS +
Sbjct: 4081 PTSISENQLSSKHLPMSSLSNNLMNPLRPQVIETLCQLVLA-------PKFSETARIMTTQLITDLAQANPYMKELILRLLSITVGHLIANISNQLQCLVSE---VDRRLKDSISNSPPKSDSYKP--SSSRYPSEISRISSYDVLPDRFGIPGQMVVVSSDSRAQSSK---------------FSDLQLASSEAFTCPNNDQCRLRGILGLMLRVAAGDSSLVGSNPIPVSSDDLLNSVPGVNEFWNYLCQAFEKLQALNDQNAVLLLQPLLEVFCLAHVHLVKDTILLRQRPTNSRSNRTNSCSPGTLSFIDMVPLLHMCVDSISHSELDANRSSTTDHLAHLYFDLGGPQSPNVTATGEDDLTVTDSVVSASCTTASQSPFSRNPIIEFADKYRRGLSQVLRQHGA-NIGESPFAVFLAYPRVLDFDVKRRFFRQQLQSLSNRSTSSNRYDDDPITVSRDRIFEDSYARLHRRSVSEWKHKFVIRFQNEEGQDAGGPLREWFLLMSREIFNPNYCLFRVSPADRVTYTINPSSYINSNHLSYFKFVGRFIAKAINDNKLLECYFTRAFYKHILGVPVRCSDLESEDYEFFKGLEFLLSHNVSDLGYELTFSTE 4668          

HSP 3 Score: 166.392 bits (420), Expect = 1.745e-36
Identity = 183/669 (27.35%), Postives = 303/669 (45.29%), Query Frame = 3
Query: 7929 NFRRWIVEARTLYGREITDLVMLARARVYQSVYHS-------------------VSSKLTEA-------SVDEKEVVDSK------TNMVKTANSNPDNVDNERNSITDQTDIGRDVSMEQDLMMQPDIMIESLDEPNESVIGEEMVTPTPS-ETMESRDEPIDNIE-IEQPNEVISRVDQSLXXXXXXXXXXXXXNDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLT---NPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQL------TSGLSDLLSQMNRGRWDQR---NIRYVVFSER--GQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKISLPKENTDSKPKIFXXXXXXXXXIL---CTPIGSGSCTDMS-----RSSSIQDDTFRQYPNNKSLFFHSFERGFALTDQVFVP-----SISKIYKHKNKSGIQSLEMPEITIHESVSGSVAKALIDSLSSISTMHTKEFFP-----------TSQSKKVP-TNFW 9716
            ++RRW   +R L+G EI DL++L R  +Y+++                      V+S L E        +V  K +++S       T  + T  S  +N  N +    D   +  D S   +  +  D+ +    E     I  E+ +  P   T ++  +P +  E I       +  +            +    DE+    +++ L+  G+DP+FL+ALP+ MR+EVI +HR A +V+Q++  + LP ++++E +  LP HIQEE+LA +R+E    + ++    T     ++   P  + S    +++FL+SL PS+ RE+LADM++SQ+  L   L  EA ++R+E  +  +RA+Q  +LS +   R  Q       TSGL        +GRW  R   N + VV      G  + +N  AV    T AG    LS+ + +V  +GLT +IALL+ SS+S +  + I   V K+L++L+CH   R WI  TI+ +   +S        KP  +   +TS S      C PI S S    +      SS  +     +   N +LF   FE       ++F P     + S  ++      I +       IH   + SVA  L+++LS ++      F+P           TS +   P T+FW
Sbjct: 3244 HYRRWTNLSRMLFGHEIMDLILLGRHYIYKALEQKRHELFNLRIAENEIVCLPVVTSSLNEPLVSSPALTVSSKSIIESPETSVTFTTPLVTCISTSENTRNSQELSADLQPVAGDSSNAFN-QINSDVCVS---EAAIGSIASELSSSNPVFSTAQNFPQPTNTTENISNLVSSSNASNSDDNPTSATPTRSLVMTDEE----TIQSLVEGGMDPSFLDALPEEMRQEVIADHRYARQVQQRINSMGLPGHINSEWLTGLPPHIQEEVLAQFRQEQQQQQQSSTQPTTTSGETDTSEQPASTQSATDSNTAFLISLPPSVLREVLADMEESQLETLPQYLVVEANRLRREHEERYVRAVQNGILSHSNDPRPYQFWRNFTTTSGLFG----GGQGRWVVRFHSNDQIVVHPNNIDGPLSLNNALAVR---TMAG----LSS-REIVDHEGLTCIIALLVASSSSSNQRQNIVPTVKKVLRNLSCHSATRNWIVNTIIFLFNGLS-------EKPPPYLHFTTSCSMPFTEDCEPIPSTSTNQKTSFPGINSSENELQCSTKPTGNNTLFHTGFEAALGCWVRIFHPVPQNLNDSHTFESNYSKDISTAVPVRYIIHPQGAVSVAGVLLETLSELTRAFPSHFYPPDICQLSESAGTSHTTDTPSTSFW 3885          

HSP 4 Score: 108.997 bits (271), Expect = 3.412e-19
Identity = 113/518 (21.81%), Postives = 212/518 (40.93%), Query Frame = 3
Query: 4395 REISTIEARLKELEMKNVSIKEMIKESFLINLFN-----LQKEKGIDIITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLI----LNHSGKEISGANIEDSPNGLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLL------------------------FKSFMAVPHQTETF-KTSVLKHITQLWLIIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLP-----SKSKDQRKFENLSEYEHKIISC-VPDPLGDEEVVELSDNMLQFL--------------ISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIEL---NCQTEKQVL-KTYSISKS 5774
            + +ST +  L  +E+ N       +ES   N+F       ++     I+ +I ++ + +G+   ++ ++ ++      +   I S  L T       ++     +    E    GLH++ LL+ +          NH + + L++  + L                        F    A  H +    K+   K +T  +L++DQYER+  ALR+R++ +  Y     W W D++  +WHP +   N  I++S+  G L A    N    Y   F ++TQ N  S   RP+ML P     +++  +    + + YE  +++  +P  L  EE  +L   +L                 +S K++      DCL A   LL+RLC      ++ LA     +  L + PH + ++ +   FV  L+ + F+        + +I  +    G   +        +  +DLFY +    PLL ++ E ++ L  +   L   +   E +V  KTY + +S
Sbjct: 1626 KRLSTSKFPLVMMELCNEKTYNESRESLKQNVFKTCYAIAKRHHSYQILHQIAELFISSGEHERYINELFSVVTSHLKSYLGITSTALETTKSSNNFDNESHGFTNHEKEHQTVGLHLVALLFTRCPLVCACLAWNHKLPSVLIQFVSDLDLLNTAAIGDDVALHEQTTMEVDGFSGGDASSHNSNHISKSDYYKTLTLAFLVLDQYERSIQALRLRQESVKLYASSHNWHWFDNQAMLWHPYTNDSNRIIDKSFHKGDLCAGCDIN-RRPYTVEFPTMTQINLVSMHRRPVMLFPPTNENTEADQETSSSHATSYELSLMNTEIPKCLSAEERSKLCHALLTHFRLFKNEPSSELHSSMSTKQLP--LSSDCLNAMFRLLLRLCFTSHENADELAE-ADILKTLFSYPHTREFSPEFSAFVGALISEIFDDASTTDRIMKEIFIRMSRSGMPNVFMGIDAGPRACRDLFYLLSLCAPLLAKNRERSLRLAVETFNLSLPDSDIESKVYPKTYIVEES 2139          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. TrEMBL
Match: A0A4S2M655 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002440 PE=4 SV=1)

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 439/1120 (39.20%), Postives = 653/1120 (58.30%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQ------SSVDV-----------FIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNE---VNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQMTKKSV--ALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDXXXXXXXXXXXXXXYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMP-----------------------LQENVDSQEIA-STAGPSGVYSSDSNQAADLLAV----------MTAVEEADREVEQIMEMSGDEDDGVADNEMTQ---AIDAEEDRTPSDGCGKDNKTEEMNQFSCDDDAVYLMDYICNVCKFMERFM-SDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQ--LYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLRQDILAE--LKSGIIDYARLLPLLNWEAMVLMNLLFEDEEACLEDL 3188
            MKIDR+KI NRCG+DQ EC  LA RLAA  ++ LI+E+K+I+VW+YGKCELGLW DVLDRLD IL   VTKVG W L+LD P N  L+  ++ ILEFTGHLIEHSIYRYLYGSW HILALFG+ NMDIL A+LGL YNFSKRSNYF R+D  N+K++LERL SIAE WGG ++ FGLA CC  ++ P +AG + +E+  D    S  G    +Q       S D+           +  PK    K+ LR LH + +SPS++ME L+ ++ L   S QMALFAR+RL  YF  PEQR   I  R+QALSIL YT +V+++ L   +++ELV+VL+LPD ++ GIKACALRT+TAI++  +L   W  L + TG++SYHG  P++ R WI  LV    +    +  Q +TTAILSFLYHLAC  E     +T    L  +G+LD+M ++I WHT   D +S+ TRAVRVTDQIL+S      +T++ + ++ +V+RL FE+ + L +  D   ++ +  ALNTQR G +KS+LNL+KRL LD +W E +   M+  LPDILR +F+N +  F P L LF+ME ITN++Y +PS +S+MQ++ +T DIL  LT QPLP NRDFLV LP L + L++N RGI  I+ S ++ KY++TL    ++  M+ KR+R+ ++    + +++T  S  ++ T+ QMSNA+ EL R+ + +  P+ ++ +    K V  IG+ QPA L+         + ++  H       +  DD+  +P                       L  ++ + ++A ST+G  G+  +D     D++ +             +++  R  +         +  + D+  T    +++ +ED  P++          +   S      +L D++ N CKF+E+ + S      ++ +   S  GL+ + D+L +P LPYDFP S +C S+ KIFE L +    ND I      F+  +   ++L  L+  Q  L S+LL++Y+                      N   LLH+LV+ +++I I  +I D L + LR  +  +  +++ +    RL   ++WEA +L+ +L+ D++    D+
Sbjct:    1 MKIDRRKIVNRCGYDQNECMLLAKRLAACPDDTLISELKQISVWNYGKCELGLWVDVLDRLDAILEHAVTKVGRWMLRLDLPENASLVDDVVTILEFTGHLIEHSIYRYLYGSWNHILALFGSENMDILLAVLGLAYNFSKRSNYFVRMDHHNKKMILERLVSIAETWGGSENNFGLAACCDPDHFPETAGNIYFEYRPDSKDGSFIGGNPPSQLETETTPSGDIAEHTDGCGNVEWTAPK----KIVLRALHRRNQSPSQIMEELLSQH-LLPPSKQMALFARIRLATYFAIPEQRHKCIRARLQALSILSYTFDVDERHLYPSLLDELVEVLELPDGQYTGIKACALRTMTAIVNSHRLGITWTSLVSCTGLSSYHGILPSLTRRWIQGLVDGTIEAPGGSTNQQFTTAILSFLYHLACYEENVGPGNTQNATLSSSGVLDTMLQLIAWHTSRNDCLSYVTRAVRVTDQILMSI-----ATSRLNVVNILVNRLSFEVDLVLKASTDGKIQQDLGPALNTQRSGLMKSILNLLKRLCLDTDWGEVMHTVMEDTLPDILRQVFLNGSIHFTPHLALFAMETITNYLYTYPSRISSMQDKNVTTDILTALTSQPLPQNRDFLVQLPGLFNTLALNARGIEAIQSSGVLSKYLETLVSPDYLPTMKTKRVRDFLSQISYNLSSSTGQSLSNSLTASQMSNAIQELLRSRSELKTPV-FQGLVACMKRVVEIGRMQPASLVVEPV-----RCISDTHT------LGTDDDAKLPSEPPDSTVCEHLGSDLPCLTGVALGRSIGTSQVATSTSGGQGIGETDPMLEEDVVMLSGDEDEDGDDDHDIDDVSRATQTAAHQHRSANTRLMDSRSTSPTASLNLKEDLAPTN-----RPITSLADGSPVPAYHFLSDFMLNTCKFLEKLLPSVLHVTEAMCRHFMSHGGLQVLCDLLRMPGLPYDFPVSASCASLCKIFEDLANSIYLNDVI---APLFQCLESSLEKLAPLQNSQFTLTSLLLREYM---------------------ANEHVLLHELVVTASIICIMVQIIDHLKSELRPSLADKWLVRNVLHSLGRLYLGVSWEACILLKILYGDKDITEADM 1069          

HSP 2 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 385/890 (43.26%), Postives = 529/890 (59.44%), Query Frame = 3
Query: 9804 DYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKSFS-MKEKPVAAEWSIATNDGDNHESST------PTASTGN-ETPLSITKEKSETKAVNVSDPHLNRVNVKTISHLVNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMIXXXXXXXXXXXXPSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHXXXXXXXXXXRKV---------DNSILTQFQSP-------SSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLC--------------------------------HSDCSEIHEEHNKSDNSN--------VSDPLSHLNTSLVVDDTF--MNSP--------AFSENGKH-----------NPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQL--RNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASM-STNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            DYF+ +  L+  PL+Q+  +  E++L+ +  ILK +  +   M E+      ++ T    +  S        P A  G  E+  +  +E ++T + +V    +  +  + +  L   +C       +P  T+  R  + +L+ +L+  N + K+ ++ LL  ++  ++  L+  L +  DE    L+++   +   +        +K S++ +  +S D+L    S S +              VS G SR N  P  AF  L+++SI+ FT    +   L  +  L+ ++         + S+    Q P       S  W  LS V + +QK  + +AV++ Q L+E+F L                                 HS    I     + D+S         V +PL + NT+ +  D    M+ P        AF ++              N  L+F E+H+  LN +LR+    +L +S F+  L YP++LDFDIKRR+F+ ++  L  R+   +RY++E + +SR RLFEDSY RLHRK+  EWK +F I+F NEEGQD GG LREWYL MS EIFNPNY LF+ SP D VTYTINP+SY+N+NHLSYFKFVGRFIAKAI+D+KLL CYF+RAFYKHILG+ ++ +DLE EDY F++GLEFLLKN VS +  + TFS +I+EFG+TETRDLI NG  + VTE+NK EYVRLVCQE+MTGAIRQQL +FL GFYEIIPK +ISIFNE+ELELLI GLP ID+ DLK NT Y+KY P SPQI+WFW ALESFDQEDRARF+QFVTGTSKVPLGGF+ LEGM+GPTKFQIS AS+ STNHLP AHTCFN++ LP YE +++L   LLTAIRECSEGYGM
Sbjct: 3825 DYFSQMADLLCHPLLQNRPSNQERVLTILAGILKEFIVNRGRMDEQSATTGQTVETTATLSQPSEQLEQPIPPEAVVGQPESSATGVQEPTKTSSASVPPDFVGSIRPEALKTLCEFVC-------SPKSTESGRSMAAQLITDLAHTNRDMKELMLNLLAESLNTLIGKLSVQLQEFSDELTSQLKSDTVISLKQKERA-----MKPSSSISRLVSMDVLPDRFSSSGQTVV-----------VSGGDSRPN--PATAFCDLQLKSIQAFTCPNNEQSRLRGIVGLMVRLTAGECSLNANASVSVSNQDPFASITSLSGFWPKLSSVFEKLQKCPDMNAVLLLQPLLEAFCLAHLHLVKDSIMIRQRSATSRTNRPTITVTASGAHSLVDMIPMLQVRVDSSTPSASERDEVREPLINENTTHLQLDVMGPMSPPTLSTEDDKAFGDDATRCRRGSSNSATANAILQFAEQHRIGLNQVLRQHGG-SLGESPFAVFLAYPRVLDFDIKRRFFRQQLQALSHRSPLSNRYDDEPILISRDRLFEDSYARLHRKSPAEWKHKFVIRFHNEEGQDAGGPLREWYLLMSREIFNPNYCLFRTSPADRVTYTINPSSYINSNHLSYFKFVGRFIAKAIYDSKLLECYFSRAFYKHILGVPVKCSDLESEDYDFYKGLEFLLKNHVSDLGYELTFSTEINEFGKTETRDLIENGRNVPVTEQNKKEYVRLVCQERMTGAIRQQLDAFLAGFYEIIPKRMISIFNEQELELLISGLPNIDIGDLKANTTYSKYHPNSPQIEWFWCALESFDQEDRARFLQFVTGTSKVPLGGFANLEGMHGPTKFQISRASVSSTNHLPCAHTCFNTLVLPAYETYEQLRARLLTAIRECSEGYGM 4688          

HSP 3 Score: 193.741 bits (491), Expect = 8.722e-45
Identity = 179/664 (26.96%), Postives = 296/664 (44.58%), Query Frame = 3
Query: 7905 FNDISMITNFRRWIVEARTLYGREITDLVMLARARVYQSVYHSVSSKLTEASVDEKEVVDSKTNMVKTANSNPDNVDNERNSI----TDQTDI-GRDVSMEQDLMMQPDIMIESLDE-------PNESVIGEEMVTPTPSETMESR-------DEPIDNIEIE--QPNEVISRVDQSLXXXXXXXXXXXXXNDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYR--------------RENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVT--DPVTEAG--EWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKISLPKENTDSKPKIFXXXXXXXXXILCTPIGSGSCTDMSRSSSIQDDTFRQYPNNKSLFFHSFERGFALTDQVFVP--------------SISKIYKHKN-----------KSGIQSLEMPEITIHESVSGSVAKALIDSLSSISTMHTKEFFPTSQSKKVP 9704
            +   ++  ++RRW+  +R L+G E+ DLV+++R +V+Q +       L    ++ + + + +   +    S P+   +   S     + Q ++ G    ME   +  P I  + L E       P+E     ++ T     ++E+        D+    I  E  Q     S            T       DE+    +++ L+  G+DP+FL+ALP+ MRREVI +HR A +V+QQL  I LPE+++++ +A LP HIQEE+L  +R                 +TS  A + + T  ESGS+  +  S    +++FL+SL PSLRRE+LADM++SQ+  L  +L  EARQ+R+E+ +   RA+Q  +L+ +   R  +L  G          GRWD R      FS      RH N+      P T  G    P +   + LV  +GLT L+ALL+ SS+     + +   V K+L++L+CH   R WI  T++ I   +S  +  +  KP +      S  S+   P  S S         +   +   + NN  +F   FE       +VF P                SKI +  +            +G  +  M    IH   + +V+  L+D+L  ++      F+P     + P
Sbjct: 3074 YAGYALPASYRRWVTLSRLLFGHELMDLVLISRYQVHQELSRRRQDTLKRRILEAERLANQQQATLAATPSQPEVALSAVTSTATIESHQPEVYGAPAQMETSHLPTPPISNQPLVEHTLQYSQPDEGTTAPQVETAALPPSIEASYGSPTVADDTAPGISEEPVQATTTTSTGGSGQPTQSQPTPPPVPMTDEE----TIQSLVESGMDPSFLDALPEEMRREVIADHRHARQVQQQLRSITLPEHINSDWLAGLPPHIQEEVLLQFRNEQQQNAAAAASGANTTTTSGAAESAATTVNESGSIVRVPES----NTAFLISLPPSLRREVLADMEESQLEMLPPDLVAEARQLRRESEERFARAVQGGMLAHSFTSRHDRLIGG---------PGRWDVR------FSSINHFLRHLNSLTGPFPPNTSVGLHNLPGIRG-RHLVDYEGLTCLLALLVASSSCSQQRRQLIPTVKKVLRNLSCHFATRNWIVGTLLCIFGGLS--ENCSKEKPPL-----ESAPSLTLEPQPSTSVAQRDSEVKLLRQSKPCFSNN--IFHTGFEAALGCWVRVFHPVSQPIQSFPPETEEGQSKISQESDIGEPLTFYCEPTAGTSATTMRNHMIHPQAAAAVSNVLLDTLGDLAKAFPAHFYPRLSGDQKP 3704          

HSP 4 Score: 113.235 bits (282), Expect = 2.031e-20
Identity = 121/520 (23.27%), Postives = 220/520 (42.31%), Query Frame = 3
Query: 4416 ARLKELEMKNVS-IKEMIKESFLINLFNLQKEKGID-IITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSGKEISGANIEDSPN-GLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLFKSFMAVPHQTETFK----TSVLKHITQLWLIIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLPSKSKDQRKFENL-SEYEHKIISCVPDPL--GDEEVVELSDNMLQF---------------LISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKS-----------AIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIELNCQ----TEKQVLKTYSISKSPSLTSKATQPLMELEKKQIAIVRFLVE 5855
            A L+ L  + +  ++E +K+      +++ K    D I+ RI ++LL +G+   +++++      + ++    +S    T+       + +G ++++ P  GLH+  LL+++ +         H++   L+       +S    P  T+       T   K +    LI+D YER+  A+++R+     Y    TW W DDR  +WHP +++    I+ ++ NG+L AY    S   Y   F ++TQ N +S   RP++L+PS ++D  +  N  S YE  I+     P+  G +     +  + QF               L  +    NV+      A+  L    C    +      AY S            +  L   PH + +T +   FV +++ Q FE    +  T+ +++ K    G          N    +DLFY +    P++ +D ET + +    I L+      T K V K Y I ++P       Q    L  +Q AI+  L+E
Sbjct: 1588 AELEPLAPEKIEELRESLKKHVFRACYSIAKHHHSDQILHRIAELLLSSGEEEHYIDELFGFVAAT-MSGRLGFSAASPTIPSLSVNVDEAGVSVQEQPTVGLHLSALLFSRCQSLCARLAWKHNLPHLLITWVARCGQSADRPPDTTQQANHGPDTDYYKTLLLSCLILDLYERSIQAMQLRQISSKLYLNSHTWNWFDDRAMLWHPYASESGRIIDTAFHNGELSAYCH-ISRRPYAVEFPTMTQINLDSMHRRPVLLMPSTAEDTDERSNKESAYERSILDAEIPPMLTGKQRRTLFTGLVHQFERATTHATITQTTVPLCDVSCPTNVH------ASPVLFPSDCVNAMLRLLLRLAYSSFDDAREMIDVNLLSVLLAFPHSRDFTAEYSAFVGSIVIQMFEDRPTVNRTMKEVIKKMCKFGLPSSFMGVRINSPACRDLFYLLSMCAPIMAKDRETALKIACDTINLSLSDADVTAKTVPKDY-IVEAPLEPDDKDQDTFPLSDRQQAIITQLIE 2098          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. TrEMBL
Match: A0A4S2M6H5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002440 PE=4 SV=1)

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 439/1120 (39.20%), Postives = 653/1120 (58.30%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQ------SSVDV-----------FIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNE---VNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQMTKKSV--ALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDXXXXXXXXXXXXXXYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMP-----------------------LQENVDSQEIA-STAGPSGVYSSDSNQAADLLAV----------MTAVEEADREVEQIMEMSGDEDDGVADNEMTQ---AIDAEEDRTPSDGCGKDNKTEEMNQFSCDDDAVYLMDYICNVCKFMERFM-SDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQ--LYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLRQDILAE--LKSGIIDYARLLPLLNWEAMVLMNLLFEDEEACLEDL 3188
            MKIDR+KI NRCG+DQ EC  LA RLAA  ++ LI+E+K+I+VW+YGKCELGLW DVLDRLD IL   VTKVG W L+LD P N  L+  ++ ILEFTGHLIEHSIYRYLYGSW HILALFG+ NMDIL A+LGL YNFSKRSNYF R+D  N+K++LERL SIAE WGG ++ FGLA CC  ++ P +AG + +E+  D    S  G    +Q       S D+           +  PK    K+ LR LH + +SPS++ME L+ ++ L   S QMALFAR+RL  YF  PEQR   I  R+QALSIL YT +V+++ L   +++ELV+VL+LPD ++ GIKACALRT+TAI++  +L   W  L + TG++SYHG  P++ R WI  LV    +    +  Q +TTAILSFLYHLAC  E     +T    L  +G+LD+M ++I WHT   D +S+ TRAVRVTDQIL+S      +T++ + ++ +V+RL FE+ + L +  D   ++ +  ALNTQR G +KS+LNL+KRL LD +W E +   M+  LPDILR +F+N +  F P L LF+ME ITN++Y +PS +S+MQ++ +T DIL  LT QPLP NRDFLV LP L + L++N RGI  I+ S ++ KY++TL    ++  M+ KR+R+ ++    + +++T  S  ++ T+ QMSNA+ EL R+ + +  P+ ++ +    K V  IG+ QPA L+         + ++  H       +  DD+  +P                       L  ++ + ++A ST+G  G+  +D     D++ +             +++  R  +         +  + D+  T    +++ +ED  P++          +   S      +L D++ N CKF+E+ + S      ++ +   S  GL+ + D+L +P LPYDFP S +C S+ KIFE L +    ND I      F+  +   ++L  L+  Q  L S+LL++Y+                      N   LLH+LV+ +++I I  +I D L + LR  +  +  +++ +    RL   ++WEA +L+ +L+ D++    D+
Sbjct:    1 MKIDRRKIVNRCGYDQNECMLLAKRLAACPDDTLISELKQISVWNYGKCELGLWVDVLDRLDAILEHAVTKVGRWMLRLDLPENASLVDDVVTILEFTGHLIEHSIYRYLYGSWNHILALFGSENMDILLAVLGLAYNFSKRSNYFVRMDHHNKKMILERLVSIAETWGGSENNFGLAACCDPDHFPETAGNIYFEYRPDSKDGSFIGGNPPSQLETETTPSGDIAEHTDGCGNVEWTAPK----KIVLRALHRRNQSPSQIMEELLSQH-LLPPSKQMALFARIRLATYFAIPEQRHKCIRARLQALSILSYTFDVDERHLYPSLLDELVEVLELPDGQYTGIKACALRTMTAIVNSHRLGITWTSLVSCTGLSSYHGILPSLTRRWIQGLVDGTIEAPGGSTNQQFTTAILSFLYHLACYEENVGPGNTQNATLSSSGVLDTMLQLIAWHTSRNDCLSYVTRAVRVTDQILMSI-----ATSRLNVVNILVNRLSFEVDLVLKASTDGKIQQDLGPALNTQRSGLMKSILNLLKRLCLDTDWGEVMHTVMEDTLPDILRQVFLNGSIHFTPHLALFAMETITNYLYTYPSRISSMQDKNVTTDILTALTSQPLPQNRDFLVQLPGLFNTLALNARGIEAIQSSGVLSKYLETLVSPDYLPTMKTKRVRDFLSQISYNLSSSTGQSLSNSLTASQMSNAIQELLRSRSELKTPV-FQGLVACMKRVVEIGRMQPASLVVEPV-----RCISDTHT------LGTDDDAKLPSEPPDSTVCEHLGSDLPCLTGVALGRSIGTSQVATSTSGGQGIGETDPMLEEDVVMLSGDEDEDGDDDHDIDDVSRATQTAAHQHRSANTRLMDSRSTSPTASLNLKEDLAPTN-----RPITSLADGSPVPAYHFLSDFMLNTCKFLEKLLPSVLHVTEAMCRHFMSHGGLQVLCDLLRMPGLPYDFPVSASCASLCKIFEDLANSIYLNDVI---APLFQCLESSLEKLAPLQNSQFTLTSLLLREYM---------------------ANEHVLLHELVVTASIICIMVQIIDHLKSELRPSLADKWLVRNVLHSLGRLYLGVSWEACILLKILYGDKDITEADM 1069          

HSP 2 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 385/890 (43.26%), Postives = 529/890 (59.44%), Query Frame = 3
Query: 9804 DYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKSFS-MKEKPVAAEWSIATNDGDNHESST------PTASTGN-ETPLSITKEKSETKAVNVSDPHLNRVNVKTISHLVNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMIXXXXXXXXXXXXPSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHXXXXXXXXXXRKV---------DNSILTQFQSP-------SSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLC--------------------------------HSDCSEIHEEHNKSDNSN--------VSDPLSHLNTSLVVDDTF--MNSP--------AFSENGKH-----------NPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQL--RNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASM-STNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            DYF+ +  L+  PL+Q+  +  E++L+ +  ILK +  +   M E+      ++ T    +  S        P A  G  E+  +  +E ++T + +V    +  +  + +  L   +C       +P  T+  R  + +L+ +L+  N + K+ ++ LL  ++  ++  L+  L +  DE    L+++   +   +        +K S++ +  +S D+L    S S +              VS G SR N  P  AF  L+++SI+ FT    +   L  +  L+ ++         + S+    Q P       S  W  LS V + +QK  + +AV++ Q L+E+F L                                 HS    I     + D+S         V +PL + NT+ +  D    M+ P        AF ++              N  L+F E+H+  LN +LR+    +L +S F+  L YP++LDFDIKRR+F+ ++  L  R+   +RY++E + +SR RLFEDSY RLHRK+  EWK +F I+F NEEGQD GG LREWYL MS EIFNPNY LF+ SP D VTYTINP+SY+N+NHLSYFKFVGRFIAKAI+D+KLL CYF+RAFYKHILG+ ++ +DLE EDY F++GLEFLLKN VS +  + TFS +I+EFG+TETRDLI NG  + VTE+NK EYVRLVCQE+MTGAIRQQL +FL GFYEIIPK +ISIFNE+ELELLI GLP ID+ DLK NT Y+KY P SPQI+WFW ALESFDQEDRARF+QFVTGTSKVPLGGF+ LEGM+GPTKFQIS AS+ STNHLP AHTCFN++ LP YE +++L   LLTAIRECSEGYGM
Sbjct: 3830 DYFSQMADLLCHPLLQNRPSNQERVLTILAGILKEFIVNRGRMDEQSATTGQTVETTATLSQPSEQLEQPIPPEAVVGQPESSATGVQEPTKTSSASVPPDFVGSIRPEALKTLCEFVC-------SPKSTESGRSMAAQLITDLAHTNRDMKELMLNLLAESLNTLIGKLSVQLQEFSDELTSQLKSDTVISLKQKERA-----MKPSSSISRLVSMDVLPDRFSSSGQTVV-----------VSGGDSRPN--PATAFCDLQLKSIQAFTCPNNEQSRLRGIVGLMVRLTAGECSLNANASVSVSNQDPFASITSLSGFWPKLSSVFEKLQKCPDMNAVLLLQPLLEAFCLAHLHLVKDSIMIRQRSATSRTNRPTITVTASGAHSLVDMIPMLQVRVDSSTPSASERDEVREPLINENTTHLQLDVMGPMSPPTLSTEDDKAFGDDATRCRRGSSNSATANAILQFAEQHRIGLNQVLRQHGG-SLGESPFAVFLAYPRVLDFDIKRRFFRQQLQALSHRSPLSNRYDDEPILISRDRLFEDSYARLHRKSPAEWKHKFVIRFHNEEGQDAGGPLREWYLLMSREIFNPNYCLFRTSPADRVTYTINPSSYINSNHLSYFKFVGRFIAKAIYDSKLLECYFSRAFYKHILGVPVKCSDLESEDYDFYKGLEFLLKNHVSDLGYELTFSTEINEFGKTETRDLIENGRNVPVTEQNKKEYVRLVCQERMTGAIRQQLDAFLAGFYEIIPKRMISIFNEQELELLISGLPNIDIGDLKANTTYSKYHPNSPQIEWFWCALESFDQEDRARFLQFVTGTSKVPLGGFANLEGMHGPTKFQISRASVSSTNHLPCAHTCFNTLVLPAYETYEQLRARLLTAIRECSEGYGM 4693          

HSP 3 Score: 193.741 bits (491), Expect = 9.251e-45
Identity = 179/664 (26.96%), Postives = 296/664 (44.58%), Query Frame = 3
Query: 7905 FNDISMITNFRRWIVEARTLYGREITDLVMLARARVYQSVYHSVSSKLTEASVDEKEVVDSKTNMVKTANSNPDNVDNERNSI----TDQTDI-GRDVSMEQDLMMQPDIMIESLDE-------PNESVIGEEMVTPTPSETMESR-------DEPIDNIEIE--QPNEVISRVDQSLXXXXXXXXXXXXXNDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYR--------------RENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVT--DPVTEAG--EWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKISLPKENTDSKPKIFXXXXXXXXXILCTPIGSGSCTDMSRSSSIQDDTFRQYPNNKSLFFHSFERGFALTDQVFVP--------------SISKIYKHKN-----------KSGIQSLEMPEITIHESVSGSVAKALIDSLSSISTMHTKEFFPTSQSKKVP 9704
            +   ++  ++RRW+  +R L+G E+ DLV+++R +V+Q +       L    ++ + + + +   +    S P+   +   S     + Q ++ G    ME   +  P I  + L E       P+E     ++ T     ++E+        D+    I  E  Q     S            T       DE+    +++ L+  G+DP+FL+ALP+ MRREVI +HR A +V+QQL  I LPE+++++ +A LP HIQEE+L  +R                 +TS  A + + T  ESGS+  +  S    +++FL+SL PSLRRE+LADM++SQ+  L  +L  EARQ+R+E+ +   RA+Q  +L+ +   R  +L  G          GRWD R      FS      RH N+      P T  G    P +   + LV  +GLT L+ALL+ SS+     + +   V K+L++L+CH   R WI  T++ I   +S  +  +  KP +      S  S+   P  S S         +   +   + NN  +F   FE       +VF P                SKI +  +            +G  +  M    IH   + +V+  L+D+L  ++      F+P     + P
Sbjct: 3079 YAGYALPASYRRWVTLSRLLFGHELMDLVLISRYQVHQELSRRRQDTLKRRILEAERLANQQQATLAATPSQPEVALSAVTSTATIESHQPEVYGAPAQMETSHLPTPPISNQPLVEHTLQYSQPDEGTTAPQVETAALPPSIEASYGSPTVADDTAPGISEEPVQATTTTSTGGSGQPTQSQPTPPPVPMTDEE----TIQSLVESGMDPSFLDALPEEMRREVIADHRHARQVQQQLRSITLPEHINSDWLAGLPPHIQEEVLLQFRNEQQQNAAAAASGANTTTTSGAAESAATTVNESGSIVRVPES----NTAFLISLPPSLRREVLADMEESQLEMLPPDLVAEARQLRRESEERFARAVQGGMLAHSFTSRHDRLIGG---------PGRWDVR------FSSINHFLRHLNSLTGPFPPNTSVGLHNLPGIRG-RHLVDYEGLTCLLALLVASSSCSQQRRQLIPTVKKVLRNLSCHFATRNWIVGTLLCIFGGLS--ENCSKEKPPL-----ESAPSLTLEPQPSTSVAQRDSEVKLLRQSKPCFSNN--IFHTGFEAALGCWVRVFHPVSQPIQSFPPETEEGQSKISQESDIGEPLTFYCEPTAGTSATTMRNHMIHPQAAAAVSNVLLDTLGDLAKAFPAHFYPRLSGDQKP 3709          

HSP 4 Score: 112.849 bits (281), Expect = 2.246e-20
Identity = 121/520 (23.27%), Postives = 220/520 (42.31%), Query Frame = 3
Query: 4416 ARLKELEMKNVS-IKEMIKESFLINLFNLQKEKGID-IITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSGKEISGANIEDSPN-GLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLFKSFMAVPHQTETFK----TSVLKHITQLWLIIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLPSKSKDQRKFENL-SEYEHKIISCVPDPL--GDEEVVELSDNMLQF---------------LISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKS-----------AIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIELNCQ----TEKQVLKTYSISKSPSLTSKATQPLMELEKKQIAIVRFLVE 5855
            A L+ L  + +  ++E +K+      +++ K    D I+ RI ++LL +G+   +++++      + ++    +S    T+       + +G ++++ P  GLH+  LL+++ +         H++   L+       +S    P  T+       T   K +    LI+D YER+  A+++R+     Y    TW W DDR  +WHP +++    I+ ++ NG+L AY    S   Y   F ++TQ N +S   RP++L+PS ++D  +  N  S YE  I+     P+  G +     +  + QF               L  +    NV+      A+  L    C    +      AY S            +  L   PH + +T +   FV +++ Q FE    +  T+ +++ K    G          N    +DLFY +    P++ +D ET + +    I L+      T K V K Y I ++P       Q    L  +Q AI+  L+E
Sbjct: 1593 AELEPLAPEKIEELRESLKKHVFRACYSIAKHHHSDQILHRIAELLLSSGEEEHYIDELFGFVAAT-MSGRLGFSAASPTIPSLSVNVDEAGVSVQEQPTVGLHLSALLFSRCQSLCARLAWKHNLPHLLITWVARCGQSADRPPDTTQQANHGPDTDYYKTLLLSCLILDLYERSIQAMQLRQISSKLYLNSHTWNWFDDRAMLWHPYASESGRIIDTAFHNGELSAYCH-ISRRPYAVEFPTMTQINLDSMHRRPVLLMPSTAEDTDERSNKESAYERSILDAEIPPMLTGKQRRTLFTGLVHQFERATTHATITQTTVPLCDVSCPTNVH------ASPVLFPSDCVNAMLRLLLRLAYSSFDDAREMIDVNLLSVLLAFPHSRDFTAEYSAFVGSIVIQMFEDRPTVNRTMKEVIKKMCKFGLPSSFMGVRINSPACRDLFYLLSMCAPIMAKDRETALKIACDTINLSLSDADVTAKTVPKDY-IVEAPLEPDDKDQDTFPLSDRQQAIITQLIE 2103          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. TrEMBL
Match: A0A0X3PN07 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR125038 PE=4 SV=1)

HSP 1 Score: 761.14 bits (1964), Expect = 0.000e+0
Identity = 490/1414 (34.65%), Postives = 750/1414 (53.04%), Query Frame = 3
Query:   12 LYE-MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQG-----NLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSE--IDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDXXXXXXXXXXXXXXYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMPLQENVDSQEIASTAGPS-GVYSSDSNQAADLLAVMTAVEEADREV-----------EQIMEMSGDEDDGVAD----------------------------NEMTQAID------AEEDRTPSDGCGKDNKTEEMNQFSCDDDAV----YLMDYICNVCKFMERFM-SDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQLYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLR---------QDILAELKSGIIDYARLLPLLNWEAMVLMNLLFEDEEACLEDLKR----LCINERGTCADNEHNEER------CFLTKKSS---LSTCQQLFSDNPRSEKIIKRMLQITQKAANDMVELLVTLTKFCCVKPDYSXXXXXXXXXXXGSIPTGKNKMALLNKIAEHCKSLLERESPYTLQAGQDSW-PEDPHSELPVEKACQKILSDIKFL---HPMKYFCFTTIHRILTGGDLNKKPFLGFFYAFQMNNGLEVFFECANELLDTIRYIQYLDPNANSSVKIMLESFLITVDRMTQIRRITQEFVDSTDKELRDKFDIDLYQRMIRAYMLEP 3998
            LY+ MKIDRKKI NRCG+DQ EC  LA  L+ L +++ I E+++I VW+YGKCELGLWAD+LDRLD IL    T+VG WT+K+D P NE L+  ++ +LEFTGHLIEHSIYR LYGSW HIL LFG+SNMDIL A+LGL YNFSKRSNYFSRLD+ N+K++L+RL SIAE WGG +  F LA CC   + P  AG + +E+  DV++  S   E  ++ +V            + + +L    ESPS++ME L++K+ +    ++MALFAR+RL VYF  PE+R   I  R+QA+S LCYT E+ D+ L   +V+ELVDVL+LPD +F+ IKACALRT+TAI    ++      +   TGM+S+HG  PT +R+WI  LV         +V Q YT A+LSFLYHLA   E   +  G      L  +G+LDSM ++I WH    D +S+ TRAVRVTDQIL++     ++TN+++ ++ +VDRL +E+ + L ++  +D    +++ LNTQR G +KS+LNL+KRL LD +W++ ++ +M+G LP IL  I+ N    F P L LF+ME +TN++Y +PS +S MQE  +T  IL  LT QPLP NRDFLV LP++L+ L++N RG   ++   I++KY++TL    +++ M+ +R+R+  +    S   +      +  T+ QMSN++ EL R++  + KP +++S+ + F+ V  +G  Q AP+L                     +P T+  +E+          +  ST G +  V+SS++   + +     AV +A               E ++ +SG ED+G A+                               T  ID      +E   T +DG   D K   +++ S   DA      L +YI N+CKF+ER + S Q     + +Q  ++ GL+ + D+LT+P LPYDFP S AC S+ KIFE L+S+ + ND      +   + + + D L K+      + L  +    S  F D  A          E GV  LH LV +S+++ +  +I + L    R         ++IL +L         L   ++WEA++L+  L ++ +   +        L ++   T A+ +  + +       F+   S    L  C Q+     +++ +   +L +     N + EL  TLT+FC   P  S   R         +P    K ++L ++A+             L  G   W P D             +L++  FL   + ++Y      H +L     +K P +  F AF M NG++  F   N+L        +L    + ++  +LE +   VDR++ I  +  E    ++ +    F+ + Y   +    L+P
Sbjct:    6 LYDLMKIDRKKIGNRCGYDQNECMLLAKHLSTLSDDEFIQELRRIKVWNYGKCELGLWADILDRLDGILENAATRVGAWTIKVDLPENEKLVEDVVTVLEFTGHLIEHSIYRCLYGSWNHILTLFGSSNMDILLAVLGLTYNFSKRSNYFSRLDAANKKMILDRLISIAETWGGSESHFDLASCCQPNHFPPMAGKIYFEYQPDVAN--SLNHEKKDEVAVVCPNTMSLSGPDVIIEDLKGCRESPSQIMEALLKKHPVP-LPNRMALFARIRLAVYFSDPEKRLKCIRARLQAISTLCYTFEINDRLLYPSLVDELVDVLQLPDGDFMEIKACALRTMTAIFSSHRVNVNLMSILESTGMSSFHGALPTRIRKWIQGLVDGSCDAAGGSVNQQYTIALLSFLYHLASFEENIGSGSGQNHATTLSTSGILDSMLQLIAWHVPRNDCLSYVTRAVRVTDQILMN-----AATNRQTVVNRLVDRLGYEVDLVLSNQGKLDATGGQALLLNTQRSGLMKSILNLLKRLCLDTDWNDAVRTSMEGNLPQILCSIYKNSVFHFTPHLALFAMETVTNYIYTYPSRISNMQENGITCGILSALTTQPLPQNRDFLVHLPSILNTLALNTRGRAALRSCGILNKYLETLVSPDYLSTMKARRVRDFHSQISYSLAPSAGQVFSTNLTASQMSNSIQELLRSHNEL-KPAVFQSLVECFRKVVRLGCSQSAPIL--------------------PSPETLGSSELESEGSCRSFNQSYSTHGRNLNVFSSENRPDSRMTVTSAAVIDATNPTANRTPGGVLLDEDLVMLSGSEDNGSAEDDDENDDMPDVGLTASRTAVSSSTIFRTTARTAHIDTTDSSVSESHSTTTDGDTPDQKPSALSEASISSDAPESFQNLPEYILNLCKFVERLLPSMQHVTEGMCRQFVNQGGLQVLCDLLTMPGLPYDFPVSAACASLCKIFEQLVSYLSLND------LLKPVLQALQDGLSKVS-----NFLASETTEYSLLFTDCSA---------NETGV--LHGLVCISSILCVLVQIINHLKPEHRCGFASLWAQRNILGQL-------GELYHKVSWEAVILLKALCDENKDLTQPGSSTSYPLPVDANETSANTQTAQSKPPFSMPAFVEALSVYRILKPCLQVHQPT-KTKSLAHYILHVCSYFINSVTELCTTLTRFCVASP--SQPQRRLLMSSFDQVPLSA-KTSVLTQVAQ-------------LAIGALCWRPPD------------AVLNNSDFLLFVYAVRYSSVRLAHLLLFDAS-SKSPQILMFNAFYMLNGIQSLFSIFNDLASFNSSTDFL----SGALSTVLEEWFACVDRLSNIVAVKAEVKKMSETDAV-HFNTNKYANYVNRLSLKP 1326          

HSP 2 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 387/881 (43.93%), Postives = 519/881 (58.91%), Query Frame = 3
Query: 9804 DYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKSFSMKEKPVAAEWSIATNDGDNHESSTPTASTGNETPLSITKEK------SETKAVNVSDPHLNRVNVKTISHL--------VNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMIXXXXXXXXXXXXPSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHXXXXXXXXXXRKV------DNSI--------LTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDC----SEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFM-------NSPAFSENGKH-------------------------------------NPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRN-DGD-SRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMST-NHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            DYF+ L  L+R P++     + EKLLS +  +++ + K      +P     S  T    N E+  P ++    T    +  +      + + AV    P   R+  K +S L        +  +C    +++T   T++ R  S RL+I +++ N  T   ++  L      +   ++  L  V++E                PS   + P     T   S S   L+S   P   NA    S R     + +    ++S+P    ++L++ S++P T +  +   L  + +L+  +      D S         +      S +W  LSQ LD ++ + + + V++ Q LVES  L HS        +      S    VS  +S +   L  +            SPAF  N  H                                     +P     E H+  LNHILR  +   L +S+F A L YP+ LDFDIKRR+F+ ++  + N DG  SR+E+E V VSR R+FEDSY RLHRK+A EWK +F I+F NEEGQD GGLLREWYL MS EIFNPNY LF+VSP D VTYTINPAS++N+NHLSYFKFVGRFI KAI+DNKLL CYFTR+FYKH+LG+ +R+ DLE EDY F++GLEFLLK+DVS +  D TFS +I+EFG+ ETRDLI +G  I+VTE NK+EYVRLVCQE+MTGAIRQQL++FLEGFYEIIPK+LISIFNE+ELELLI GLP ID+ DLK NT Y+KY P SPQ++WFW+ALESFDQEDRARF+QF+TGTSKVPLGGF+ LEGM+GPTKFQIS A +S+ NHLP+AHTCFN+++LP YE++++L + LLTAIRECSEGYGM
Sbjct: 3710 DYFSQLASLLRHPVISCRPPLQEKLLSILVGVVREFCKRSRALHQP-----STTTAPLINRENVEPASAMAEGTTSEASSSQYAGGAMASSSAVGGDAPE--RIPKKPVSDLMLCPQHAVIECLCELVVAAKT---TEQARSLSVRLVILIAQANAKTNAQMLHYLCKAASDLSAIISRQLKAVINEV-----------DSLPPSNKASLPSSSKTTIPLSASMTRLSSVSDPEVSNA-GDPSDRFLAPTLVASLPSSSSVPPATASELELSSLQPLTTSRSEQSRLCCVLHLILHMLSCGSEDTSTNDAHTKVTMESINGLSQLWEDLSQTLDRLETTNDANTVLLLQPLVESLCLAHSTVLRENGSVRRLSRVSTIGVVSSGISFIPNLLPPEADLYELPPITNTSPAFGRNSTHVDSEPLSPASTIDLNRPMSPPLSTLNNATDAVSETASSPIAHLAETHRASLNHILRNFSG-NLSESSFVAFLSYPRALDFDIKRRFFRQRLQAIANRDGSVSRFEDEPVVVSRGRIFEDSYARLHRKSAAEWKHKFVIRFQNEEGQDAGGLLREWYLLMSREIFNPNYCLFRVSPADRVTYTINPASFINSNHLSYFKFVGRFIGKAIYDNKLLECYFTRSFYKHMLGVRVRFVDLESEDYDFYKGLEFLLKHDVSELGYDVTFSTEINEFGKNETRDLIEDGRNIIVTEANKNEYVRLVCQERMTGAIRQQLNAFLEGFYEIIPKSLISIFNEQELELLISGLPNIDIEDLKANTTYSKYQPNSPQVRWFWRALESFDQEDRARFLQFITGTSKVPLGGFANLEGMHGPTKFQISRAVVSSINHLPSAHTCFNTLELPPYESYEQLRERLLTAIRECSEGYGM 4567          

HSP 3 Score: 171.4 bits (433), Expect = 5.111e-38
Identity = 146/494 (29.55%), Postives = 238/494 (48.18%), Query Frame = 3
Query: 7914 ISMITNFRRWIVEARTLYGREITDLVMLARARVYQSVYHSVSSKLTE----ASVDEKEVVDSKTNMVKTANSNPDNVDNERN------SITDQTDIGRDVSMEQDLMMQPDIMIESLDEPNE---SVIGEEMV--------------TPTPSETMESRDEPIDNIEIEQPNEVISRVDQSLXXXXXXXXXXXXXNDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNP-ESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVT---DPVTEAGEWPNLSAY-KPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKIS 9299
             S++TNFR  I   R LYG+E+ D+++L+R   Y+   H++  +  E     +  +  V ++  +   T  +  DN     +      S  DQ  +G   S ++ +            EPN+   SV  E  +               P+ SETM     P      EQP    ++ +    +     +     +    D  ++  ++AEG+DP+FL+ALP+ +RRE++ +HRR  ++R QL+ +QLPE+V AE ++ LP +IQEE+L   R+E      ++     N   +G     +++T   +++FL SL PS+RRE+LADM+  QI  L  +L  EAR +R+E      RA+Q    S+ G  R R  T+     LS    GRWD R   Y       +  R+  A V     P   +G     S   + L+  +GLT ++ LL+ SS  P   +     + ++L++L  HP IR WI CTI+++L ++S
Sbjct: 2983 FSILTNFRHLIDVCRILYGQEVMDMILLSR---YEVGVHAIRRRGDEFRERLAAHQASVNNAAASAETTTEATADNSSAAAHVPLLAPSTEDQAFVGAAASDDRYIRASVQSEWAPPHEPNDLASSVRPEASMEHQSASQSEREVAEPPSSSETMSVPSNP------EQPTAGDAQSNVPTPSAAPPLIVTEEIHVPVTDEETIASMVAEGMDPSFLDALPEDVRRELLADHRRTRQLRSQLSSMQLPEHVSAEFLSSLPPNIQEEVLTQVRQETQRQTGSDETQGQNTARAGEAANGAAATPENNAAFLASLPPSVRREVLADMEDFQIDLLPPDLQQEARTLRREHEAQFARAVQGR--SLPGLFRPRLDTTYFWQTLSGF--GRWDSRAGSY------NRLIRNGGAPVLGSRGPSAFSGLQSFFSGRNRHLIDHEGLTCILTLLVVSSACPVQRRHTVPALKRVLRNLASHPGIRNWIICTILSLLKRLS 3457          

HSP 4 Score: 102.064 bits (253), Expect = 4.233e-17
Identity = 118/510 (23.14%), Postives = 214/510 (41.96%), Query Frame = 3
Query: 4458 EMIKESFLINLFNLQKE-----KGIDIITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSGKEISGANIEDSPNGLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLFKSFMAVP-----------HQTETFKTS----VLKHITQLWL----IIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLPSK----SKDQRKFEN----LSEYEHKIISCVPDPLGDEEVVELSDNMLQFLIS--IKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIELNCQTEKQV-----LKTYSISKSPSLTSKATQPLM----ELEKKQIAIVRFLVES 5858
            E ++ES   ++F+   E     K  +I+ +I +++L + Q  + +E ++A    +   S       L  L+   S        + D+  GLH++ LL+ + RF        + ++  L  +      +  + P            +   + +S     L+    L++    I+DQYER   A+R+RK  +  Y+ C +W W D+R  +WHP +       + ++ NG  +A    +  N Y   F ++TQ N  S   RP++L+P      S D  +       +++YE  II+  P    D    +L  ++   L+    +  +     +CL +   LL+RL    S       A    +  L  + H   ++ Q   FV  ++RQ F+    +  T+  IL K  ++G C             +DLFY +    PL+ +  E  + LM +   L    EK +      K++SI     L + A   ++    EL  +Q  IV F++E+
Sbjct: 1541 EKLRESLRKHIFSACYEIARLHKTDEILHQISELMLCSKQETQCIENLVAAVTTNLFAS-------LGVLLPTPSSP------VTDTGVGLHLIALLFTRCRFVCAQMVHKYSLILVLTALITDDVDTLRSHPLPVLLNLGESSAKPSAYMSSQSLVALEGDEDLFMLAAIILDQYERAVAAIRLRKKSVELYKDCHSWSWFDERANLWHPQAPDLFQAADAAFHNGATRAQWSID-RNRYAIEFPTMTQVNLSSMHRRPVLLMPCSLSPTSSDSPRPTGSTTQVTDYEGMIINMEPP---DGLSADLRRSLCLALLRRFDRSTEKPLSAECLNSFLRLLLRLT-ASSFEDAETVANADGLRVLFALSHPFEFSSQYSAFVGHIIRQLFDDLSTVTVTMQQILHK-FAEGVC----------SSCRDLFYLLSLCAPLVAKAEELAIRLMKETFSLVVD-EKSIEDGVPPKSFSIVN--PLETPANDAIIDVSPELNNRQKHIVVFIIEA 2018          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Cavefish
Match: huwe1 (HECT, UBA and WWE domain containing E3 ubiquitin protein ligase 1 [Source:ZFIN;Acc:ZDB-GENE-081104-387])

HSP 1 Score: 373.629 bits (958), Expect = 6.320e-103
Identity = 258/799 (32.29%), Postives = 402/799 (50.31%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGH--WTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECC----VTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQ-----PESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKC---LSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNM---TGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEI----KIC-------------------LDSEIDQM----------------------TKKSVALNT---------QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDXXXXXXXXXXXXXXYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKA 2204
            MK+DR K+         +C  L  +L    +  L+ E++ I  W+ GKCEL  W D+LDR D IL +    V +  W L  D+P N  L   ++A+L FT  LIE+S  R+LY S EH+  L  + +M ++ ++L L Y FSKRSNY +RL S  R  +L RL  +AE+WGGK++GFGLAECC    +T+Y P SA T+ +EF  + SS     K+ S+                 TL  +H++      ESPSE+ME+L   YN+     Q  LF  +RL   F   ++R   +  R+ A+SIL Y+N +++     L   ++EELVDVL++ D++ + IKA +LRTLT+I+H  +     P L N+   TG  SYHG  P ++R  I  ++    +PY       + TA+ SFLYHLA  +         LV  G+++++ ++I +   E D I+F TRAVRV D I     L+ ++    S +   + RL+ E+    K C                   +D+++D                          +S A++T         QR   +KSMLN +K+ I D  +S+ ++  MDG LP  L+ I  N    + P L L + EV+T FV+  PS +S++Q+  LT  +L  L  + +P  R+ L +LP + SAL +N RG++   + +  ++  K L    ++ AMR +R  + +  + ++                 + +A++EL R +    K     +I K  + + N+G+   AP     KP SIQKA
Sbjct:    1 MKVDRSKLKKTPTEAPADCRTLIEKLKGCSDEQLLLELQHIKTWNIGKCELYHWVDLLDRFDGILCDAGQTVENMSWMLVCDRPDNGQLKALLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASCDMQVVLSVLNLLYVFSKRSNYITRLGSDKRSPLLARLQHLAESWGGKENGFGLAECCRDLPMTKY-PPSATTLHFEFYAEPSSEVKVEKKSSSN----------------TLHYIHIEQLDKISESPSEIMESLTVMYNIPK-DKQTLLFTHIRLAHGFSNHKKRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQLVDIKAASLRTLTSIVHLERT----PKLSNIIDCTGTASYHGFLPVLVRNCIQAMIDPLMEPYP----HQFATALFSFLYHLASYDAGGEA----LVSCGMMEALLKVIKFLGDEQDQITFVTRAVRVVDLIT---NLDMAAFQSHSGLSIFICRLEHEVDLSRKECPFVIKPKIQRPSTATETEDMDTDMDMSEVAMESSPGPSTSAGSRAETDPRAQSSAVSTPRTGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISN-AEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGLHSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASN-----------------LGSAVDELMR-HQPTLKTDATTAIIKLLEEICNLGR---APEYICQKP-SIQKA 743          

HSP 2 Score: 59.6918 bits (143), Expect = 9.827e-8
Identity = 81/327 (24.77%), Postives = 117/327 (35.78%), Query Frame = 3
Query: 4875 KHITQLWLIIDQYERTAFALRIRKDV-IYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIML-------LPSKSK------------DQR-KFENL-----------------SEYEHK-IISCVPD-PLGDEE---------VVELSDNMLQFLI--SIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSAIPRLCTIPHVKGYTQQ-----LVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFE 5687
            K IT + L+ID YE+ A + + R  +  Y       W W DDR G W   S  +N+ I+ ++R G+            Y   F ++ Q NEE+   RP+ML       +P  +K            +QR K E                    E E K   S VP  P   ++         V  LS+ M   LI   +  I      D L A   L +RL         R   Y      L +   + G TQ          V  L R   E P  L+HT+  ++   V+ GA             S+++ Y +    P   R+ E
Sbjct: 1655 KWITPVLLLIDFYEKMAVSSKRRAQMNKYLQPNGNNWRWFDDRSGRWCSYSASNNSTIDSAWRAGETSVRFT-AGRRRYTVQFNTMVQVNEETGNRRPVMLTVQRVPRMPKPTKAGTAADSEREEGEQRAKTEETQTDTDSTSVAVEMAPPKEEAEQKESSSSVPTLPAASQDASSGSGAIVVQGLSEEMTTVLIRACVSMISVPVDPDTLHATLRLCLRLT--------RTHHYAMMFAELKSTRMILGLTQSSGFNGFTPLVTLLFRHIIEDPATLRHTMEKVVRSAVTSGAGSTTSGVVSGSLGSREINYILRVLGPAACRNPE 1972          

HSP 3 Score: 58.151 bits (139), Expect = 3.022e-7
Identity = 27/71 (38.03%), Postives = 47/71 (66.20%), Query Frame = 3
Query: 2562 VYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLS 2774
            + LMDYI NV KF+E  +S+   +    Q+  +++GL  ++ IL +P+LP DFP+S ACQ++  + + +L+
Sbjct:  797 IPLMDYILNVMKFVESILSNNTTDDHC-QEFVNQKGLLPLVSILGLPNLPIDFPTSAACQAVAGVCKSILT 866          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Cavefish
Match: hace1 (HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:103021726])

HSP 1 Score: 331.643 bits (849), Expect = 4.275e-95
Identity = 182/459 (39.65%), Postives = 272/459 (59.26%), Query Frame = 3
Query: 10878 SLVVDDTFMNSPAFSENGKHNP-FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLD----------FDIKRRYFQAKVAQLRNDGDSRY----EEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNK-YTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            S V+   +M        G  +P F+EFV KH +VL   + R      +  +F  LL+ P+L+           F  +  +F   +   + D D  +    E +++ + R  +F  S   + + T E+ KQ   ++F  EEG  G G++REW+  +S+EI NP+YALF  S DG T+  N  S VN +HL+YF+F G+ +  A++  +L+  YFTR+FYKHILGI + Y D+   D ++ + L+++L ND+S + L+ TFS++   FG  E   L P G+ I VT+ENK+EYV+LV + +MT AI+ Q+++FL+GF+  IP +LI +F+E ELELL+ G+PEID+ D K NT Y   Y    P IQWFW  +ES  QE+R   +QFVTG+S+VP GGF+ + G +G  KF I+    ++N LP + TC N + LP+Y + D L   LL A+   S GY M
Sbjct:  407 SAVIQAFYMCCSCQMPQGMTSPRFIEFVCKHDEVLKCFVTRNPKIIFNHFHF--LLECPELMSRFMHIIKGQPFKDRCEWFYEHLLAGQPDSDMVHRPVNENDILLIHRDSIFRSSCEVVSKSTNEKLKQGIAVRFHGEEGM-GQGVVREWFDVLSNEIINPDYALFTQSADGTTFQPNSNSSVNPDHLNYFRFAGQILGLALYHRQLVNIYFTRSFYKHILGIPVNYQDVSSIDPEYAKNLQWILDNDISDLGLELTFSVETDVFGAMEEVALKPGGTSIQVTQENKAEYVQLVTELRMTRAIQPQINAFLQGFHTFIPPSLIQLFDEYELELLLSGMPEIDVLDWKRNTEYTSGYDTEEPVIQWFWDVVESLTQEERVLLLQFVTGSSRVPHGGFAFIMGGSGLQKFTIAAVPYTSNLLPTSSTCINMLKLPEYPSKDVLRDRLLVALHCGSYGYTM 862          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Cavefish
Match: hace1 (HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:103021726])

HSP 1 Score: 332.028 bits (850), Expect = 1.290e-94
Identity = 182/459 (39.65%), Postives = 272/459 (59.26%), Query Frame = 3
Query: 10878 SLVVDDTFMNSPAFSENGKHNP-FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLD----------FDIKRRYFQAKVAQLRNDGDSRY----EEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNK-YTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            S V+   +M        G  +P F+EFV KH +VL   + R      +  +F  LL+ P+L+           F  +  +F   +   + D D  +    E +++ + R  +F  S   + + T E+ KQ   ++F  EEG  G G++REW+  +S+EI NP+YALF  S DG T+  N  S VN +HL+YF+F G+ +  A++  +L+  YFTR+FYKHILGI + Y D+   D ++ + L+++L ND+S + L+ TFS++   FG  E   L P G+ I VT+ENK+EYV+LV + +MT AI+ Q+++FL+GF+  IP +LI +F+E ELELL+ G+PEID+ D K NT Y   Y    P IQWFW  +ES  QE+R   +QFVTG+S+VP GGF+ + G +G  KF I+    ++N LP + TC N + LP+Y + D L   LL A+   S GY M
Sbjct:  476 SAVIQAFYMCCSCQMPQGMTSPRFIEFVCKHDEVLKCFVTRNPKIIFNHFHF--LLECPELMSRFMHIIKGQPFKDRCEWFYEHLLAGQPDSDMVHRPVNENDILLIHRDSIFRSSCEVVSKSTNEKLKQGIAVRFHGEEGM-GQGVVREWFDVLSNEIINPDYALFTQSADGTTFQPNSNSSVNPDHLNYFRFAGQILGLALYHRQLVNIYFTRSFYKHILGIPVNYQDVSSIDPEYAKNLQWILDNDISDLGLELTFSVETDVFGAMEEVALKPGGTSIQVTQENKAEYVQLVTELRMTRAIQPQINAFLQGFHTFIPPSLIQLFDEYELELLLSGMPEIDVLDWKRNTEYTSGYDTEEPVIQWFWDVVESLTQEERVLLLQFVTGSSRVPHGGFAFIMGGSGLQKFTIAAVPYTSNLLPTSSTCINMLKLPEYPSKDVLRDRLLVALHCGSYGYTM 931          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Cavefish
Match: itchb (E3 ubiquitin-protein ligase Itchy [Source:NCBI gene;Acc:103022206])

HSP 1 Score: 327.405 bits (838), Expect = 1.696e-94
Identity = 170/408 (41.67%), Postives = 252/408 (61.76%), Query Frame = 3
Query: 10995 RRTACALD-QSNFSALLKYPKLL---DFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFK-VSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            RRT   +D ++  S+L   P++    DF  K +YF+    QL     +  +   + V+R  LFEDS+ ++   +A++ ++R  I F  EEG D GG+ REW+  +SHE+ NP Y LF+    D     INPASY+N +HL YF+F+GRFIA A+F  K +   F++ FYK IL   +   DLE  D +F+  L ++ +N++    L+  FS+     G+  T +L P G  I VTEENK EY+RLV + +++  + +Q  +F EGF E++P+  +  F+ KELE+L+CG+ EIDL D + NT+Y  YT  + QI WFWQ ++  D E R R +QFVTGT ++P+GGF+ L G NGP KF I   +   N LP +HTCFN +DLP Y+++++L + LL AI E +EG+G
Sbjct:  378 RRTTTYIDPRTGKSSLENGPQITYVRDFKAKVQYFRFWCQQL-----ALPQHIKINVTRKTLFEDSFQQIMSFSAQDLRRRLWIIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSQPFYKRILNKPLGLGDLESIDPEFYNSLIWIKENNIEECGLEMFFSVDKDILGEITTHELKPEGGDIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQYFDAKELEVLLCGMQEIDLADWQRNTIYRHYTRGNKQIVWFWQLVKEMDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIE-KTGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEE-TEGFG 778          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Cavefish
Match: itchb (E3 ubiquitin-protein ligase Itchy [Source:NCBI gene;Acc:103022206])

HSP 1 Score: 328.561 bits (841), Expect = 5.663e-94
Identity = 170/408 (41.67%), Postives = 252/408 (61.76%), Query Frame = 3
Query: 10995 RRTACALD-QSNFSALLKYPKLL---DFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFK-VSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            RRT   +D ++  S+L   P++    DF  K +YF+    QL     +  +   + V+R  LFEDS+ ++   +A++ ++R  I F  EEG D GG+ REW+  +SHE+ NP Y LF+    D     INPASY+N +HL YF+F+GRFIA A+F  K +   F++ FYK IL   +   DLE  D +F+  L ++ +N++    L+  FS+     G+  T +L P G  I VTEENK EY+RLV + +++  + +Q  +F EGF E++P+  +  F+ KELE+L+CG+ EIDL D + NT+Y  YT  + QI WFWQ ++  D E R R +QFVTGT ++P+GGF+ L G NGP KF I   +   N LP +HTCFN +DLP Y+++++L + LL AI E +EG+G
Sbjct:  472 RRTTTYIDPRTGKSSLENGPQITYVRDFKAKVQYFRFWCQQL-----ALPQHIKINVTRKTLFEDSFQQIMSFSAQDLRRRLWIIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSQPFYKRILNKPLGLGDLESIDPEFYNSLIWIKENNIEECGLEMFFSVDKDILGEITTHELKPEGGDIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQYFDAKELEVLLCGMQEIDLADWQRNTIYRHYTRGNKQIVWFWQLVKEMDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIE-KTGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEE-TEGFG 872          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Sea Lamprey
Match: nedd4a (NEDD4 E3 ubiquitin protein ligase a [Source:ZFIN;Acc:ZDB-GENE-051005-2])

HSP 1 Score: 311.997 bits (798), Expect = 2.851e-93
Identity = 177/389 (45.50%), Postives = 245/389 (62.98%), Query Frame = 3
Query: 11049 PKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRL-HRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYV-NNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQ-TETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVY-NKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGY 12200
            P   D+  K  +F+ K+ +   D  +R+E   +++ RA + EDSY R+   K A+  K R  I+F  E+G D GG+ REW+  +S E+FNP Y LF+ S  D  T  INP S + N  HLSYF F+GR    A+F  KLL  +F R FYK +L   I   D+E  D +++  L ++L+ND +   LD  F I    FGQ T   +L PNGS+ILVT ENK EY+ LV Q +    +++Q+++F+EGF E+IP +LI IF+E ELELL+CGL ++D+ND + +T+Y N Y    P IQWFW+A+   D E R R +QFVTGTS+VP+ GF++L G NGP  F I + S S   LP AHTCFN +DLP YE+FD L + L  AI E ++G+
Sbjct:  110 PYSRDYKQKYDFFRKKLKK-PADIPNRFE---MKLHRASILEDSYRRIVAVKRADLLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPISGLCNEEHLSYFTFIGRVAGMAVFHGKLLDGFFIRPFYKMMLQKPITLNDMESVDSEYYNSLMWILENDPAD--LDLRFCIDEEMFGQQTHLVELKPNGSEILVTNENKKEYIELVIQWRFVERVQKQINAFMEGFSELIPMDLIKIFDENELELLMCGLGDVDVNDWRQHTIYKNSYCANHPVIQWFWKAVLLMDGEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEMWSTSEK-LPRAHTCFNRLDLPPYESFDDLREKLNIAI-ENAQGF 490          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Sea Lamprey
Match: wwp2 (WW domain containing E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-000607-82])

HSP 1 Score: 279.256 bits (713), Expect = 9.150e-78
Identity = 134/310 (43.23%), Postives = 201/310 (64.84%), Query Frame = 3
Query: 11277 REWYLKMSHEIFNPNYALFK-VSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            REW+  +SHE+ NP Y LF+    +     INPAS +N +HL+YF+F+GRFIA A++  K +   F+  FYK +L   +   DLE  D +F+  L +L  N++    L+  FS+ +   G+  + DL P+GS ILVTEENK EY+ L+ + + +  + +Q  +FL+GF E++P   +  F+E+ELE+++CG+ EIDL D + +T+Y  Y  +S QI WFWQ ++  D E R R +QFVTGT ++P+GGF++L G NGP KF I      T  LP +HTCFN +DLP Y+++++L + LL AI E +EG+G
Sbjct:  623 REWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLAYFRFIGRFIAMALYHGKFIDTGFSLPFYKRMLNKKLTIKDLESIDPEFYNSLIWLRDNNIEECGLEMFFSVDMELLGKVSSHDLKPDGSDILVTEENKEEYIGLMTEWRFSRGVEEQTKAFLDGFSEVVPLQWLLYFDERELEVMLCGMQEIDLADWQRSTIYRHYNRSSKQISWFWQVVKEMDNEKRLRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIEKVGKET-WLPRSHTCFNRLDLPPYKSYEQLKEKLLYAIEE-TEGFG 930          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Sea Lamprey
Match: smurf2 (SMAD specific E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:563633])

HSP 1 Score: 249.595 bits (636), Expect = 3.560e-69
Identity = 140/358 (39.11%), Postives = 203/358 (56.70%), Query Frame = 3
Query: 11145 VQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGV-TYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQ--YENFDKLHKCLLTAIRECSEGYGMI 12209
            ++VSR  +FE+SY ++ +    + K+R  +KF  EEG D GG+ REW   +SHE+ NP Y LF+ S D + T  INP S +N  HLSYF FVGR +  A+F    +   FT  FYK +LG  I   D+E  D +  + L ++L N    +  + T         Q   R  +  G   ++    +  YV      +    I  Q  +  +GF E+IP+ L+  F+EKELEL+I GL +ID++D K NT     TP S  ++WFW+A+ESFD+E RAR +QFVTG+S+VPL GF  L+G  GP  F I L    T++LP AHTCFN ID+ +  YE  + ++  ++     C++ YG +
Sbjct:  404 LEVSRTEIFEESYRQVMKMRPRDLKKRLMVKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAINPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLADMETVDPELHKSLVWILNNSDVNILHEHTVHSCWGGRVQFCFR-TVNKGVPAMIRLAPRRLYVSW----RFLRGIEAQFLALQKGFNELIPQPLLKSFDEKELELIIGGLGKIDVSDWKSNTRLKHCTPESSVVRWFWRAVESFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHLIDAKTDNLPKAHTCFNRIDITRNPYETNNNIYDRVIC----CADFYGGL 752          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Sea Lamprey
Match: AREL1 (apoptosis resistant E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:20363])

HSP 1 Score: 215.698 bits (548), Expect = 5.371e-59
Identity = 129/373 (34.58%), Postives = 204/373 (54.69%), Query Frame = 3
Query: 11145 VQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASY-VNNNHLSYFKFVGRFIAKAIFDNKLLTCY-------FTRAFYKHILGISIR--YTDLEKEDYQFFRG-LEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLE-----GFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVY--NKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGMI 12209
            ++VSR  L + S   +   ++ +W + F + F NEE  D GG  REW+  M   +F P   LF    D     ++P  +  ++  L  ++  GR + K +F+  L   Y       FTR+F   ++G+ +R  Y   E +D +F++  + F+L NDVS M L  +  +   +   ++  DL+P GS I VT  NK  Y+ ++ Q ++   +R ++  FL+     G  E++P+NL++IF+E ELE+L+CG  +I ++D K N V     +      I WFW  + SF QE+ AR +QF TG+S +P GGF+ L        FQI ++S     LP AHTCFN + LP Y++ ++LHK L  AI E SEG+G++
Sbjct:  246 LRVSRQCLLDSSVKAVRNFSSNDWFRSFEVTFENEEALDRGGPRREWFELMCKALFEPANKLFTHFVDDNQALVHPNPHRPHHMRLRLYELAGRLVGKCLFETSLGDTYRQLVRARFTRSFLAQLIGLHVRFLYFYFETDDPEFYKTKVSFVLNNDVSEMDLTLSEEVYDEQGKLSQLVDLVPGGSGIGVTNANKLAYLNVLAQYRLATQVRTEVEHFLKVLSIKGLNEMVPENLLAIFDENELEMLMCGTEDISVDDFKANAVLVGASWHFRKKVILWFWAVVSSFTQEELARLLQFSTGSSLLPTGGFAALS-----PPFQI-VSSPKHGTLPTAHTCFNQLCLPTYDSCEELHKMLRYAITEGSEGFGLL 612          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005015.1 (pep scaffold:Pmarinus_7.0:GL486731:734:6293:1 gene:ENSPMAG00000004557.1 transcript:ENSPMAT00000005015.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.081 bits (414), Expect = 2.732e-46
Identity = 79/166 (47.59%), Postives = 116/166 (69.88%), Query Frame = 3
Query: 11706 VRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVY-NKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGY 12200
            V LV Q +    +++Q+++F+EGF E+IP +LI IF+E ELELL+CGL ++D+N+ + +TVY N Y    P +QWFW+A+   D E R R +QFVTGTS+VP+ GF++L G NGP  F + +   +   LP AHTCFN +DLP YE+F++L + L  AI E ++G+
Sbjct:    1 VSLVIQWRFVSRVQKQMNAFMEGFCELIPMDLIKIFDENELELLVCGLGDVDVNNWRQHTVYKNGYCANHPVVQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTVEMWG-APEKLPRAHTCFNRLDLPPYESFEELRERLNMAI-ENAQGF 164          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Yeast
Match: TOM1 (E3 ubiquitin ligase of the hect-domain class; has a role in mRNA export from the nucleus and may regulate transcriptional coactivators; involved in degradation of excess histones; interacts with Dia2p and is required for Dia2p degradation; required to target Cdc6p for ubiquitin-mediated destruction during G1 phase [Source:SGD;Acc:S000002865])

HSP 1 Score: 374.4 bits (960), Expect = 6.634e-104
Identity = 205/510 (40.20%), Postives = 310/510 (60.78%), Query Frame = 3
Query: 10692 IWHLLSQVLDAIQKSKEPD-AVIVFQSLVESFLLC--HSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQ-RFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            +W  LS+ L   +KS+  + +  +   L+ES ++    SD S+      K +++ + D                    FS+    N F  F + HKK+LN ++R  +   L    F+ L+K PK+LDFD KR +F AK   L++D   R +   + V R ++F DSY  L  KT +E K  +  I F  E G D GG+ REWY  +S ++FNP+YALF   P D  T+  N  S +N  HLS+FKF+G  I KAI D   L C+F+R  YK+ILG  +   D+E  D  +++ L ++L+ND++ + +++TFS++  ++G+ +  +LI  G  I+VTE NK +YV+ V + K+  ++++Q+ +FL GFY +I K+LI+IF+E+ELELLI GLP+ID++D K NT Y  YT    ++ +FW+A+ SFD E+RA+ +QFVTGTSKVPL GF +L G+NG  KF I     S+  LP++HTCFN ++LP YE+++ L   LL AI E  EG+G+
Sbjct: 2785 VWSSLSECLSQFEKSQAINTSATILLPLIESLMVVCRRSDLSQNRNTAVKYEDAKLLD--------------------FSKTRVENLFFPFTDAHKKLLNQMIR--SNPKLMSGPFALLVKNPKVLDFDNKRYFFNAK---LKSDNQERPKLP-ITVRREQVFLDSYRALFFKTNDEIKNSKLEITFKGESGVDAGGVTREWYQVLSRQMFNPDYALFLPVPSDKTTFHPNRTSGINPEHLSFFKFIGMIIGKAIRDQCFLDCHFSREVYKNILGRPVSLKDMESLDPDYYKSLVWILENDITDI-IEETFSVETDDYGEHKVINLIEGGKDIIVTEANKQDYVKKVVEYKLQTSVKEQMDNFLVGFYALISKDLITIFDEQELELLISGLPDIDVDDWKNNTTYVNYTATCKEVSYFWRAVRSFDAEERAKLLQFVTGTSKVPLNGFKELSGVNGVCKFSIHRDFGSSERLPSSHTCFNQLNLPPYESYETLRGSLLLAINEGHEGFGL 3267          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Yeast
Match: RSP5 (NEDD4 family E3 ubiquitin ligase; regulates processes including: MVB sorting, the heat shock response, transcription, endocytosis and ribosome stability; ubiquitinates Sec23p, Sna3p, Ste4p, Nfi1p, Rpo21p and Sem1p; autoubiquitinates; deubiquitinated by Ubp2p; regulated by SUMO ligase Siz1p, in turn regulates Siz1p SUMO ligase activity; required for efficient Golgi-to-ER trafficking in COPI mutants; mutant tolerates aneuploidy; human homolog implicated in Liddle syndrome [Source:SGD;Acc:S000000927])

HSP 1 Score: 311.997 bits (798), Expect = 6.100e-90
Identity = 160/392 (40.82%), Postives = 239/392 (60.97%), Query Frame = 3
Query: 11043 KYPKLLDFDIK--RRYFQAKVAQLRNDGDSRY--EEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            + P  LD ++   +R F+ KV   R+    R    +  ++V R  +FED+Y  + R+T E+ K+R  IKF  EEG D GG+ RE++  +SHE+FNP Y LF+ S  D  T  INP S +N  HL+YFKF+GR +   +F  + L  +F  A YK +L   +   D+E  D + +  L ++L+N +  + LD TFS     FG+  T DL P+G  I VT+ NK EYV L  Q ++   +++Q  +F++GF E+IP++L+++F+E+ELELLI G+ EID+ D K +T Y  Y  +   IQWFW+ +  +D E RAR +QF TGTS++P+ GF  L+G +GP +F I  A      LP +HTCFN +DLPQY ++D + + L  A+ E   G+G
Sbjct:  419 RLPSSLDQNVPQYKRDFRRKVIYFRSQPALRILPGQCHIKVRRKNIFEDAYQEIMRQTPEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMFNPFYCLFEYSAYDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQDMEGVDAEVYNSLNWMLENSIDGV-LDLTFSADDERFGEVVTVDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDIEDWKKHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAG-EVQQLPKSHTCFNRVDLPQYVDYDSMKQKLTLAVEETI-GFG 807          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Yeast
Match: HUL5 (Multiubiquitin chain assembly factor (E4); proteasome processivity factor that elongates polyUb chains on substrates, opposing Ubp6p, a branched polyubiquitin protease; required for retrograde transport of misfolded proteins during ERAD; required for ubiquitination of a subset of cytosolic misfolded proteins upon heat shock [Source:SGD;Acc:S000003109])

HSP 1 Score: 157.918 bits (398), Expect = 7.048e-39
Identity = 116/354 (32.77%), Postives = 172/354 (48.59%), Query Frame = 3
Query: 11151 VSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQ----DGGGLLREWYLKMSHEIF-NPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHIL----GISIRYTDLEKEDYQFFRGLEFLLKNDVSTM-FLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPE-IDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAI 12179
            +SR  + ED++   +    E +K    + FINE G+    DGGG+ +E+   +S E F +P + LF+ +     Y + P+   +   L Y  F+G+ + K ++++ L+   F   F K +L    G    ++DL   D   +  L  LL      +  LD TF I   E    +  DLIPNGS+  VT++N   YV  V   K+     + + +F  G   II  + + +FN  EL++LI G  + IDL+DLK NT Y  Y      I  FW+ L  F  E++  F++FVT   + PL GF  L+      KF I  A      LP A TC N + LP Y N   L + LL AI
Sbjct:  558 ISRDNVLEDAFNAFN-SIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDPKHELFRTND---RYELYPSVVYDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEPE-SSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVLNEFKFEEKLNFLKFVTSVPQAPLQGFKALD-----PKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILREKLLYAI 901          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Yeast
Match: HUL4 (Protein with similarity to hect domain E3 ubiquitin-protein ligases; not essential for viability; found in association with Trf4 in TRAMP complex [Source:SGD;Acc:S000003797])

HSP 1 Score: 139.813 bits (351), Expect = 2.519e-33
Identity = 107/348 (30.75%), Postives = 171/348 (49.14%), Query Frame = 3
Query: 11232 IKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVT--YTINPASY----VNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLK------NDVSTMFLDQTFSIQISEFGQTE------TRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPK-NLISIFNEKELELLICGLPE---IDLNDLKINTVY-NKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQIS-LASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            I+F+NE G D GGL +EW+  ++  +FNP   LF    +     + I+P ++      N+ L  +   G  +  AIF++ +L   F +A YK +    + + D  +   +  R L  +L        DV ++  + T+         ++      T +L  NG  + +T+ NK E+V    +  +  +I  Q + F+ GF  +  + N I +FN +ELE L+CG  E    D   L+  T Y   ++  S  + WFW+ +ES+D   + + +QFVT + ++P  G S +        F+IS L S  ++ LP AHTCFN I L  Y +  KL   LL AI E SEGYG
Sbjct:  551 IEFVNEPGIDAGGLRKEWFFLLTKSLFNPMNGLFIYIKESSRSWFAIDPPNFDKSKGKNSQLELYYLFGVVMGLAIFNSTILDLQFPKALYKKLCSEPLSFEDYSELFPETSRNLIKMLNYTEDNFEDVFSLTFETTYRNNNWILNDSKSSKEYVTVELCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVFAECNSIKLFNSEELERLVCGDEEQTKFDFKSLRSVTKYVGGFSDDSRAVCWFWEIIESWDYPLQKKLLQFVTASDRIPATGISTIP-------FKISLLGSHDSDDLPLAHTCFNEICLWNYSSKKKLELKLLWAINE-SEGYG 890          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Yeast
Match: UFD4 (Ubiquitin-protein ligase (E3); interacts with Rpt4p and Rpt6p, two subunits of the 19S particle of the 26S proteasome; cytoplasmic E3 involved in the degradation of ubiquitin fusion proteins; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000001493])

HSP 1 Score: 98.2117 bits (243), Expect = 2.268e-20
Identity = 81/311 (26.05%), Postives = 139/311 (44.69%), Query Frame = 3
Query: 11364 INPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTD------------LEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGF-----YE----IIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNK------YTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISL-----ASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGY 12200
            +NP S  N   +  F ++G F+A+++ DN++L   F++ F++ +  +S                 +E  D    + L++++ N    M L ++ S+  +  G  +  +LIP G    +   N  EY+  V  + +   I +QL +F+EGF     YE    + P  L+ IF   E              D  + T+Y        YT  S  I  F   + +F + +R  F+QF+TG+ K+P+GGF  L       KF + L        +  +LP+  TC N + LP+Y + D +   L  AI E +  +
Sbjct: 1191 LNPFSN-NEKVIELFGYLGTFVARSLLDNRILDFRFSKVFFELLHRMSTPNVTTVPSDVETCLLMIELVDPLLAKSLKYIVANKDDNMTL-ESLSLTFTVPGNDDI-ELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAFIEGFSKVFSYERMLILFPDELVDIFGRVE-------------EDWSMATLYTNLNAEHGYTMDSSIIHDFISIISAFGKHERRLFLQFLTGSPKLPIGGFKSLN-----PKFTVVLKHAEDGLTADEYLPSVMTCANYLKLPKYTSKDIMRSRLCQAIEEGAGAF 1480          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Nematostella
Match: EDO34473 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP65])

HSP 1 Score: 340.502 bits (872), Expect = 4.265e-104
Identity = 200/424 (47.17%), Postives = 253/424 (59.67%), Query Frame = 3
Query: 10944 FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCI--KFINEEGQDGGGLLREWYLKMSHEIFNPNY-ALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            FL+F E H+ VLN ILR+ T   L    F+ L+ + ++LDFD+KRR+F+ ++ Q  +D   R E+  + + R  +FEDSY  LHR++AEEWK R  I  + I         LL  W     H  F  ++  + KVS                      +   RF+     +  L +      F KH L  ++R   LE  D         L K  +  +F   T +  + EFG +E RDLIPNG  I VTEENK EYV+LVCQ KMTGAIR+Q+ SFLEGFYEIIPK LISIFNE+ELELLI GLP IDL+DLK +  Y+KY   S QIQWFW+AL SFDQ  RA+F+QFVTGTSKVPL GF+ LEGMNG  KFQI     +T+ LP+AHTCFN +DLP YE +DKL   L  A  EC EG+G+
Sbjct:   23 FLKFAETHRTVLNQILRQSTV-HLSNGPFAVLVDHTRVLDFDVKRRFFRQELEQ--SDEGIRREDLTIPIRRDHVFEDSYRELHRRSAEEWKARLYIVNRLI-------FPLLTIWMSDNIHVQFEYSFTCIIKVS---------------------MELSARFLC----ERGLFSTSLNILFVKHTLN-TVRPQKLELGDT--------LQKVALYILF---TIARLVREFGLSEIRDLIPNGRNIPVTEENKREYVKLVCQMKMTGAIRKQIDSFLEGFYEIIPKRLISIFNEQELELLISGLPNIDLDDLKSHIEYHKYNENSLQIQWFWRALRSFDQAARAKFLQFVTGTSKVPLQGFAALEGMNGFQKFQIHRDDRNTDRLPSAHTCFNQLDLPAYETYDKLRTMLKKACDECPEGFGL 399          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Nematostella
Match: EDO49327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHD5])

HSP 1 Score: 307.76 bits (787), Expect = 2.877e-93
Identity = 152/354 (42.94%), Postives = 227/354 (64.12%), Query Frame = 3
Query: 11145 VQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFK-VSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            + VSR  LFE+S+ ++ R    + ++R  I F  EEG D GG+ REW+  +SHE+ NP Y LF+  + +  +  IN AS VN +HL YFKF+GRFIA A++  K +   FT  FYK +L   +   DLE  D +F+  L ++ +N++    L+  F++ +   G+  + DL P G+ I VTEENK EY+ L+ + ++   I +Q  +FLEG +E++P   I  F+E+ELEL++CG+ EID+ D + NTVY  YT  S Q+ WFWQA++++D E R R +QFVTGT ++P+GGF++L G NGP KF I      T  LP +HTCFN +DLP Y+++++L + L  AI E +EG+ 
Sbjct:   11 ITVSRTNLFEESFQQVMRYQPHDLRRRLYITFKGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYANKNNYSLQINAASSVNPDHLMYFKFIGRFIAMALYHGKFIDRGFTLPFYKRMLNKKLLMKDLETIDPEFYNSLVWVKENNIEECGLEMFFTVDMELLGKVTSHDLKPGGTDIAVTEENKEEYISLMTEWRLNRGIEEQTRAFLEGMHEVLPLYWIQYFDERELELMLCGMQEIDVEDWQQNTVYRHYTRNSKQVMWFWQAVKAYDNEKRIRLLQFVTGTCRLPVGGFTELMGDNGPQKFCIEKVGKET-WLPRSHTCFNRLDLPPYKSYEQLVEKLTFAIEE-TEGFA 362          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Nematostella
Match: EDO46071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR93])

HSP 1 Score: 305.064 bits (780), Expect = 1.398e-85
Identity = 175/390 (44.87%), Postives = 235/390 (60.26%), Query Frame = 3
Query: 11049 PKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYG--RLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYV-NNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVY-NKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNH-LPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGY 12200
            P   D+  K  YF++K+ +  N   ++YE   + + R  L EDSY   +L     E  K R  I F  E G D GGL REW+  +S E+FNP Y LF+ S  D  T  INP S + N  HLSYFKF+GR    A++  KLL  +F R FYK +LG  I   D+E  D +++  L ++L+ND     LD  F +    FG    +DL PNGSQ  VT ENK EY+ LV + +    +  Q+ +F+EGF ++IP NLI IF+E+ELELL+CGL EID  D + N+ Y  +Y      IQWFW+A+ SFD E RAR +QFVTGTS+VP+ GFS+L G NGP +F I      T H LP AHTCFN +DLP+Y ++ +L + L  AI E ++G+
Sbjct:  605 PYSRDYKRKCDYFRSKLKRPSN-VPNKYE---IHIRRRNLMEDSYRAVQLSIVKPEILKSRLWIVFDGETGLDYGGLQREWFYLLSKEVFNPYYGLFEYSASDNYTLQINPNSGLCNEEHLSYFKFIGRVAGMAVYHGKLLDAFFIRPFYKMMLGRPITLIDMESVDSEYYNSLNWILENDPED--LDLHFCVDEELFGILSVKDLKPNGSQTNVTNENKREYINLVIKWRFVSRVEDQMRAFMEGFCDLIPHNLIQIFDERELELLMCGLGEIDTVDWRKNSNYRGEYHDKHIVIQWFWKAVNSFDIETRARLLQFVTGTSRVPMNGFSELYGSNGPQRFTIE--PWGTPHSLPRAHTCFNRLDLPRYRSYYELRERLRIAI-ENTQGF 985          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Nematostella
Match: EDO49328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHD7])

HSP 1 Score: 279.256 bits (713), Expect = 9.586e-80
Identity = 144/352 (40.91%), Postives = 215/352 (61.08%), Query Frame = 3
Query: 11079 RYFQAKVAQLRN--DGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFK-VSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFW-QALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSI 12122
            R F+ KV Q R+    ++      + VSR  LFE+S+ ++ R    + ++R  I F  EEG D GG+ REW+  +SHE+ NP Y LF+  + +  +  IN AS VN +HL YFKF+GRFIA A++  K +   FT  FYK +L   +   DLE  D +F+  L ++ +N++    L+  F++ +   G+  + DL P G+ I V EENK EY+ L+ + ++   I +Q  +FLEG +E++P   I  F+E+ELEL++CG+ EID+ D + NTVY  YT  S Q+ WFW QA++++D E R R +QFVTGT ++P+GGF++L G NGP KF I      T  LP +HT +  I
Sbjct:  308 RSFRWKVGQFRHLCQANTLPSHIKITVSRTNLFEESFQQVMRYQPHDLRRRLYITFKGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYANKNNYSLQINAASSVNPDHLMYFKFIGRFIAMALYHGKFIDRGFTLPFYKRMLNKKLLMKDLETIDPEFYNSLVWVKENNIEECGLEMFFTVDMELLGKVTSHDLKPGGTDIAVIEENKEEYISLMTEWRLNRGIEEQTRAFLEGMHEVLPLYWIQYFDERELELMLCGMQEIDVEDWQQNTVYRHYTRNSKQVMWFWQQAVKAYDNEKRIRLLQFVTGTCRLPVGGFTELMGSNGPQKFCIEKVGKET-WLPRSHTWWVHI 658          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Nematostella
Match: EDO49383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG94])

HSP 1 Score: 255.758 bits (652), Expect = 1.751e-75
Identity = 135/328 (41.16%), Postives = 197/328 (60.06%), Query Frame = 3
Query: 11217 KQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPAS-YVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVY-NKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECS 12191
            + R  I+F  EEG D GG  RE++  +S +IFNP Y LF+ S  D  T  ++P S YV+N+H  +F+F GR +   I    LL  +FTR FYK +L      +D+E  D  F + + ++++ND+  + LD TFS+    FGQ   R+LIP G  I VTE+NK +YV  + + ++   + +Q+ S + GF E+I   L++IF+ +ELEL+I G  +ID+ D + NT Y + Y      ++WFW+A+ SFD E R R +QFVTGTS +P  GF+ L G  GP KF I      T  LP AHTCFN +D+P Y ++D+L + L  A+ E  
Sbjct:   10 RNRLEIQFAGEEGLDYGGPAREFFFLISRQIFNPYYGLFEYSANDTYTVQVSPVSLYVDNSH-EWFRFCGRIVGLVIIHQHLLDAFFTRTFYKALLRSLCDLSDVEALDALFHQSMTWVIENDIEDV-LDLTFSVSEEIFGQVTERELIPGGKDIAVTEQNKGDYVAEMVKWRVERGVSEQMESIVRGFNEVIDPALVNIFDARELELVISGTADIDIKDWRRNTEYRSGYHDNHKVVKWFWKAVSSFDNEQRLRLLQFVTGTSSIPYEGFAALRGSTGPRKFSIERWGDYTK-LPRAHTCFNRLDMPIYRSYDELLEKLTYAVEETG 334          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Medaka
Match: huwe1 (HECT, UBA and WWE domain containing E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101170019])

HSP 1 Score: 589.726 bits (1519), Expect = 3.296e-168
Identity = 294/522 (56.32%), Postives = 367/522 (70.31%), Query Frame = 3
Query: 10692 IWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHS----------DCSEIHEEHNKSDNSNVSD-PLSHLNTSLVVDDTFMNSPAFSENGKHNP-----FLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSP-DGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGM 12206
            +W +L + L  +++S +  AV+V Q  VE+F L H+          D  E    H K +   +S  PL+    S  +D  F   P+      + P     FL F E H+ VLN ILR+ T    D   F+ L+ Y ++LDFD+KR+YF+ ++ +L  D   R E+  V V R  +FEDSY  LHRK+ E+ K R  I F  EEGQD GGLLREWY+ +S E+FNP YALF+ SP D VTYTINP+S+ N NHLSYFKFVGR +AKA++DN+LL CYFTR+FYKHILG S+RYTD+E EDY FF+GL +LL+NDVST+  + TFS ++ EFG  E RDL PNG+ ILVTEENK EYV LVCQ KMTGAIR+QL +FLEGFYEIIPK LISIF E+ELELLI GLP ID++DLK NT Y+KY  +S QIQWFW+AL SFDQ DRA+F+QFVTGTSKVPL GF+ LEGMNG  KFQI     ST+ LP+AHTCFN +DLP YE+++KL   LL AI+ECSEG+G+
Sbjct: 3605 LWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPVRDTRESQLSHIKDEPPPLSPAPLTPATPS-SLDPFFSREPSSMHISSNLPPDTQKFLRFAETHRTVLNQILRQSTTHLAD-GPFAVLVDYIRILDFDVKRKYFRQELERL--DEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEDMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRVVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYPFFQGLVYLLENDVSTLGYELTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMKMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKANTEYHKYQSSSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESYEKLRHMLLLAIQECSEGFGL 4122          

HSP 2 Score: 380.563 bits (976), Expect = 8.875e-105
Identity = 251/762 (32.94%), Postives = 394/762 (51.71%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGH--WTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECC---VTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQ-----PESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKC---LSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNM---TGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKI------------------CLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDXXXXXXXXXXXXXXYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKA 2204
            MK+DR K+         +C  L  +L A  ++ L+ E++ I  W+ GKCEL  W D+LDR D IL +    V +  W L  D+P N  L   ++A+L FT  LIE+S  R+LY S EH+  L  + +M ++ ++L L Y FSKRSNY +RL S  R  +L RL  +AE+WGGK++GFGLAECC     +  P SA T+ +EF  + +S     ++ S+                 TL  +H++      ESPSE+ME+L   YN+     Q  LF  +RL   F   ++R   +  R+ A+SIL Y+N +++     L   ++EELVDVL++ D++ + IKA +LRTLT+I+H  +     P L N+   TG  SYHG  P ++R  I  ++    +PY       + TA+ SFLYHLA  +         LV  G+++++ ++I +   E D I+F TRAVRV D I     L+ ++    S +   + RL+ E+ +                   ++SE       S+    QR   +KSMLN +K+ I D  +S+ ++  MDG LP  L+ I  N    + P L L + EV+T FV+  PS +S++Q+  LT  +L  L  + +P  R+ L +LP + SAL +N RG++   + +  ++  K L    ++ AMR +R  + +  + ++                 + +A++EL R +    K     +I K  + + N+G+   AP     KP SIQKA
Sbjct:    1 MKVDRSKLKKTPTEAPADCRILIDKLKACSDDQLLVELQHIKTWNIGKCELYHWVDLLDRFDGILCDAGQTVENMSWLLVCDRPENGQLKALLLAVLNFTALLIEYSFSRHLYSSIEHLTNLLASCDMQVVLSVLNLLYVFSKRSNYITRLGSDKRTPLLARLQHLAESWGGKENGFGLAECCRDLPLQKYPPSATTLHFEFYAEPASEVKLDRKSSSN----------------TLHYIHIEQLDKISESPSEIMESLTAMYNIPK-DKQTLLFTHIRLAHGFSNHKKRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQLVDIKAASLRTLTSIVHLERT----PKLSNIIDCTGTASYHGFLPVLVRNCIQAMIDPVIEPYP----HQFATALFSFLYHLASYDAGGEA----LVSCGMMEALLKVIKFLGDEQDQITFVTRAVRVVDLIT---NLDMAAFQSHSGLSIFICRLEHEVDLSRKECPFVIKPKIQRPSAAVESEDMDTDMDSIQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISN-AEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGLHSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASN-----------------LGSAVDELMR-HQPTLKTDATTAIIKLLEEICNLGR---APEYICQKP-SIQKA 707          

HSP 3 Score: 66.6254 bits (161), Expect = 7.640e-10
Identity = 81/316 (25.63%), Postives = 122/316 (38.61%), Query Frame = 3
Query: 4875 KHITQLWLIIDQYERTAFALRIRKDV-IYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIML----LPSKSK------------------------DQRKFENLSEYEHKIISCVPDPLGDEEVVELSDNMLQFLI--SIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSA--IPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIEL 5723
            K IT + LIID YE+ A + + R+ +  Y       W W DDR G W   S  +N+ I+ ++R G+  +         Y   F ++ Q NEE+   RP+ML    +P  SK                        D  + +  +      +  V     D  V  L+D+M+  LI   +  I      D L A   L +RL   +  A    A  KS   I  L       G+T  LVT    L R   E P  L+HT+  ++   V+ GA             S+++ Y +    P   R+ E  +   S  I +
Sbjct: 1571 KWITPVLLIIDFYEKMAVSSKRREQMNKYLQPNGNNWRWFDDRSGRWCSYSASNNSTIDSAWRAGE-SSVRFTAGRRRYTVLFNTMVQVNEETGNRRPVMLTVQRVPRISKPPKTGNVPDSERSEGDKMEIKSKEDSSQLKETTSGPSSTVESVWSQGTDIVVKGLTDDMITVLIRACVSMISVPVDPDTLHATLRLCLRLTRNHHYAM-MFAELKSTRMILGLTQGSGFNGFT-PLVTL---LFRHIIEDPATLRHTMEKVVRSAVTSGAGSTTSGVVSGSLGSREINYILRVLGPAACRNPECFIETASNCIRI 1880          

HSP 4 Score: 57.3806 bits (137), Expect = 4.824e-7
Identity = 27/73 (36.99%), Postives = 48/73 (65.75%), Query Frame = 3
Query: 2562 VYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWA 2780
            + LMDYI NV KF+E  +S+   +    Q+  +++GL  ++ IL +P+LP DFP+S ACQ++  + + +L+ +
Sbjct:  761 IPLMDYILNVMKFVESILSNNTTDDHC-QEFVNQKGLLPLVSILGLPNLPIDFPTSAACQAVAGVCKSILTLS 832          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Medaka
Match: smurf2 (E3 ubiquitin-protein ligase SMURF2 [Source:NCBI gene;Acc:101160323])

HSP 1 Score: 318.161 bits (814), Expect = 3.882e-92
Identity = 162/348 (46.55%), Postives = 219/348 (62.93%), Query Frame = 3
Query: 11145 VQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGV-TYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRE 12185
            ++VSR  +FE+SY ++ +   ++  +R  +KF  EEG D GG+ REW   +SHE+ NP Y LF+ S D + T  INP S VN  HLSYF FVGR +  A+F    +   FT  FYK +LG  I   D+E  D      L ++L ND+ T  LD TF ++ + +G+    +L PNG  I VT+E K EYVRL    +    I  Q  +  +GF E+IP++L+  F+EKELEL++CGL +ID++D K NT     TP S  ++WFW+A+E FD+E RAR +QFVTG+S+VPL GF  L+G  GP  F I     STN+LP AHTCFN ID+P YE +DKL+  LLTAI E
Sbjct:  357 IEVSREEIFEESYRQVMKMRPKDLWKRLMVKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLDDMESVDPDLHNSLVWILDNDI-TGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVTQETKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKAFDEKELELIVCGLGKIDIHDWKGNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDASTNNLPKAHTCFNRIDIPPYETYDKLYDKLLTAIEE 703          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Medaka
Match: smurf1 (SMAD specific E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101167123])

HSP 1 Score: 317.39 bits (812), Expect = 7.155e-92
Identity = 157/348 (45.11%), Postives = 225/348 (64.66%), Query Frame = 3
Query: 11145 VQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGV-TYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRE 12185
            ++VSR  +FE+SY ++ +   ++ K+R  +KF  EEG D GG+ REW   + HE+ NP Y LF+ S D + T  INP S +N +HLSYF FVGR +  A+F    +   FT  FYK +LG  I+  DLE  D +  + L ++L+ND++++ LD TF ++ + FG+    +L PNG  + VTEENK EYVRL    +    I  Q  +  +GF E+IP++L+  F+ KELEL+I GL +IDL D K NT     T  S  ++WFWQA+E+F +E R R +QFVTG+++VPL GF  L+G  GP  F I L   +T++LP AHTCFN ID+P YE+++KL++ LLTA+ E
Sbjct:  353 IEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYTLQINPDSSINPDHLSYFHFVGRVMGLAVFHGHYINGSFTLPFYKQLLGKPIQLNDLETTDPELHKSLVWILENDITSV-LDHTFCVEHNAFGKLSQHELKPNGRNVAVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFGELIPQHLLKPFDHKELELIIGGLGKIDLADWKTNTRLKHCTSESNVVRWFWQAVEAFSEERRGRLLQFVTGSTRVPLQGFKALQGSAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEE 699          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Medaka
Match: itcha (E3 ubiquitin-protein ligase Itchy [Source:NCBI gene;Acc:101167949])

HSP 1 Score: 320.087 bits (819), Expect = 7.862e-92
Identity = 168/409 (41.08%), Postives = 243/409 (59.41%), Query Frame = 3
Query: 10995 RRTACALD--QSNFSALLKYPKLL---DFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFK-VSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            RRT   +D      S+L   P++    DF  K +YF+    QL     S  +   + VSR  LFEDS+ ++     ++ ++R  I F  EEG D GG+ REW+  +SHE+ NP Y LF+    D     INPASY+N +HL YFKF+GRFIA A+F  K +   F+  FYK IL   +   DLE  D +F+  L ++  N++    L+  FS+     G+  T +L P+G  I VTE+NK EY+RLV + +++  + +Q  +F EGF E++P+  +  F+ KELE+++CG+ EIDL D + NT+Y  Y   S QI WFWQ ++  D E R R +QFV GT ++P+GGF+ L G NGP KF I       N LP +HTCFN +DLP Y+ +++L + L+ AI E +EG+G
Sbjct:  393 RRTTTYIDPRTGKSSSLENGPQITYVRDFKAKVQYFRFWCQQL-----SMPQHIKITVSRKTLFEDSFQQIMSFHPQDLRRRLWIIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFKFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPLTLKDLESIDPEFYNSLIWIKDNNIEECGLEMFFSVDKEILGEVTTHELKPDGGNIQVTEDNKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQYFDAKELEVMLCGMQEIDLADWQRNTIYRHYARNSKQIIWFWQFVKEMDNEKRMRLLQFVAGTCRLPMGGFADLMGSNGPQKFCIEKVG-KENWLPRSHTCFNRLDLPPYKTYEQLKEKLMFAIEE-TEGFG 794          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Medaka
Match: smurf1 (SMAD specific E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101167123])

HSP 1 Score: 317.775 bits (813), Expect = 9.820e-92
Identity = 157/348 (45.11%), Postives = 225/348 (64.66%), Query Frame = 3
Query: 11145 VQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGV-TYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRE 12185
            ++VSR  +FE+SY ++ +   ++ K+R  +KF  EEG D GG+ REW   + HE+ NP Y LF+ S D + T  INP S +N +HLSYF FVGR +  A+F    +   FT  FYK +LG  I+  DLE  D +  + L ++L+ND++++ LD TF ++ + FG+    +L PNG  + VTEENK EYVRL    +    I  Q  +  +GF E+IP++L+  F+ KELEL+I GL +IDL D K NT     T  S  ++WFWQA+E+F +E R R +QFVTG+++VPL GF  L+G  GP  F I L   +T++LP AHTCFN ID+P YE+++KL++ LLTA+ E
Sbjct:  375 IEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYTLQINPDSSINPDHLSYFHFVGRVMGLAVFHGHYINGSFTLPFYKQLLGKPIQLNDLETTDPELHKSLVWILENDITSV-LDHTFCVEHNAFGKLSQHELKPNGRNVAVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFGELIPQHLLKPFDHKELELIIGGLGKIDLADWKTNTRLKHCTSESNVVRWFWQAVEAFSEERRGRLLQFVTGSTRVPLQGFKALQGSAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEE 721          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Planmine SMEST
Match: SMESG000059703.1 (SMESG000059703.1)

HSP 1 Score: 7947.81 bits (20621), Expect = 0.000e+0
Identity = 4052/4065 (99.68%), Postives = 4055/4065 (99.75%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDXXXXXXXXXXXXXXYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMPLQENVDSQEIASTAGPSGVYSSDSNQAADLLAVMTAVEEADREVEQIMEMSGDEDDGVADNEMTQAIDAEEDRTPSDGCGKDNKTEEMNQFSCDDDAVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQLYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLRQDILAELKSGIIDYARLLPLLNWEAMVLMNLLFEDEEACLEDLKRLCINERGTCADNEHNEERCFLTKKSSLSTCQQLFSDNPRSEKIIKRMLQITQKAANDMVELLVTLTKFCCVKPDYSXXXXXXXXXXXGSIPTGKNKMALLNKIAEHCKSLLERESPYTLQAGQDSWPEDPHSELPVEKACQKILSDIKFLHPMKYFCFTTIHRILTGGDLNKKPFLGFFYAFQMNNGLEVFFECANELLDTIRYIQYLDPNANS--SVKIMLESFLITVDRMTQIRRITQEFVDSTDKELRDKFDIDLYQRMIRAYMLEPXXXXXXXXXXXXXXXNNQSQESLMNIIAFLTSYIFDRDXXXXXXXXXXXXXIVFNDDHEQLINQHISFIMELGFSRENARRALERNDYDPTQAVSSLFNSDLGIRXXXXXXXXXXXXXXXXXVRPNPLNENSREISTIEARLKELEMKNVSIKEMIKESFLINLFNLQKEKGIDIITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSGKEISGANIEDSPNGLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLPSKSKDQRKFENLSEYEHKIISCVPDPLGDEEVVELSDNMLQFLISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIELNCQTEKQVLKTYSISKSPSLTSKATQPLMELEKKQIAIVRFLVESALSYYIEKNDVWCELFKKLKLNTEYDLKNMIASPNYLLETHTVVTSNLENNFSSNQHSSGTVKHTYKLTGKEFLIYLEELIFSYEQVGAFTINLRLFNRPLSFYLVNIYLQEACALLDSMRSKEPGSNTSPSMSREQNQFQQLVSLQIIEAFLLTVKESYDVIIGEIVRNLKMRSHHKDGDCRNTYIVVIMKLLNDLITRLPVSVSKKLVILMYKYRLPNDLCRLLSVVDCSVAQHKSVLVDILTVVDSLCRPERQMYINKRQRSSKSXXXXXXXXXXXXXXXADTQATSVIAGTSAATNEITAQEMETDDVFYVDINAWSRNSRSENTDTAAVDNMENLEASNADEHPXXXXXXXXXXXXXXXXXXXXSEFRDIDAEYDFDEPQMYDDDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXRFDEDIRETENSSHSNGRQEQSRRIFQILNHNYYNISQEGENTETPRHDTETSLRDRLSNVQMMSTYDHHPNYVLNESFSLDAPPSQDDTSTFRLADNLYFVTNSREYDISSQPSNYYPNDLAGCSNTPSNNLLRTTNLESSAVSQNPQVPTGSQEDSINGRGWRGLTYAPGARYMRLEARTLRQNTIRNILTLNRGSFMDRAPNTRSPSNRFVXXXXXXXXXXXXFEMQEILARALSNIPSGWNFLINPTASAPQNTINNFTFNDISMITNFRRWIVEARTLYGREITDLVMLARARVYQSVYHSVSSKLTEASVDEKEVVDSKTNMVKTANSNPDNVDNERNSITDQTDIGRDVSMEQDLMMQPDIMIESLDEPNESVIGEEMVTPTPSETMESRDEPIDNIEIEQPNEVISRVDQSLXXXXXXXXXXXXXNDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKISLPKENTDSKPKIFXXXXXXXXXILCTPIGSGSCTDMSRSSSIQDDTFRQYPNNKSLFFHSFERGFALTDQVFVPSISKIYKHKNKSGIQSLEMPEITIHESVSGSVAKALIDSLSSISTMHTKEFFPTSQSKKVPTNFWFTLAWYMSLKSVSLEDQCPETHLPPNEEYDYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKSFSMKEKPVAAEWSIATNDGDNHESSTPTASTGNETPLSITKEKSETKAVNVSDPHLNRVNVKTISHLVNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMIXXXXXXXXXXXXPSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHXXXXXXXXXXRKVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGMI 12209
            MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDTATTNHSHPSTPTSYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMPLQENVDSQEIASTAGPS VY SDSNQAADLLAVMTAVEEADREVEQIMEMSGDEDDGVADNEMTQAIDAEEDRTPSDGCGKDNKTEEMNQFSCDDDAVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQLYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLRQDILAELKSGIIDYARLLPLLNWEAMVLMNLLFEDEEACLEDLKRLCINERGTCADNEHNEERCFLTKKSSLSTCQQLFSDNPRSEKIIKRMLQITQKAANDMVELLVTLTKFCCVKPDYSYVVRVRYNRVNGSIPTGKNKMALLNKIAEHCKSLLERESPYTLQAGQDSWPEDPHSELPVEKACQKILSDIKFLHPMKYFCFTTIHRILTGGDLNKKPFLGFFYAFQMNNGLEVFFECANELLDTIRYIQYLDPNANS  SVKIMLESFLITVDRMTQIRRITQEFVDSTDKELRDKFDIDLYQRMIRAYMLEPISKLFSFSSLDIDLLNNQSQESLMNIIAFLTSYIFDRDTKKSESEETPEEPIVFNDDHEQLINQHISFIMELGFSRENARRALERNDYDPTQAVSSLFNSDLGIRTAESSSSTNEPETSSKSVRPNPLNENSREISTIEARLKELEMKNVSIKEMIKESFLINLFNLQKEKGIDIITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSGKEISGANIEDSPNGLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLPSKSKDQRKFENLSEYEHKIISCVPDPLGDEEVVELSDNMLQFLISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIELNCQTEKQVLKTYSISKSPS TSKATQPLMELEKKQIAIVRFLVESALSYYIEKNDVWCELFKKLKLNTEYDLKNMIASPNYLLETHTVVTSNLENNFSSNQHSSGTVKHTYKLTGKEFLIYLEELIFSYEQVGAFTINLRLFNRPLSFYLVNIYLQEACALLDSMRSKEPGSNTSPSMSREQ QFQQLVSLQIIEAFLLTVKESYDVIIGEIVRNLKMRSHHKDGDCRNTYIVVIMKLLNDLITRLPVSVSKKLVILMYKYRLPNDLCRLLSVVDCSVAQHKSVLVDILTVVDSLCRPERQMYINKRQRSSKSNLEL+NKRQRRLNNNADTQATSVIAGTSAATNEITAQEMETDDVFYVDINAWSRNSRSENTDT AVDNMENLEASNADEHPVDVDDDEEMDEYDEVDGVMMSEFRDIDAEYDFDEPQMYDDDNNTESETDYEEIEEDEGSAGSQDGDSQGDRFDEDIRETENSSHSNGRQEQSRRIFQILNHNYYNISQEGENTETPRHDTETSLRDRLSNVQMMSTYDHHP+YVLNESFSLDAPPSQDDTSTFRLADNLYFVTNSREYDISSQPSNYYPNDLAGCSNTPSNNLLRTTNLESSAVSQNPQVPTGSQEDSINGRGWRGLTYAPGARYMRLEARTLRQNTIRNILTLNRGSFMDRAPNTRSPSNRFVDADLSLDSLEADFEMQEILARALSNIPSGWNFLINPTASAPQNTINNFTFNDISMITNFRRWIVEARTLYGREITDLVMLARARVYQSVYHSVSSKLTEASVDEKEVVDSKTNMVKTANSNPDNVDNERNSI DQTDIGRDVSMEQDLMMQPDIMIESLDEPNESVIGEEMVTPTPSETMESRDEPIDNIEIEQPNEVISRVDQSLGAVGGAT AAARANDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKISLPKENTDSKPKIFSSPSTSESSILCTPIGSGSCTDMSRSSSIQDDTFRQYPNNKSLFFHSFERGFALTDQVFVPSISKIYKHKNKSGIQSLEMPEITIHESVSGSVAKALIDSLSSISTMHTKEFFPTSQSKKVPTNFWFTLAWYMSLKSVSLEDQCPETHLPPNEEYDYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKSFSMKEKP AAEWSIATNDGDNHESSTPTASTGNETPLSI+KEKSETKAVNVSDPHLNRVNVKTISHLVNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMILENECNETCLNEPSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHLNLLDLFNLLRKVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGMI
Sbjct:    1 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDTATTNHSHPSTPTSYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMPLQENVDSQEIASTAGPSAVYPSDSNQAADLLAVMTAVEEADREVEQIMEMSGDEDDGVADNEMTQAIDAEEDRTPSDGCGKDNKTEEMNQFSCDDDAVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQLYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLRQDILAELKSGIIDYARLLPLLNWEAMVLMNLLFEDEEACLEDLKRLCINERGTCADNEHNEERCFLTKKSSLSTCQQLFSDNPRSEKIIKRMLQITQKAANDMVELLVTLTKFCCVKPDYSYVVRVRYNRVNGSIPTGKNKMALLNKIAEHCKSLLERESPYTLQAGQDSWPEDPHSELPVEKACQKILSDIKFLHPMKYFCFTTIHRILTGGDLNKKPFLGFFYAFQMNNGLEVFFECANELLDTIRYIQYLDPNANSERSVKIMLESFLITVDRMTQIRRITQEFVDSTDKELRDKFDIDLYQRMIRAYMLEPISKLFSFSSLDIDLLNNQSQESLMNIIAFLTSYIFDRDTKKSESEETPEEPIVFNDDHEQLINQHISFIMELGFSRENARRALERNDYDPTQAVSSLFNSDLGIRTAESSSSTNEPETSSKSVRPNPLNENSREISTIEARLKELEMKNVSIKEMIKESFLINLFNLQKEKGIDIITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSGKEISGANIEDSPNGLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLPSKSKDQRKFENLSEYEHKIISCVPDPLGDEEVVELSDNMLQFLISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIELNCQTEKQVLKTYSISKSPSPTSKATQPLMELEKKQIAIVRFLVESALSYYIEKNDVWCELFKKLKLNTEYDLKNMIASPNYLLETHTVVTSNLENNFSSNQHSSGTVKHTYKLTGKEFLIYLEELIFSYEQVGAFTINLRLFNRPLSFYLVNIYLQEACALLDSMRSKEPGSNTSPSMSREQIQFQQLVSLQIIEAFLLTVKESYDVIIGEIVRNLKMRSHHKDGDCRNTYIVVIMKLLNDLITRLPVSVSKKLVILMYKYRLPNDLCRLLSVVDCSVAQHKSVLVDILTVVDSLCRPERQMYINKRQRSSKSNLELINKRQRRLNNNADTQATSVIAGTSAATNEITAQEMETDDVFYVDINAWSRNSRSENTDTVAVDNMENLEASNADEHPVDVDDDEEMDEYDEVDGVMMSEFRDIDAEYDFDEPQMYDDDNNTESETDYEEIEEDEGSAGSQDGDSQGDRFDEDIRETENSSHSNGRQEQSRRIFQILNHNYYNISQEGENTETPRHDTETSLRDRLSNVQMMSTYDHHPSYVLNESFSLDAPPSQDDTSTFRLADNLYFVTNSREYDISSQPSNYYPNDLAGCSNTPSNNLLRTTNLESSAVSQNPQVPTGSQEDSINGRGWRGLTYAPGARYMRLEARTLRQNTIRNILTLNRGSFMDRAPNTRSPSNRFVDADLSLDSLEADFEMQEILARALSNIPSGWNFLINPTASAPQNTINNFTFNDISMITNFRRWIVEARTLYGREITDLVMLARARVYQSVYHSVSSKLTEASVDEKEVVDSKTNMVKTANSNPDNVDNERNSINDQTDIGRDVSMEQDLMMQPDIMIESLDEPNESVIGEEMVTPTPSETMESRDEPIDNIEIEQPNEVISRVDQSLGAVGGATAAAARANDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKISLPKENTDSKPKIFSSPSTSESSILCTPIGSGSCTDMSRSSSIQDDTFRQYPNNKSLFFHSFERGFALTDQVFVPSISKIYKHKNKSGIQSLEMPEITIHESVSGSVAKALIDSLSSISTMHTKEFFPTSQSKKVPTNFWFTLAWYMSLKSVSLEDQCPETHLPPNEEYDYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKSFSMKEKPAAAEWSIATNDGDNHESSTPTASTGNETPLSISKEKSETKAVNVSDPHLNRVNVKTISHLVNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMILENECNETCLNEPSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHLNLLDLFNLLRKVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGMI 4065          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Planmine SMEST
Match: SMESG000059703.1 (SMESG000059703.1)

HSP 1 Score: 7942.8 bits (20608), Expect = 0.000e+0
Identity = 4051/4066 (99.63%), Postives = 4055/4066 (99.73%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNST---NQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDXXXXXXXXXXXXXXYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMPLQENVDSQEIASTAGPSGVYSSDSNQAADLLAVMTAVEEADREVEQIMEMSGDEDDGVADNEMTQAIDAEEDRTPSDGCGKDNKTEEMNQFSCDDDAVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQLYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLRQDILAELKSGIIDYARLLPLLNWEAMVLMNLLFEDEEACLEDLKRLCINERGTCADNEHNEERCFLTKKSSLSTCQQLFSDNPRSEKIIKRMLQITQKAANDMVELLVTLTKFCCVKPDYSXXXXXXXXXXXGSIPTGKNKMALLNKIAEHCKSLLERESPYTLQAGQDSWPEDPHSELPVEKACQKILSDIKFLHPMKYFCFTTIHRILTGGDLNKKPFLGFFYAFQMNNGLEVFFECANELLDTIRYIQYLDPNANSSVKIMLESFLITVDRMTQIRRITQEFVDSTDKELRDKFDIDLYQRMIRAYMLEPXXXXXXXXXXXXXXXNNQSQESLMNIIAFLTSYIFDRDXXXXXXXXXXXXXIVFNDDHEQLINQHISFIMELGFSRENARRALERNDYDPTQAVSSLFNSDLGIRXXXXXXXXXXXXXXXXXVRPNPLNENSREISTIEARLKELEMKNVSIKEMIKESFLINLFNLQKEKGIDIITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSGKEISGANIEDSPNGLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLPSKSKDQRKFENLSEYEHKIISCVPDPLGDEEVVELSDNMLQFLISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIELNCQTEKQVLKTYSISKSPSLTSKATQPLMELEKKQIAIVRFLVESALSYYIEKNDVWCELFKKLKLNTEYDLKNMIASPNYLLETHTVVTSNLENNFSSNQHSSGTVKHTYKLTGKEFLIYLEELIFSYEQVGAFTINLRLFNRPLSFYLVNIYLQEACALLDSMRSKEPGSNTSPSMSREQNQFQQLVSLQIIEAFLLTVKESYDVIIGEIVRNLKMRSHHKDGDCRNTYIVVIMKLLNDLITRLPVSVSKKLVILMYKYRLPNDLCRLLSVVDCSVAQHKSVLVDILTVVDSLCRPERQMYINKRQRSSKSXXXXXXXXXXXXXXXADTQATSVIAGTSAATNEITAQEMETDDVFYVDINAWSRNSRSENTDTAAVDNMENLEASNADEHPXXXXXXXXXXXXXXXXXXXXSEFRDIDAEYDFDEPQMYDDDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXRFDEDIRETENSSHSNGRQEQSRRIFQILNHNYYNISQEGENTETPRHDTETSLRDRLSNVQMMSTYDHHPNYVLNESFSLDAPPSQDDTSTFRLADNLYFVTNSREYDISSQPSNYYPNDLAGCSNTPSNNLLRTTNLESSAVSQNPQVPTGSQEDSINGRGWRGLTYAPGARYMRLEARTLRQNTIRNILTLNRGSFMDRAPNTRSPSNRFVXXXXXXXXXXXXFEMQEILARALSNIPSGWNFLINPTASAPQNTINNFTFNDISMITNFRRWIVEARTLYGREITDLVMLARARVYQSVYHSVSSKLTEASVDEKEVVDSKTNMVKTANSNPDNVDNERNSITDQTDIGRDVSMEQDLMMQPDIMIESLDEPNESVIGEEMVTPTPSETMESRDEPIDNIEIEQPNEVISRVDQSLXXXXXXXXXXXXXNDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKISLPKENTDSKPKIFXXXXXXXXXILCTPIGSGSCTDMSRSSSIQDDTFRQYPNNKSLFFHSFERGFALTDQVFVPSISKIYKHKNKSGIQSLEMPEITIHESVSGSVAKALIDSLSSISTMHTKEFFPTSQSKKVPTNFWFTLAWYMSLKSVSLEDQCPETHLPPNEEYDYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKSFSMKEKPVAAEWSIATNDGDNHESSTPTASTGNETPLSITKEKSETKAVNVSDPHLNRVNVKTISHLVNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMIXXXXXXXXXXXXPSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHXXXXXXXXXXRKVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGMI 12209
            MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNST   +QGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDTATTNHSHPSTPTSYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMPLQENVDSQEIASTAGPS VY SDSNQAADLLAVMTAVEEADREVEQIMEMSGDEDDGVADNEMTQAIDAEEDRTPSDGCGKDNKTEEMNQFSCDDDAVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQLYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLRQDILAELKSGIIDYARLLPLLNWEAMVLMNLLFEDEEACLEDLKRLCINERGTCADNEHNEERCFLTKKSSLSTCQQLFSDNPRSEKIIKRMLQITQKAANDMVELLVTLTKFCCVKPDYSYVVRVRYNRVNGSIPTGKNKMALLNKIAEHCKSLLERESPYTLQAGQDSWPEDPHSELPVEKACQKILSDIKFLHPMKYFCFTTIHRILTGGDLNKKPFLGFFYAFQMNNGLEVFFECANELLDTIRYIQYLDPNANSSVKIMLESFLITVDRMTQIRRITQEFVDSTDKELRDKFDIDLYQRMIRAYMLEPISKLFSFSSLDIDLLNNQSQESLMNIIAFLTSYIFDRDTKKSESEETPEEPIVFNDDHEQLINQHISFIMELGFSRENARRALERNDYDPTQAVSSLFNSDLGIRTAESSSSTNEPETSSKSVRPNPLNENSREISTIEARLKELEMKNVSIKEMIKESFLINLFNLQKEKGIDIITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSGKEISGANIEDSPNGLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLPSKSKDQRKFENLSEYEHKIISCVPDPLGDEEVVELSDNMLQFLISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIELNCQTEKQVLKTYSISKSPS TSKATQPLMELEKKQIAIVRFLVESALSYYIEKNDVWCELFKKLKLNTEYDLKNMIASPNYLLETHTVVTSNLENNFSSNQHSSGTVKHTYKLTGKEFLIYLEELIFSYEQVGAFTINLRLFNRPLSFYLVNIYLQEACALLDSMRSKEPGSNTSPSMSREQ QFQQLVSLQIIEAFLLTVKESYDVIIGEIVRNLKMRSHHKDGDCRNTYIVVIMKLLNDLITRLPVSVSKKLVILMYKYRLPNDLCRLLSVVDCSVAQHKSVLVDILTVVDSLCRPERQMYINKRQRSSKSNLEL+NKRQRRLNNNADTQATSVIAGTSAATNEITAQEMETDDVFYVDINAWSRNSRSENTDT AVDNMENLEASNADEHPVDVDDDEEMDEYDEVDGVMMSEFRDIDAEYDFDEPQMYDDDNNTESETDYEEIEEDEGSAGSQDGDSQGDRFDEDIRETENSSHSNGRQEQSRRIFQILNHNYYNISQEGENTETPRHDTETSLRDRLSNVQMMSTYDHHP+YVLNESFSLDAPPSQDDTSTFRLADNLYFVTNSREYDISSQPSNYYPNDLAGCSNTPSNNLLRTTNLESSAVSQNPQVPTGSQEDSINGRGWRGLTYAPGARYMRLEARTLRQNTIRNILTLNRGSFMDRAPNTRSPSNRFVDADLSLDSLEADFEMQEILARALSNIPSGWNFLINPTASAPQNTINNFTFNDISMITNFRRWIVEARTLYGREITDLVMLARARVYQSVYHSVSSKLTEASVDEKEVVDSKTNMVKTANSNPDNVDNERNSI DQTDIGRDVSMEQDLMMQPDIMIESLDEPNESVIGEEMVTPTPSETMESRDEPIDNIEIEQPNEVISRVDQSLGAVGGAT AAARANDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKISLPKENTDSKPKIFSSPSTSESSILCTPIGSGSCTDMSRSSSIQDDTFRQYPNNKSLFFHSFERGFALTDQVFVPSISKIYKHKNKSGIQSLEMPEITIHESVSGSVAKALIDSLSSISTMHTKEFFPTSQSKKVPTNFWFTLAWYMSLKSVSLEDQCPETHLPPNEEYDYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKSFSMKEKP AAEWSIATNDGDNHESSTPTASTGNETPLSI+KEKSETKAVNVSDPHLNRVNVKTISHLVNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMILENECNETCLNEPSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHLNLLDLFNLLRKVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGMI
Sbjct:    1 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTSTSDQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDTATTNHSHPSTPTSYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMPLQENVDSQEIASTAGPSAVYPSDSNQAADLLAVMTAVEEADREVEQIMEMSGDEDDGVADNEMTQAIDAEEDRTPSDGCGKDNKTEEMNQFSCDDDAVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQLYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLRQDILAELKSGIIDYARLLPLLNWEAMVLMNLLFEDEEACLEDLKRLCINERGTCADNEHNEERCFLTKKSSLSTCQQLFSDNPRSEKIIKRMLQITQKAANDMVELLVTLTKFCCVKPDYSYVVRVRYNRVNGSIPTGKNKMALLNKIAEHCKSLLERESPYTLQAGQDSWPEDPHSELPVEKACQKILSDIKFLHPMKYFCFTTIHRILTGGDLNKKPFLGFFYAFQMNNGLEVFFECANELLDTIRYIQYLDPNANSSVKIMLESFLITVDRMTQIRRITQEFVDSTDKELRDKFDIDLYQRMIRAYMLEPISKLFSFSSLDIDLLNNQSQESLMNIIAFLTSYIFDRDTKKSESEETPEEPIVFNDDHEQLINQHISFIMELGFSRENARRALERNDYDPTQAVSSLFNSDLGIRTAESSSSTNEPETSSKSVRPNPLNENSREISTIEARLKELEMKNVSIKEMIKESFLINLFNLQKEKGIDIITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSGKEISGANIEDSPNGLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLPSKSKDQRKFENLSEYEHKIISCVPDPLGDEEVVELSDNMLQFLISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIELNCQTEKQVLKTYSISKSPSPTSKATQPLMELEKKQIAIVRFLVESALSYYIEKNDVWCELFKKLKLNTEYDLKNMIASPNYLLETHTVVTSNLENNFSSNQHSSGTVKHTYKLTGKEFLIYLEELIFSYEQVGAFTINLRLFNRPLSFYLVNIYLQEACALLDSMRSKEPGSNTSPSMSREQIQFQQLVSLQIIEAFLLTVKESYDVIIGEIVRNLKMRSHHKDGDCRNTYIVVIMKLLNDLITRLPVSVSKKLVILMYKYRLPNDLCRLLSVVDCSVAQHKSVLVDILTVVDSLCRPERQMYINKRQRSSKSNLELINKRQRRLNNNADTQATSVIAGTSAATNEITAQEMETDDVFYVDINAWSRNSRSENTDTVAVDNMENLEASNADEHPVDVDDDEEMDEYDEVDGVMMSEFRDIDAEYDFDEPQMYDDDNNTESETDYEEIEEDEGSAGSQDGDSQGDRFDEDIRETENSSHSNGRQEQSRRIFQILNHNYYNISQEGENTETPRHDTETSLRDRLSNVQMMSTYDHHPSYVLNESFSLDAPPSQDDTSTFRLADNLYFVTNSREYDISSQPSNYYPNDLAGCSNTPSNNLLRTTNLESSAVSQNPQVPTGSQEDSINGRGWRGLTYAPGARYMRLEARTLRQNTIRNILTLNRGSFMDRAPNTRSPSNRFVDADLSLDSLEADFEMQEILARALSNIPSGWNFLINPTASAPQNTINNFTFNDISMITNFRRWIVEARTLYGREITDLVMLARARVYQSVYHSVSSKLTEASVDEKEVVDSKTNMVKTANSNPDNVDNERNSINDQTDIGRDVSMEQDLMMQPDIMIESLDEPNESVIGEEMVTPTPSETMESRDEPIDNIEIEQPNEVISRVDQSLGAVGGATAAAARANDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKISLPKENTDSKPKIFSSPSTSESSILCTPIGSGSCTDMSRSSSIQDDTFRQYPNNKSLFFHSFERGFALTDQVFVPSISKIYKHKNKSGIQSLEMPEITIHESVSGSVAKALIDSLSSISTMHTKEFFPTSQSKKVPTNFWFTLAWYMSLKSVSLEDQCPETHLPPNEEYDYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKSFSMKEKPAAAEWSIATNDGDNHESSTPTASTGNETPLSISKEKSETKAVNVSDPHLNRVNVKTISHLVNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMILENECNETCLNEPSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHLNLLDLFNLLRKVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGMI 4066          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Planmine SMEST
Match: SMESG000059703.1 (SMESG000059703.1)

HSP 1 Score: 7937.79 bits (20595), Expect = 0.000e+0
Identity = 4051/4068 (99.58%), Postives = 4055/4068 (99.68%), Query Frame = 3
Query:   21 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNST---NQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDXXXXXXXXXXXXXXYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMPLQENVDSQEIASTAGPSGVYSSDSNQAADLLAVMTAVEEADREVEQIMEMSGDEDDGVADNEMTQAIDAEEDRTPSDGCGKDNKTEEMNQFSCDDDAVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQLYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLRQDILAELKSGIIDYARLLPLLNWEAMVLMNLLFEDEEACLEDLKRLCINERGTCADNEHNEERCFLTKKSSLSTCQQLFSDNPRSEKIIKRMLQITQKAANDMVELLVTLTKFCCVKPDYSXXXXXXXXXXXGSIPTGKNKMALLNKIAEHCKSLLERESPYTLQAGQDSWPEDPHSELPVEKACQKILSDIKFLHPMKYFCFTTIHRILTGGDLNKKPFLGFFYAFQMNNGLEVFFECANELLDTIRYIQYLDPNANS--SVKIMLESFLITVDRMTQIRRITQEFVDSTDKELRDKFDIDLYQRMIRAYMLEPXXXXXXXXXXXXXXXNNQSQESLMNIIAFLTSYIFDRDXXXXXXXXXXXXXIVFNDDHEQLINQHISFIMELGFSRENARRALERNDYDPTQAVSSLFNSDLGIRXXXXXXXXXXXXXXXXXVRPNPLNENSREISTIEARLKELEMKNVSIKEMIKESFLINLFNLQKEKGIDIITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSGKEISGANIEDSPNGLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLPSKSKDQRKFENLSEYEHKIISCVPDPLGDEEVVELSDNMLQFLISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIELNCQTEKQVLKTYSISKSPSLTSKATQPLMELEKKQIAIVRFLVESALSYYIEKNDVWCELFKKLKLNTEYDLKNMIASPNYLLETHTVVTSNLENNFSSNQHSSGTVKHTYKLTGKEFLIYLEELIFSYEQVGAFTINLRLFNRPLSFYLVNIYLQEACALLDSMRSKEPGSNTSPSMSREQNQFQQLVSLQIIEAFLLTVKESYDVIIGEIVRNLKMRSHHKDGDCRNTYIVVIMKLLNDLITRLPVSVSKKLVILMYKYRLPNDLCRLLSVVDCSVAQHKSVLVDILTVVDSLCRPERQMYINKRQRSSKSXXXXXXXXXXXXXXXADTQATSVIAGTSAATNEITAQEMETDDVFYVDINAWSRNSRSENTDTAAVDNMENLEASNADEHPXXXXXXXXXXXXXXXXXXXXSEFRDIDAEYDFDEPQMYDDDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXRFDEDIRETENSSHSNGRQEQSRRIFQILNHNYYNISQEGENTETPRHDTETSLRDRLSNVQMMSTYDHHPNYVLNESFSLDAPPSQDDTSTFRLADNLYFVTNSREYDISSQPSNYYPNDLAGCSNTPSNNLLRTTNLESSAVSQNPQVPTGSQEDSINGRGWRGLTYAPGARYMRLEARTLRQNTIRNILTLNRGSFMDRAPNTRSPSNRFVXXXXXXXXXXXXFEMQEILARALSNIPSGWNFLINPTASAPQNTINNFTFNDISMITNFRRWIVEARTLYGREITDLVMLARARVYQSVYHSVSSKLTEASVDEKEVVDSKTNMVKTANSNPDNVDNERNSITDQTDIGRDVSMEQDLMMQPDIMIESLDEPNESVIGEEMVTPTPSETMESRDEPIDNIEIEQPNEVISRVDQSLXXXXXXXXXXXXXNDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKISLPKENTDSKPKIFXXXXXXXXXILCTPIGSGSCTDMSRSSSIQDDTFRQYPNNKSLFFHSFERGFALTDQVFVPSISKIYKHKNKSGIQSLEMPEITIHESVSGSVAKALIDSLSSISTMHTKEFFPTSQSKKVPTNFWFTLAWYMSLKSVSLEDQCPETHLPPNEEYDYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKSFSMKEKPVAAEWSIATNDGDNHESSTPTASTGNETPLSITKEKSETKAVNVSDPHLNRVNVKTISHLVNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMIXXXXXXXXXXXXPSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHXXXXXXXXXXRKVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGMI 12209
            MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNST   +QGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDTATTNHSHPSTPTSYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMPLQENVDSQEIASTAGPS VY SDSNQAADLLAVMTAVEEADREVEQIMEMSGDEDDGVADNEMTQAIDAEEDRTPSDGCGKDNKTEEMNQFSCDDDAVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQLYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLRQDILAELKSGIIDYARLLPLLNWEAMVLMNLLFEDEEACLEDLKRLCINERGTCADNEHNEERCFLTKKSSLSTCQQLFSDNPRSEKIIKRMLQITQKAANDMVELLVTLTKFCCVKPDYSYVVRVRYNRVNGSIPTGKNKMALLNKIAEHCKSLLERESPYTLQAGQDSWPEDPHSELPVEKACQKILSDIKFLHPMKYFCFTTIHRILTGGDLNKKPFLGFFYAFQMNNGLEVFFECANELLDTIRYIQYLDPNANS  SVKIMLESFLITVDRMTQIRRITQEFVDSTDKELRDKFDIDLYQRMIRAYMLEPISKLFSFSSLDIDLLNNQSQESLMNIIAFLTSYIFDRDTKKSESEETPEEPIVFNDDHEQLINQHISFIMELGFSRENARRALERNDYDPTQAVSSLFNSDLGIRTAESSSSTNEPETSSKSVRPNPLNENSREISTIEARLKELEMKNVSIKEMIKESFLINLFNLQKEKGIDIITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSGKEISGANIEDSPNGLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLPSKSKDQRKFENLSEYEHKIISCVPDPLGDEEVVELSDNMLQFLISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIELNCQTEKQVLKTYSISKSPS TSKATQPLMELEKKQIAIVRFLVESALSYYIEKNDVWCELFKKLKLNTEYDLKNMIASPNYLLETHTVVTSNLENNFSSNQHSSGTVKHTYKLTGKEFLIYLEELIFSYEQVGAFTINLRLFNRPLSFYLVNIYLQEACALLDSMRSKEPGSNTSPSMSREQ QFQQLVSLQIIEAFLLTVKESYDVIIGEIVRNLKMRSHHKDGDCRNTYIVVIMKLLNDLITRLPVSVSKKLVILMYKYRLPNDLCRLLSVVDCSVAQHKSVLVDILTVVDSLCRPERQMYINKRQRSSKSNLEL+NKRQRRLNNNADTQATSVIAGTSAATNEITAQEMETDDVFYVDINAWSRNSRSENTDT AVDNMENLEASNADEHPVDVDDDEEMDEYDEVDGVMMSEFRDIDAEYDFDEPQMYDDDNNTESETDYEEIEEDEGSAGSQDGDSQGDRFDEDIRETENSSHSNGRQEQSRRIFQILNHNYYNISQEGENTETPRHDTETSLRDRLSNVQMMSTYDHHP+YVLNESFSLDAPPSQDDTSTFRLADNLYFVTNSREYDISSQPSNYYPNDLAGCSNTPSNNLLRTTNLESSAVSQNPQVPTGSQEDSINGRGWRGLTYAPGARYMRLEARTLRQNTIRNILTLNRGSFMDRAPNTRSPSNRFVDADLSLDSLEADFEMQEILARALSNIPSGWNFLINPTASAPQNTINNFTFNDISMITNFRRWIVEARTLYGREITDLVMLARARVYQSVYHSVSSKLTEASVDEKEVVDSKTNMVKTANSNPDNVDNERNSI DQTDIGRDVSMEQDLMMQPDIMIESLDEPNESVIGEEMVTPTPSETMESRDEPIDNIEIEQPNEVISRVDQSLGAVGGAT AAARANDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKISLPKENTDSKPKIFSSPSTSESSILCTPIGSGSCTDMSRSSSIQDDTFRQYPNNKSLFFHSFERGFALTDQVFVPSISKIYKHKNKSGIQSLEMPEITIHESVSGSVAKALIDSLSSISTMHTKEFFPTSQSKKVPTNFWFTLAWYMSLKSVSLEDQCPETHLPPNEEYDYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKSFSMKEKP AAEWSIATNDGDNHESSTPTASTGNETPLSI+KEKSETKAVNVSDPHLNRVNVKTISHLVNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMILENECNETCLNEPSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHLNLLDLFNLLRKVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGMI
Sbjct:    1 MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCELGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGHLIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLDSTNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQDVSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLIQKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEVEDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPVLKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLYHLACTNEVNSTSTSDQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTDQILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQMTKKSVALNTQRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFNPQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFLVTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREMMTPSENSDTATTNHSHPSTPTSYQMSNAMNELARANAVVFKPIIYESISKAFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMPLQENVDSQEIASTAGPSAVYPSDSNQAADLLAVMTAVEEADREVEQIMEMSGDEDDGVADNEMTQAIDAEEDRTPSDGCGKDNKTEEMNQFSCDDDAVYLMDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDFPSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQLYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVIYDKITDRLSNNLRQDILAELKSGIIDYARLLPLLNWEAMVLMNLLFEDEEACLEDLKRLCINERGTCADNEHNEERCFLTKKSSLSTCQQLFSDNPRSEKIIKRMLQITQKAANDMVELLVTLTKFCCVKPDYSYVVRVRYNRVNGSIPTGKNKMALLNKIAEHCKSLLERESPYTLQAGQDSWPEDPHSELPVEKACQKILSDIKFLHPMKYFCFTTIHRILTGGDLNKKPFLGFFYAFQMNNGLEVFFECANELLDTIRYIQYLDPNANSERSVKIMLESFLITVDRMTQIRRITQEFVDSTDKELRDKFDIDLYQRMIRAYMLEPISKLFSFSSLDIDLLNNQSQESLMNIIAFLTSYIFDRDTKKSESEETPEEPIVFNDDHEQLINQHISFIMELGFSRENARRALERNDYDPTQAVSSLFNSDLGIRTAESSSSTNEPETSSKSVRPNPLNENSREISTIEARLKELEMKNVSIKEMIKESFLINLFNLQKEKGIDIITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSGKEISGANIEDSPNGLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLFKSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVIYEYQGCPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNFVSLTQKNEESQTERPIMLLPSKSKDQRKFENLSEYEHKIISCVPDPLGDEEVVELSDNMLQFLISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLAAYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDKNVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIELNCQTEKQVLKTYSISKSPSPTSKATQPLMELEKKQIAIVRFLVESALSYYIEKNDVWCELFKKLKLNTEYDLKNMIASPNYLLETHTVVTSNLENNFSSNQHSSGTVKHTYKLTGKEFLIYLEELIFSYEQVGAFTINLRLFNRPLSFYLVNIYLQEACALLDSMRSKEPGSNTSPSMSREQIQFQQLVSLQIIEAFLLTVKESYDVIIGEIVRNLKMRSHHKDGDCRNTYIVVIMKLLNDLITRLPVSVSKKLVILMYKYRLPNDLCRLLSVVDCSVAQHKSVLVDILTVVDSLCRPERQMYINKRQRSSKSNLELINKRQRRLNNNADTQATSVIAGTSAATNEITAQEMETDDVFYVDINAWSRNSRSENTDTVAVDNMENLEASNADEHPVDVDDDEEMDEYDEVDGVMMSEFRDIDAEYDFDEPQMYDDDNNTESETDYEEIEEDEGSAGSQDGDSQGDRFDEDIRETENSSHSNGRQEQSRRIFQILNHNYYNISQEGENTETPRHDTETSLRDRLSNVQMMSTYDHHPSYVLNESFSLDAPPSQDDTSTFRLADNLYFVTNSREYDISSQPSNYYPNDLAGCSNTPSNNLLRTTNLESSAVSQNPQVPTGSQEDSINGRGWRGLTYAPGARYMRLEARTLRQNTIRNILTLNRGSFMDRAPNTRSPSNRFVDADLSLDSLEADFEMQEILARALSNIPSGWNFLINPTASAPQNTINNFTFNDISMITNFRRWIVEARTLYGREITDLVMLARARVYQSVYHSVSSKLTEASVDEKEVVDSKTNMVKTANSNPDNVDNERNSINDQTDIGRDVSMEQDLMMQPDIMIESLDEPNESVIGEEMVTPTPSETMESRDEPIDNIEIEQPNEVISRVDQSLGAVGGATAAAARANDEDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQLPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPLISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQETGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVVFSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITSSTSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKISLPKENTDSKPKIFSSPSTSESSILCTPIGSGSCTDMSRSSSIQDDTFRQYPNNKSLFFHSFERGFALTDQVFVPSISKIYKHKNKSGIQSLEMPEITIHESVSGSVAKALIDSLSSISTMHTKEFFPTSQSKKVPTNFWFTLAWYMSLKSVSLEDQCPETHLPPNEEYDYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKSFSMKEKPAAAEWSIATNDGDNHESSTPTASTGNETPLSISKEKSETKAVNVSDPHLNRVNVKTISHLVNIICAKECSSQTPLPTDKCRMFSERLLIELSKGNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMILENECNETCLNEPSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSSGYSRNNSLPHIAFNQLKMESIKPFTANTGDHLNLLDLFNLLRKVDNSILTQFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHEEHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHNPFLEFVEKHKKVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDGDSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYGMI 4068          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Planmine SMEST
Match: SMESG000038772.1 (SMESG000038772.1)

HSP 1 Score: 304.679 bits (779), Expect = 1.194e-87
Identity = 153/378 (40.48%), Postives = 241/378 (63.76%), Query Frame = 3
Query: 11079 RYFQAKVAQLRNDGDSRYEEELVQVS--RARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPD-GVTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            R F+ ++   +++  S      V+++  R  L + S+ ++   +  E KQR  I+F+ EEG D GG+ +EW+L++SHEI NP Y LF+ +     +  INP S+VN NHLSYFKF+GRFI  A F  + +   FT  FYK IL   +   D+E  D +F++ L F+ +N ++   L+  FS      G+ +  +LIP G+++ VT+ENK EY++L+    +T  + +Q+ +FLEG YE++P +L+  F+E+ELELL+CGL +ID++D + +TVY +Y+P++ Q+ WFW+ + S D E +AR +QFVTGT ++PLGGFS+L+G NG   F +      T  LP +HTCFN +DLP Y+ +++  + L  A  E +EG+G
Sbjct:  330 RSFRYRLEAFQDECKSMMPTGTVKINFKRDDLLDSSFNQIINLSTTELKQRLSIQFLGEEGLDYGGVAKEWFLRLSHEILNPMYCLFEYANTYNYSLKINPGSFVNPNHLSYFKFIGRFIGMAFFHGRCIDNGFTIPFYKQILNKPLTLQDIESIDLEFYQSLLFIKENPINDCDLELYFSASYEVLGEVKLHELIPGGNEVKVTDENKKEYIQLMIPWWLTKGVEKQMKNFLEGLYELVPLSLLQRFDERELELLLCGLQKIDVDDWERHTVYRQYSPSNIQVIWFWKFVRSLDHEQQARLLQFVTGTCRLPLGGFSELQGGNGRQLFCLERVGDET-WLPRSHTCFNRLDLPPYKTYEQFIEKLTLAFEE-TEGFG 705          
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Planmine SMEST
Match: SMESG000008708.1 (SMESG000008708.1)

HSP 1 Score: 300.827 bits (769), Expect = 5.819e-86
Identity = 142/352 (40.34%), Postives = 227/352 (64.49%), Query Frame = 3
Query: 11151 VSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGGLLREWYLKMSHEIFNPNYALFKVSPDG-VTYTINPASYVNNNHLSYFKFVGRFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLLKNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVCQEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLNDLKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGFSKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLLTAIRECSEGYG 12203
            V R  L EDS+  + R   ++ ++R  I+F +E+G D GG+ REW+ ++SHE+ NP Y LF+ + D   +  INPAS++N  HL YF+FVGRF+A A+F  K +   FT  FYK +LG  I   D+E  D +++  L+F+  N++    +   FS +   FG+ E ++L  NG  I VTEENK+EY+ L+   + +  + +Q  +F++GF EI+P + + +++E+++ELL+CG+ +ID+ D + N++Y  YT  SPQI+WFW+ +     +++ R +QFVTGT ++P+GGF +L G NGP KF I      +  LP +HTCFN +DLP Y ++++L + L  A+ E +EG+G
Sbjct:  394 VRRNMLMEDSFNEIMRVKPKDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVPLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKES-WLPRSHTCFNRLDLPPYASYEQLKEKLTYAVME-TEGFG 743          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HUWE12.963e-17755.83HECT, UBA and WWE domain containing E3 ubiquitin p... [more]
HUWE14.863e-16955.83HECT, UBA and WWE domain containing E3 ubiquitin p... [more]
HUWE14.863e-16955.83HECT, UBA and WWE domain containing E3 ubiquitin p... [more]
HUWE15.981e-16955.83HECT, UBA and WWE domain containing E3 ubiquitin p... [more]
ITCH4.238e-9640.67itchy E3 ubiquitin protein ligase [Source:HGNC Sym... [more]
back to top
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eel-11.260e-15151.06Enhancer of EfL-1 mutant phenotype [Source:UniPro... [more]
eel-11.262e-15151.06Enhancer of EfL-1 mutant phenotype [Source:UniPro... [more]
eel-11.282e-15151.06Enhancer of EfL-1 mutant phenotype [Source:UniPro... [more]
eel-11.302e-15151.06Enhancer of EfL-1 mutant phenotype [Source:UniPro... [more]
eel-11.732e-15150.97Enhancer of EfL-1 mutant phenotype [Source:UniPro... [more]
back to top
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HUWE18.847e-16351.75gene:FBgn0030674 transcript:FBtr0339689[more]
HUWE19.487e-16351.75gene:FBgn0030674 transcript:FBtr0339690[more]
HUWE11.010e-16251.75gene:FBgn0030674 transcript:FBtr0339688[more]
HUWE11.088e-16251.75gene:FBgn0030674 transcript:FBtr0340304[more]
HUWE11.134e-16251.75gene:FBgn0030674 transcript:FBtr0339686[more]
back to top
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
huwe14.540e-15255.58HECT, UBA and WWE domain containing E3 ubiquitin p... [more]
BX664745.22.420e-10233.05HECT, UBA and WWE domain containing E3 ubiquitin p... [more]
huwe12.435e-10233.05HECT, UBA and WWE domain containing E3 ubiquitin p... [more]
hace18.393e-9439.43HECT domain and ankyrin repeat containing E3 ubiqu... [more]
smurf21.163e-9246.55SMAD specific E3 ubiquitin protein ligase 2 [Sourc... [more]
back to top
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itch4.331e-9741.87itchy E3 ubiquitin protein ligase [Source:NCBI gen... [more]
itch1.295e-9641.87itchy E3 ubiquitin protein ligase [Source:NCBI gen... [more]
itch1.296e-9641.87itchy E3 ubiquitin protein ligase [Source:NCBI gen... [more]
crybb24.558e-9646.00crystallin beta B2 [Source:Xenbase;Acc:XB-GENE-586... [more]
crybb29.395e-9346.00crystallin beta B2 [Source:Xenbase;Acc:XB-GENE-586... [more]
back to top
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Huwe18.326e-16756.51HECT, UBA and WWE domain containing 1 [Source:MGI ... [more]
Huwe18.681e-16756.51HECT, UBA and WWE domain containing 1 [Source:MGI ... [more]
Itch3.919e-9640.91itchy, E3 ubiquitin protein ligase [Source:MGI Sym... [more]
Itch3.919e-9640.91itchy, E3 ubiquitin protein ligase [Source:MGI Sym... [more]
Nedd4l1.427e-9445.10neural precursor cell expressed, developmentally d... [more]
back to top
BLAST of E3 ubiquitin protein ligase HUWE1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7Z6Z7|HUWE1_HUMAN2.336e-16855.83E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens ... [more]
sp|Q7TMY8|HUWE1_MOUSE6.072e-16656.51E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus ... [more]
sp|P51593|HUWE1_RAT1.224e-15069.78E3 ubiquitin-protein ligase HUWE1 (Fragment) OS=Ra... [more]
sp|Q8GY23|UPL1_ARATH1.417e-11448.83E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis th... [more]
sp|Q8H0T4|UPL2_ARATH1.518e-11448.83E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis th... [more]
back to top
BLAST of E3 ubiquitin protein ligase HUWE1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183SSY58.429e-1536.13Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A4Z2CZ755.310e-8240.07E3 ubiquitin-protein ligase HUWE1 (Fragment) OS=Sc... [more]
A0A4S2M6558.722e-4539.20Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M6H59.251e-4539.20Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0X3PN075.111e-3834.65Uncharacterized protein (Fragment) OS=Schistocepha... [more]
back to top
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
huwe16.320e-10332.29HECT, UBA and WWE domain containing E3 ubiquitin p... [more]
hace14.275e-9539.65HECT domain and ankyrin repeat containing E3 ubiqu... [more]
hace11.290e-9439.65HECT domain and ankyrin repeat containing E3 ubiqu... [more]
itchb1.696e-9441.67E3 ubiquitin-protein ligase Itchy [Source:NCBI gen... [more]
itchb5.663e-9441.67E3 ubiquitin-protein ligase Itchy [Source:NCBI gen... [more]
back to top
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nedd4a2.851e-9345.50NEDD4 E3 ubiquitin protein ligase a [Source:ZFIN;A... [more]
wwp29.150e-7843.23WW domain containing E3 ubiquitin protein ligase 2... [more]
smurf23.560e-6939.11SMAD specific E3 ubiquitin protein ligase 2 [Sourc... [more]
AREL15.371e-5934.58apoptosis resistant E3 ubiquitin protein ligase 1 ... [more]
ENSPMAT00000005015.12.732e-4647.59pep scaffold:Pmarinus_7.0:GL486731:734:6293:1 gene... [more]
back to top
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TOM16.634e-10440.20E3 ubiquitin ligase of the hect-domain class; has ... [more]
RSP56.100e-9040.82NEDD4 family E3 ubiquitin ligase; regulates proces... [more]
HUL57.048e-3932.77Multiubiquitin chain assembly factor (E4); proteas... [more]
HUL42.519e-3330.75Protein with similarity to hect domain E3 ubiquiti... [more]
UFD42.268e-2026.05Ubiquitin-protein ligase (E3); interacts with Rpt4... [more]
back to top
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO344734.265e-10447.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493272.877e-9342.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460711.398e-8544.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493289.586e-8040.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493831.751e-7541.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
huwe13.296e-16856.32HECT, UBA and WWE domain containing E3 ubiquitin p... [more]
smurf23.882e-9246.55E3 ubiquitin-protein ligase SMURF2 [Source:NCBI ge... [more]
smurf17.155e-9245.11SMAD specific E3 ubiquitin protein ligase 1 [Sourc... [more]
itcha7.862e-9241.08E3 ubiquitin-protein ligase Itchy [Source:NCBI gen... [more]
smurf19.820e-9245.11SMAD specific E3 ubiquitin protein ligase 1 [Sourc... [more]
back to top
BLAST of E3 ubiquitin protein ligase HUWE1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059703.10.000e+099.68SMESG000059703.1[more]
SMESG000059703.10.000e+099.63SMESG000059703.1[more]
SMESG000059703.10.000e+099.58SMESG000059703.1[more]
SMESG000038772.11.194e-8740.48SMESG000038772.1[more]
SMESG000008708.15.819e-8640.34SMESG000008708.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006629 ID=SMED30006629|Name=E3 ubiquitin protein ligase HUWE1|organism=Schmidtea mediterranea sexual|type=transcript|length=12667bp
CTATATAAATCTTATATGAAATGAAAATAGATAGAAAAAAAATTTTCAAT
CGTTGCGGTTTTGATCAACGTGAATGCTATGACCTAGCTGTCAGATTAGC
GGCATTGGGTGAAAATGACCTTATTAATGAAATTAAAAAAATCAATGTTT
GGCATTATGGAAAATGCGAGTTAGGATTATGGGCCGATGTATTAGATAGG
TTGGATAATATTTTAGCAGAAGGCGTGACTAAAGTTGGACACTGGACACT
TAAGCTTGATCAGCCAGGAAATGAACATTTAATTGGAAAGATAATAGCTA
TTTTGGAATTTACTGGCCATCTTATAGAACACAGTATCTACAGATATCTT
TATGGTTCTTGGGAACACATCTTAGCTTTATTTGGCACATCGAACATGGA
CATATTACACGCTCTGTTAGGATTGTTTTACAACTTTAGTAAAAGATCGA
ATTATTTTTCAAGGCTCGATTCAACTAATAGAAAAATAGTTCTTGAACGA
TTAGATTCAATAGCTGAAAATTGGGGTGGTAAACAACATGGATTTGGATT
AGCAGAATGTTGCGTTACTGAATATATGCCATATTCAGCCGGTACAATGC
AATATGAATTCATGCAAGATGTTTCGTCGTTATCCAGTGCAGGCAAAGAA
GATTCCAATCAATCATCCGTAGACGTGTTTATCAAACCGAAATGTCATCG
ACGAAAGTTAACTCTGAGGAATTTGCATTTACAGCCTGAATCACCATCAG
AATTAATGGAAAATTTGATTCAAAAATATAATCTTACAAATACATCAGAC
CAAATGGCGTTATTTGCCCGGTTAAGATTGTGCGTATATTTTGGCAAGCC
CGAACAAAGAAAATTGTTAATTTATACTCGAATGCAAGCCCTGTCAATAT
TATGTTACACGAATGAGGTCGAGGATAAATGTTTATCATGGGACATTGTT
GAGGAATTGGTAGACGTTTTAAAGCTCCCAGATCGGGAATTTCTTGGAAT
TAAGGCTTGCGCATTAAGAACTTTAACAGCAATTATCCATTGTGGAAAAC
TGACCTCCTGCTGGCCAGTGCTTAAAAATATGACCGGAATGAACAGTTAC
CATGGTCATTTCCCAACCATGATGCGAGAGTGGATCACAGATCTCGTGCA
ATCTAAATTCCAGCCATACGCAAGCACAGTTGAACAAATGTACACAACAG
CAATTTTGTCATTTCTCTATCATTTGGCTTGTACAAATGAAGTGAATTCG
ACGAATCAAGGAAATTTGGTTGGTACCGGGTTATTGGACTCAATGAAAGA
AATAATAATGTGGCATACCCATGAACCTGACTATATCAGTTTTGCCACTA
GAGCGGTTCGTGTGACAGACCAGATTCTTTTGTCCTTTCAATTGAACGGT
AGCAGCACGAATCAAAAATCTACAATTGATGCTATTGTTGATCGTTTGAA
ATTTGAAATTAAAATCTGTTTGGATTCTGAAATCGATCAGATGACAAAGA
AAAGTGTTGCACTCAATACACAACGAGTTGGATTTATAAAATCAATGTTG
AATTTAATAAAACGTCTAATTCTCGATAACGAGTGGTCAGAAACTCTGAA
AGCTACAATGGACGGTGAATTGCCAGACATCCTCAGATTGATATTCATGA
ATTACACAACTAAATTCAACCCTCAGCTTTGTTTATTTTCAATGGAAGTC
ATCACTAATTTCGTGTACAACCACCCGTCGAGCATGTCAGCAATGCAGGA
GCGACAACTGACGAAAGATATCTTACGGACTCTCACCGAACAGCCTTTGC
CAGTGAATCGTGATTTCCTCGTAACCCTGCCAACCCTGTTGTCGGCATTA
TCGATCAATATCCGAGGCATCAATGAAATCAAAGAAAGCAAAATAATCGA
TAAATACATCAAAACCCTAACGGACTCCCGATTTGTGACAGCAATGCGCA
ACAAACGCATTCGTGAAATGATGACCCCGTCTGAGAATTCCGATACCGCC
ACAACCAATCACAGCCACCCGTCGACTCCTACATCCTATCAAATGAGTAA
TGCCATGAATGAATTGGCCAGAGCCAATGCGGTCGTATTCAAGCCGATTA
TCTATGAATCGATCTCCAAAGCATTCAAAACTGTCACGAATATCGGCCAG
AAGCAACCGGCACCTCTGCTGGGAAATGGGAAACCCGGATCGATTCAGAA
GGCGCTAAATCATCACCACAACAACGAGCACAGCAATCCGATCACCATTG
ACGACAATGAGATCATGCCGTTGCAGGAGAATGTCGATTCTCAGGAGATC
GCCTCAACTGCCGGTCCATCCGGGGTCTATTCGAGTGATAGCAATCAGGC
AGCAGACCTTCTCGCTGTGATGACCGCTGTGGAAGAGGCCGACCGAGAGG
TGGAACAGATCATGGAAATGTCTGGCGATGAAGATGACGGAGTAGCAGAC
AATGAGATGACTCAAGCTATCGATGCCGAGGAGGACAGAACTCCTAGCGA
TGGCTGTGGAAAGGATAACAAAACCGAGGAAATGAATCAGTTCAGTTGTG
ATGATGACGCAGTCTATCTGATGGATTACATTTGCAACGTGTGTAAGTTT
ATGGAGCGTTTCATGTCTGATCAACAACCAGAACACTCGTTACGACAACA
AATTTACAGCGAAGAAGGCTTAAAAACTATTCTTGACATTCTAACTATTC
CAAGCTTACCATATGACTTTCCGAGTTCTCCAGCATGTCAATCAATGCAA
AAAATATTCGAATATCTTCTAAGCTGGGCTACAGCAAATGATGCCATTTT
AATCTATCAAATGTTCTTTAAAATATCGAAAAAAGTCGGCGACCGCTTGC
AAAAACTCGAACAGCCACAACTTTATTCGATTTTGCTGAAAGATTATGTG
AACAGATCCGAGGAGTTTCAGGATTCTCCAGCTCTTATGGTCGCCACGAA
AACCTATTGGGAAGAAAACGGCGTGTGCCTATTGCACGATCTAGTCATCT
TATCGACCGTTATAGTCATATATGACAAAATCACTGATCGATTGTCAAAT
AATCTAAGACAGGATATTCTTGCGGAGTTGAAGAGTGGAATTATCGATTA
TGCACGCCTGTTGCCGCTTCTTAATTGGGAAGCTATGGTTTTAATGAATC
TCTTATTTGAAGACGAAGAAGCGTGTTTAGAGGATTTGAAGCGATTGTGC
ATTAACGAACGTGGAACATGTGCTGATAATGAACACAATGAGGAACGATG
TTTTCTGACAAAAAAATCATCGTTATCTACATGCCAGCAACTTTTTTCCG
ATAATCCAAGGAGTGAAAAAATTATCAAAAGAATGCTACAAATAACTCAA
AAGGCTGCCAACGATATGGTGGAGCTATTGGTTACATTGACTAAGTTCTG
CTGTGTCAAGCCGGATTATTCATATGTAGTCCGAGTACGCTATAACCGAG
TAAATGGCAGTATTCCTACTGGTAAAAATAAAATGGCGTTACTTAACAAA
ATAGCAGAACATTGCAAGTCATTGCTTGAACGTGAGAGTCCGTACACGTT
GCAAGCTGGTCAGGACTCTTGGCCAGAAGATCCTCACAGTGAGTTACCAG
TTGAAAAAGCTTGTCAAAAAATTCTTTCAGATATCAAATTTCTACACCCA
ATGAAATATTTTTGTTTCACTACAATTCATAGAATATTAACTGGTGGTGA
CCTTAATAAAAAACCTTTTTTGGGATTCTTTTATGCATTTCAGATGAATA
ACGGACTGGAAGTGTTTTTCGAATGTGCAAATGAATTGCTTGATACGATC
AGATATATCCAATATTTGGATCCAAATGCTAATAGCTCTGTGAAAATTAT
GCTGGAGAGTTTTTTGATAACCGTTGACAGAATGACTCAAATCCGCCGGA
TTACACAGGAATTTGTCGATAGTACTGACAAAGAGTTAAGAGATAAATTT
GACATTGATCTCTATCAAAGAATGATTAGAGCTTATATGCTGGAACCGAT
TAGCAAATTATTCTCATTTTCATCTCTTGATATCGACCTATTAAATAATC
AAAGCCAAGAGTCATTGATGAATATTATTGCATTTCTTACTTCGTATATA
TTTGATAGAGATACGAAAAAGTCTGAATCAGAAGAAACTCCAGAGGAACC
CATCGTATTCAATGATGATCATGAACAATTGATAAATCAGCACATTAGCT
TCATAATGGAATTGGGTTTCTCCAGAGAAAATGCTCGAAGAGCTTTAGAG
CGAAACGATTATGATCCAACTCAAGCAGTCAGTTCTTTATTTAACTCCGA
TCTCGGCATACGAACGGCTGAGTCTAGTTCAAGTACAAACGAGCCTGAAA
CAAGTTCGAAATCTGTACGTCCGAATCCATTAAATGAAAACTCACGAGAA
ATATCTACAATAGAAGCGAGATTGAAAGAATTAGAAATGAAGAATGTATC
AATTAAAGAAATGATTAAAGAATCATTTTTAATCAATCTTTTCAATTTGC
AGAAAGAAAAGGGAATAGATATTATCACACGCATCGTCGACATTCTGTTG
TTAACCGGACAAATAAATGAGTTCCTTGAAAAGATCCTCGCGATAAATGG
CTGTAGTTTCTTAACCAGTGACGATATCTATTCAAACATCCTGAGAACTT
TAATCCTCAACCATTCGGGAAAAGAAATATCCGGTGCGAATATCGAAGAT
TCCCCCAACGGACTTCATATATTGACCTTGCTTTATAACAAAATAAGATT
TCAAGTCACTGCAGCCTTCAAAAACCACGATATGGTGACAAGATTGGTGA
AAATGACAAATCTATTATTCAAATCATTCATGGCTGTTCCCCATCAAACA
GAAACCTTCAAAACCAGTGTACTGAAACATATCACTCAATTGTGGTTGAT
TATCGACCAATATGAGCGGACGGCTTTCGCCTTGCGCATTAGGAAAGACG
TGATTTATGAGTATCAAGGCTGTCCGACATGGTTCTGGATAGACGACCGA
CATGGAATATGGCATCCTGTAAGCACCCAACACAATGCAAACATCAATCG
TAGCTACAGAAATGGACAGCTAAAAGCCTATTCCAAACCCAACTCCAATA
ATGAATACGTATTCAATTTCGTTTCACTTACCCAGAAAAATGAAGAAAGC
CAAACTGAACGACCGATAATGTTGCTGCCATCTAAATCAAAAGACCAAAG
GAAATTTGAGAATCTCAGTGAATATGAACACAAAATTATCTCCTGTGTTC
CTGATCCATTGGGTGACGAAGAAGTTGTGGAACTGTCGGATAATATGCTA
CAATTTCTGATAAGTATTAAAAAAATTGACAATGTCTACAAATGGGATTG
CTTGCAGGCAGCGTGCTATCTGCTTATCCGACTTTGTGACAAATATTCAG
TTGCCAGTGAACGGTTAGCGGCATATAAATCCGCCATACCTCGTCTCTGC
ACGATTCCCCATGTGAAAGGTTACACTCAACAATTGGTGACATTTGTAAT
GACACTATTAAGACAGCAATTTGAAACCCCTCAACTGTTGCAACATACCA
TATCCGATATTCTTGATAAAAACGTATCAAAAGGTGCATGTGTTCTACAC
AAAACGACCAGCTACAATGATAAATTATCCAAAGATTTATTCTATTTCAT
TTGGGATAATATTCCGTTATTGGTTCGAGATTTTGAAACGACTATGAATT
TGATGTCAAAGAAAATCGAATTAAACTGCCAGACTGAAAAACAAGTTCTC
AAAACTTATTCCATATCGAAATCTCCATCTCTCACAAGTAAAGCCACTCA
ACCGTTAATGGAATTAGAGAAAAAACAAATAGCTATTGTTAGATTCCTTG
TGGAAAGCGCACTTAGTTATTATATCGAAAAGAACGATGTTTGGTGCGAG
TTATTCAAGAAGCTGAAATTAAATACTGAATATGATTTGAAAAATATGAT
TGCATCCCCAAACTATTTACTTGAGACTCACACAGTCGTTACATCGAATC
TTGAAAACAATTTCAGCTCTAATCAACATTCATCGGGCACCGTAAAACAC
ACTTATAAATTAACTGGAAAAGAATTTCTAATTTATCTCGAAGAATTGAT
TTTCTCCTATGAACAAGTTGGAGCTTTCACGATAAATCTACGCCTATTCA
ATCGACCTCTTTCTTTCTATTTGGTAAATATCTATCTCCAGGAAGCCTGT
GCACTACTGGACTCTATGAGATCCAAAGAACCCGGCTCCAACACGTCTCC
ATCAATGAGTCGAGAACAAAATCAATTCCAGCAACTGGTATCGCTACAGA
TAATTGAGGCTTTTCTTCTAACAGTCAAAGAATCGTATGATGTGATTATC
GGTGAGATTGTGCGAAATCTAAAGATGAGATCACATCACAAAGATGGTGA
CTGCAGAAATACCTATATTGTCGTCATAATGAAGCTATTGAACGATTTGA
TAACACGGTTACCAGTTTCCGTTTCCAAGAAACTAGTGATTTTGATGTAT
AAATATCGCCTGCCAAATGATTTATGTCGGTTACTCAGCGTCGTAGATTG
CAGTGTCGCGCAACACAAATCTGTTTTGGTCGATATTCTCACCGTGGTCG
ATTCACTCTGCCGACCAGAAAGACAAATGTATATCAATAAACGACAGCGG
TCTTCGAAATCGAATTTGGAATTATTAAACAAACGTCAAAGGCGCCTCAA
TAACAATGCTGATACACAGGCGACTTCAGTGATTGCTGGGACTTCTGCAG
CGACCAATGAAATCACTGCCCAAGAAATGGAAACCGACGATGTGTTTTAT
GTGGATATTAATGCGTGGAGTCGTAATTCCCGCTCAGAAAACACCGATAC
AGCGGCGGTCGATAATATGGAGAATCTGGAAGCATCAAACGCAGATGAGC
ACCCGGTCGATGTGGACGATGATGAGGAAATGGATGAATATGATGAGGTA
GATGGAGTAATGATGTCGGAATTCCGAGATATCGATGCGGAATATGATTT
CGATGAACCGCAAATGTATGACGATGACAACAATACGGAAAGCGAAACAG
ATTATGAAGAAATCGAAGAAGATGAAGGCAGTGCTGGAAGTCAAGATGGC
GACAGTCAGGGAGATCGATTTGATGAGGATATACGGGAAACAGAAAACAG
TTCTCATTCCAATGGCAGACAGGAACAATCGCGAAGAATATTCCAAATTC
TCAACCATAACTATTATAATATCAGCCAAGAAGGAGAGAATACCGAAACT
CCAAGACATGACACGGAAACCTCATTGCGTGACAGATTGAGTAATGTGCA
AATGATGTCGACATATGATCACCATCCTAACTATGTGCTGAATGAAAGCT
TTTCTCTCGATGCTCCTCCATCACAAGATGATACTAGCACATTCCGATTG
GCTGACAATTTATATTTCGTCACAAACTCCCGAGAGTATGATATTTCCAG
CCAGCCGTCAAATTACTATCCAAATGATTTGGCTGGGTGCTCAAACACGC
CATCGAACAATCTACTTAGAACCACGAATTTAGAATCCTCAGCCGTTTCA
CAAAATCCACAAGTTCCCACCGGTTCACAGGAAGATTCCATTAACGGAAG
AGGCTGGCGAGGATTGACATATGCCCCGGGAGCTCGATACATGAGACTGG
AAGCCAGGACTTTGCGACAAAATACAATTAGGAATATACTGACATTAAAC
CGTGGCTCCTTTATGGATCGTGCTCCAAACACCAGATCACCTTCGAATCG
ATTTGTCGATGCAGATCTTTCATTGGATTCACTGGAAGCGGATTTTGAAA
TGCAGGAAATCCTCGCTCGAGCACTCAGTAACATTCCTTCCGGTTGGAAT
TTCTTGATCAATCCCACTGCTTCTGCACCTCAAAACACGATAAATAATTT
CACCTTCAATGACATATCTATGATTACCAATTTCCGTAGATGGATAGTTG
AAGCACGCACATTGTATGGCCGGGAAATTACCGATTTAGTTATGCTAGCT
AGAGCTCGTGTATATCAATCTGTATATCATTCGGTATCATCTAAATTGAC
TGAGGCTAGCGTGGATGAGAAAGAAGTTGTGGATTCAAAAACCAATATGG
TGAAAACGGCTAATAGTAATCCAGATAATGTTGATAATGAGAGAAATAGT
ATAACTGATCAAACAGATATCGGACGAGATGTGTCTATGGAACAAGACTT
AATGATGCAACCAGATATAATGATAGAGTCTTTAGATGAACCCAATGAAA
GTGTGATTGGAGAGGAAATGGTAACTCCTACACCTTCTGAAACAATGGAA
TCAAGAGATGAACCGATCGATAATATCGAAATAGAACAGCCGAATGAAGT
AATCTCAAGAGTTGACCAATCACTGGGGGCTGTCGGAGGTGCTACAGTGG
CAGCAGCAAGAGCAAATGATGAGGATATTGATAATTTATCTATGGAGCAG
TTGATTGCTGAAGGAATAGATCCGACATTTTTGGAGGCTTTACCTCAATC
AATGAGAAGAGAAGTTATTATTGAGCACCGGCGAGCAAATCGAGTGAGAC
AACAGCTTACTGGGATTCAATTACCTGAAAATGTTGATGCTGAAATTATG
GCACAATTACCTGCACATATCCAAGAAGAAATACTTGCTCATTATCGACG
TGAAAATTCAACCTCAGAAACTGCTAACGCTCCATCCTTAACTAATCCAG
AATCTGGCAGTTTACCATTGATTTCGTCTTCTACCGGTGTCGTCGATTCG
AGCTTTCTTTTATCATTGGCTCCCAGTCTAAGACGGGAAATTCTTGCTGA
TATGGATCAATCTCAAATCGCTAATCTCAGCAGTGAATTGGCTGATGAAG
CGCGTCAAGTTCGACAGGAAACTGGAGATGCTCAGATGCGTGCATTGCAG
GCCAATCTGTTATCAGTGACCGGAAGAAGGCGTGCAAGGCAATTGACATC
TGGGTTATCGGACTTGTTATCGCAAATGAATAGAGGTCGATGGGATCAAC
GAAACATCCGTTATGTGGTATTTAGTGAACGAGGTCAAACAAACAGACAT
AACAATGCAGCAGTTACTGATCCAGTAACTGAGGCCGGAGAATGGCCTAA
TTTATCCGCTTACAAGCCATTAGTGTCAACTGATGGATTGACCAATCTAA
TTGCTTTGCTTATTACCAGTTCAACCTCTCCAAGCGTTATGAAGATGATA
TCGACACTCGTTAATAAGATTCTACAAAGTCTTACTTGCCATCCACAAAT
TAGAGCTTGGATATCTTGTACAATTGTTAATATCCTTCTTAAAATATCTT
TACCTAAAGAAAATACTGATAGTAAACCAAAGATTTTCTCATCTCCGTCG
ACTAGTGAATCCAGTATTCTCTGTACTCCCATAGGTAGCGGCAGTTGTAC
CGATATGTCTCGTTCTTCGTCGATCCAAGACGACACATTCCGACAATACC
CGAATAACAAATCTCTATTTTTCCATTCATTTGAACGCGGATTTGCATTG
ACTGATCAGGTTTTCGTTCCATCGATATCGAAAATTTATAAGCATAAAAA
TAAATCCGGTATCCAATCGCTTGAAATGCCAGAGATCACAATTCATGAAT
CGGTTTCTGGATCTGTTGCTAAAGCACTTATCGATTCTCTTTCTTCAATC
AGCACGATGCATACGAAAGAATTTTTTCCAACTTCCCAATCTAAGAAGGT
TCCTACGAATTTCTGGTTCACTCTAGCATGGTATATGAGCCTGAAAAGTG
TTAGTCTTGAAGATCAGTGTCCAGAAACACATTTACCGCCAAATGAGGAA
TATGACTATTTCACGCATTTATTGTGTTTGGTAAGGCTACCTTTGATGCA
ATCCAATAATGCAATGCTCGAGAAGCTTCTATCTACGATCCACAATATTC
TTAAAGCGTATTACAAGTCATTTAGTATGAAAGAAAAGCCAGTTGCAGCA
GAATGGTCAATTGCTACAAATGACGGTGACAACCACGAATCTAGTACACC
TACTGCATCGACGGGTAATGAAACCCCATTAAGTATAACGAAAGAGAAAT
CTGAAACAAAAGCTGTCAATGTAAGTGACCCGCATTTGAATCGGGTCAAC
GTGAAGACTATATCTCATTTGGTGAATATAATTTGCGCTAAAGAATGTTC
TAGTCAAACGCCTTTGCCTACAGATAAATGTCGCATGTTTTCTGAGCGAC
TTCTAATTGAATTATCGAAAGGAAATGTCAACACAAAGCAAGATATAATC
CGACTCCTCACCAGTAATATAGAATTGGTATTGGAAACATTAACTGGGGT
TTTGCATAAAGTTCTTGATGAGGCGGTTATGATTCTGGAAAATGAATGCA
ATGAAACTTGTCTCAATGAACCATCTGGTTCTACCGCATCGCCAATTAAA
AAAAGCAATACATTTACCGAGTCGATATCAAGTGACATTCTGACTTCTAA
TTTGTCGCCGTCGTATGAAAATGCCTTTACTAGTGCTAGCTCGCGTCGAA
ACCAAGCACAAGTATCAAGTGGCTATTCTAGAAATAATTCTCTGCCACAT
ATTGCATTTAACCAATTGAAAATGGAATCGATCAAACCGTTTACAGCGAA
TACCGGCGATCATCTTAATTTATTGGATCTTTTTAATTTGTTGAGGAAAG
TCGATAATTCAATTCTTACTCAGTTCCAATCGCCGAGTTCAATATGGCAT
TTACTGAGTCAAGTGCTAGATGCCATTCAAAAATCCAAAGAACCAGATGC
AGTCATTGTTTTTCAAAGTTTAGTTGAATCGTTTCTGCTTTGTCATTCTG
ATTGTAGTGAAATCCATGAAGAACATAATAAATCAGATAATTCCAATGTA
TCAGATCCTCTTTCTCATCTCAACACCAGTCTTGTTGTCGATGACACGTT
CATGAATTCTCCGGCATTTAGTGAAAACGGCAAGCATAATCCTTTTCTGG
AATTTGTTGAAAAACACAAAAAAGTCCTTAACCATATTCTTAGACGCCGA
ACCGCTTGCGCACTTGACCAATCGAATTTTTCAGCTCTCCTTAAATATCC
GAAATTATTAGATTTCGATATCAAACGTCGATATTTCCAGGCTAAAGTAG
CTCAATTACGAAATGACGGTGATAGTCGATATGAAGAAGAGTTAGTGCAA
GTTTCTAGGGCTCGTTTATTTGAAGATAGTTATGGTCGATTACATCGAAA
AACCGCTGAAGAATGGAAGCAGAGGTTCTGTATCAAATTTATAAATGAAG
AAGGTCAAGATGGTGGTGGACTCCTTCGAGAATGGTATTTAAAAATGAGT
CATGAAATATTCAATCCGAATTATGCACTATTTAAAGTTTCTCCAGACGG
CGTTACTTACACCATCAATCCTGCATCATACGTCAATAATAATCATTTGA
GTTACTTTAAGTTCGTTGGAAGATTCATTGCGAAAGCAATTTTCGATAAC
AAACTCTTGACTTGCTATTTCACTCGAGCATTTTATAAGCATATACTCGG
CATTTCAATTCGATATACCGATCTAGAAAAAGAAGATTATCAATTTTTCC
GTGGCCTAGAATTCCTATTAAAAAATGATGTTTCGACAATGTTTCTCGAT
CAAACGTTTTCTATTCAAATATCAGAATTCGGGCAGACAGAAACCAGAGA
TTTAATACCAAATGGATCACAAATACTTGTCACAGAGGAAAATAAATCCG
AATACGTTCGATTGGTTTGTCAAGAGAAAATGACTGGAGCTATTCGCCAA
CAACTGCATAGTTTTCTCGAAGGGTTTTACGAAATCATACCAAAAAATTT
GATATCAATTTTCAATGAAAAAGAACTTGAATTATTGATATGCGGACTGC
CGGAAATTGATCTCAATGACCTGAAGATCAATACAGTGTATAATAAATAT
ACACCAGCGTCACCTCAGATCCAATGGTTTTGGCAAGCTCTTGAATCCTT
TGACCAAGAAGACAGAGCTCGATTTATCCAATTTGTCACCGGTACAAGTA
AAGTTCCACTGGGGGGATTCTCAAAACTCGAAGGTATGAATGGTCCGACA
AAATTCCAAATTAGCCTAGCATCGATGAGTACCAATCACTTACCAGCCGC
TCACACTTGCTTCAATTCAATCGATCTACCCCAATACGAGAATTTCGACA
AACTCCATAAATGTCTGCTGACTGCCATTAGAGAGTGCAGTGAAGGATAC
GGGATGATTTAATGATAATCCAGTCTTTGTGATATATAATATAAGAAATT
AATTAATAGTAATCATATTCTACCAATAATGACTCATGATATTATTTCTC
GGCTATTTTGTGGTGTTTTCAATGATCATAATTATTGCTAAATATTCATT
ATTCTCTAACTGTATTTTCAGAGGGCCTTGATTTCTCAGACTGTTTGTGG
TGTGCCTCGACTAGTTCTAATGCTATTCGTGTTGTTGTATTATATTATTC
AGTTTTCTTTTTCCAGATATTTGAGTGCTGTTATGGTTTTGATTGAGGTT
TCTTTTCCGATATCTGTCATTACTAATATATACATATAAATATACATGCA
TACATATATATGTATTGTTATGTGCAATTTCCGAGTGCTGCATTGTTGTT
GTTGGTGTTATGCTGTAATAGCTGAGTGTTTTGCAAATATAAATTATCTG
AGATTGTTACACCTGGC
back to top

protein sequence of SMED30006629-orf-1

>SMED30006629-orf-1 ID=SMED30006629-orf-1|Name=SMED30006629-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=4064bp
MKIDRKKIFNRCGFDQRECYDLAVRLAALGENDLINEIKKINVWHYGKCE
LGLWADVLDRLDNILAEGVTKVGHWTLKLDQPGNEHLIGKIIAILEFTGH
LIEHSIYRYLYGSWEHILALFGTSNMDILHALLGLFYNFSKRSNYFSRLD
STNRKIVLERLDSIAENWGGKQHGFGLAECCVTEYMPYSAGTMQYEFMQD
VSSLSSAGKEDSNQSSVDVFIKPKCHRRKLTLRNLHLQPESPSELMENLI
QKYNLTNTSDQMALFARLRLCVYFGKPEQRKLLIYTRMQALSILCYTNEV
EDKCLSWDIVEELVDVLKLPDREFLGIKACALRTLTAIIHCGKLTSCWPV
LKNMTGMNSYHGHFPTMMREWITDLVQSKFQPYASTVEQMYTTAILSFLY
HLACTNEVNSTNQGNLVGTGLLDSMKEIIMWHTHEPDYISFATRAVRVTD
QILLSFQLNGSSTNQKSTIDAIVDRLKFEIKICLDSEIDQMTKKSVALNT
QRVGFIKSMLNLIKRLILDNEWSETLKATMDGELPDILRLIFMNYTTKFN
PQLCLFSMEVITNFVYNHPSSMSAMQERQLTKDILRTLTEQPLPVNRDFL
VTLPTLLSALSINIRGINEIKESKIIDKYIKTLTDSRFVTAMRNKRIREM
MTPSENSDTATTNHSHPSTPTSYQMSNAMNELARANAVVFKPIIYESISK
AFKTVTNIGQKQPAPLLGNGKPGSIQKALNHHHNNEHSNPITIDDNEIMP
LQENVDSQEIASTAGPSGVYSSDSNQAADLLAVMTAVEEADREVEQIMEM
SGDEDDGVADNEMTQAIDAEEDRTPSDGCGKDNKTEEMNQFSCDDDAVYL
MDYICNVCKFMERFMSDQQPEHSLRQQIYSEEGLKTILDILTIPSLPYDF
PSSPACQSMQKIFEYLLSWATANDAILIYQMFFKISKKVGDRLQKLEQPQ
LYSILLKDYVNRSEEFQDSPALMVATKTYWEENGVCLLHDLVILSTVIVI
YDKITDRLSNNLRQDILAELKSGIIDYARLLPLLNWEAMVLMNLLFEDEE
ACLEDLKRLCINERGTCADNEHNEERCFLTKKSSLSTCQQLFSDNPRSEK
IIKRMLQITQKAANDMVELLVTLTKFCCVKPDYSYVVRVRYNRVNGSIPT
GKNKMALLNKIAEHCKSLLERESPYTLQAGQDSWPEDPHSELPVEKACQK
ILSDIKFLHPMKYFCFTTIHRILTGGDLNKKPFLGFFYAFQMNNGLEVFF
ECANELLDTIRYIQYLDPNANSSVKIMLESFLITVDRMTQIRRITQEFVD
STDKELRDKFDIDLYQRMIRAYMLEPISKLFSFSSLDIDLLNNQSQESLM
NIIAFLTSYIFDRDTKKSESEETPEEPIVFNDDHEQLINQHISFIMELGF
SRENARRALERNDYDPTQAVSSLFNSDLGIRTAESSSSTNEPETSSKSVR
PNPLNENSREISTIEARLKELEMKNVSIKEMIKESFLINLFNLQKEKGID
IITRIVDILLLTGQINEFLEKILAINGCSFLTSDDIYSNILRTLILNHSG
KEISGANIEDSPNGLHILTLLYNKIRFQVTAAFKNHDMVTRLVKMTNLLF
KSFMAVPHQTETFKTSVLKHITQLWLIIDQYERTAFALRIRKDVIYEYQG
CPTWFWIDDRHGIWHPVSTQHNANINRSYRNGQLKAYSKPNSNNEYVFNF
VSLTQKNEESQTERPIMLLPSKSKDQRKFENLSEYEHKIISCVPDPLGDE
EVVELSDNMLQFLISIKKIDNVYKWDCLQAACYLLIRLCDKYSVASERLA
AYKSAIPRLCTIPHVKGYTQQLVTFVMTLLRQQFETPQLLQHTISDILDK
NVSKGACVLHKTTSYNDKLSKDLFYFIWDNIPLLVRDFETTMNLMSKKIE
LNCQTEKQVLKTYSISKSPSLTSKATQPLMELEKKQIAIVRFLVESALSY
YIEKNDVWCELFKKLKLNTEYDLKNMIASPNYLLETHTVVTSNLENNFSS
NQHSSGTVKHTYKLTGKEFLIYLEELIFSYEQVGAFTINLRLFNRPLSFY
LVNIYLQEACALLDSMRSKEPGSNTSPSMSREQNQFQQLVSLQIIEAFLL
TVKESYDVIIGEIVRNLKMRSHHKDGDCRNTYIVVIMKLLNDLITRLPVS
VSKKLVILMYKYRLPNDLCRLLSVVDCSVAQHKSVLVDILTVVDSLCRPE
RQMYINKRQRSSKSNLELLNKRQRRLNNNADTQATSVIAGTSAATNEITA
QEMETDDVFYVDINAWSRNSRSENTDTAAVDNMENLEASNADEHPVDVDD
DEEMDEYDEVDGVMMSEFRDIDAEYDFDEPQMYDDDNNTESETDYEEIEE
DEGSAGSQDGDSQGDRFDEDIRETENSSHSNGRQEQSRRIFQILNHNYYN
ISQEGENTETPRHDTETSLRDRLSNVQMMSTYDHHPNYVLNESFSLDAPP
SQDDTSTFRLADNLYFVTNSREYDISSQPSNYYPNDLAGCSNTPSNNLLR
TTNLESSAVSQNPQVPTGSQEDSINGRGWRGLTYAPGARYMRLEARTLRQ
NTIRNILTLNRGSFMDRAPNTRSPSNRFVDADLSLDSLEADFEMQEILAR
ALSNIPSGWNFLINPTASAPQNTINNFTFNDISMITNFRRWIVEARTLYG
REITDLVMLARARVYQSVYHSVSSKLTEASVDEKEVVDSKTNMVKTANSN
PDNVDNERNSITDQTDIGRDVSMEQDLMMQPDIMIESLDEPNESVIGEEM
VTPTPSETMESRDEPIDNIEIEQPNEVISRVDQSLGAVGGATVAAARAND
EDIDNLSMEQLIAEGIDPTFLEALPQSMRREVIIEHRRANRVRQQLTGIQ
LPENVDAEIMAQLPAHIQEEILAHYRRENSTSETANAPSLTNPESGSLPL
ISSSTGVVDSSFLLSLAPSLRREILADMDQSQIANLSSELADEARQVRQE
TGDAQMRALQANLLSVTGRRRARQLTSGLSDLLSQMNRGRWDQRNIRYVV
FSERGQTNRHNNAAVTDPVTEAGEWPNLSAYKPLVSTDGLTNLIALLITS
STSPSVMKMISTLVNKILQSLTCHPQIRAWISCTIVNILLKISLPKENTD
SKPKIFSSPSTSESSILCTPIGSGSCTDMSRSSSIQDDTFRQYPNNKSLF
FHSFERGFALTDQVFVPSISKIYKHKNKSGIQSLEMPEITIHESVSGSVA
KALIDSLSSISTMHTKEFFPTSQSKKVPTNFWFTLAWYMSLKSVSLEDQC
PETHLPPNEEYDYFTHLLCLVRLPLMQSNNAMLEKLLSTIHNILKAYYKS
FSMKEKPVAAEWSIATNDGDNHESSTPTASTGNETPLSITKEKSETKAVN
VSDPHLNRVNVKTISHLVNIICAKECSSQTPLPTDKCRMFSERLLIELSK
GNVNTKQDIIRLLTSNIELVLETLTGVLHKVLDEAVMILENECNETCLNE
PSGSTASPIKKSNTFTESISSDILTSNLSPSYENAFTSASSRRNQAQVSS
GYSRNNSLPHIAFNQLKMESIKPFTANTGDHLNLLDLFNLLRKVDNSILT
QFQSPSSIWHLLSQVLDAIQKSKEPDAVIVFQSLVESFLLCHSDCSEIHE
EHNKSDNSNVSDPLSHLNTSLVVDDTFMNSPAFSENGKHNPFLEFVEKHK
KVLNHILRRRTACALDQSNFSALLKYPKLLDFDIKRRYFQAKVAQLRNDG
DSRYEEELVQVSRARLFEDSYGRLHRKTAEEWKQRFCIKFINEEGQDGGG
LLREWYLKMSHEIFNPNYALFKVSPDGVTYTINPASYVNNNHLSYFKFVG
RFIAKAIFDNKLLTCYFTRAFYKHILGISIRYTDLEKEDYQFFRGLEFLL
KNDVSTMFLDQTFSIQISEFGQTETRDLIPNGSQILVTEENKSEYVRLVC
QEKMTGAIRQQLHSFLEGFYEIIPKNLISIFNEKELELLICGLPEIDLND
LKINTVYNKYTPASPQIQWFWQALESFDQEDRARFIQFVTGTSKVPLGGF
SKLEGMNGPTKFQISLASMSTNHLPAAHTCFNSIDLPQYENFDKLHKCLL
TAIRECSEGYGMI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR037197WWE_dom_sf
IPR035983Hect_E3_ubiquitin_ligase
IPR000569HECT_dom
IPR015940UBA
IPR025527HUWE1/Rev1_UBM
IPR010309E3_Ub_ligase_DUF908
IPR010314E3_Ub_ligase_DUF913
IPR004170WWE-dom
IPR009060UBA-like_sf
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0004842ubiquitin-protein transferase activity
GO:0005515protein binding
GO:0005488binding
GO:0016740transferase activity
GO:0016874ligase activity
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1455..1482
NoneNo IPR availableGENE3DG3DSA:3.30.2160.10coord: 3829..3908
e-value: 9.2E-86
score: 289.1
NoneNo IPR availableGENE3DG3DSA:1.10.8.10coord: 1363..1428
e-value: 4.7E-7
score: 31.8
NoneNo IPR availableGENE3DG3DSA:3.90.1750.10coord: 3710..3943
e-value: 9.2E-86
score: 289.1
NoneNo IPR availableGENE3DG3DSA:3.30.2410.10coord: 3945..4064
e-value: 7.2E-44
score: 150.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2285..2306
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 3319..3351
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1432..1461
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 654..671
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2327..2357
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 650..671
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2327..2368
NoneNo IPR availablePANTHERPTHR11254:SF291E3 UBIQUITIN-PROTEIN LIGASE HUWE1coord: 41..4063
NoneNo IPR availablePANTHERPTHR11254HECT DOMAIN UBIQUITIN-PROTEIN LIGASEcoord: 41..4063
IPR000569HECT domainSMARTSM00119hect_3coord: 3727..4064
e-value: 4.7E-151
score: 517.8
IPR000569HECT domainPFAMPF00632HECTcoord: 3760..4063
e-value: 1.0E-87
score: 294.5
IPR000569HECT domainPROSITEPS50237HECTcoord: 3729..4064
score: 99.35
IPR000569HECT domainCDDcd00078HECTccoord: 3710..4062
e-value: 2.7345E-130
score: 411.958
IPR015940Ubiquitin-associated domainSMARTSM00165uba_6coord: 1389..1426
e-value: 0.0046
score: 26.2
IPR015940Ubiquitin-associated domainPROSITEPS50030UBAcoord: 1383..1427
score: 11.463
IPR010314E3 ubiquitin ligase, domain of unknown function DUF913PFAMPF06025DUF913coord: 444..900
e-value: 3.4E-61
score: 207.2
IPR004170WWE domainPFAMPF02825WWEcoord: 1654..1717
e-value: 1.0E-5
score: 26.0
IPR004170WWE domainPROSITEPS50918WWEcoord: 1640..1719
score: 13.299
IPR025527HUWE1/Rev1, ubiquitin binding regionPFAMPF14377UBMcoord: 2908..2934
e-value: 1.2E-6
score: 27.8
coord: 2814..2842
e-value: 1.7E-7
score: 30.4
coord: 2851..2880
e-value: 1.2E-4
score: 21.4
IPR010309E3 ubiquitin ligase, domain of unknown function DUF908PFAMPF06012DUF908coord: 92..372
e-value: 4.6E-16
score: 59.2
IPR037197WWE domain superfamilyGENE3DG3DSA:3.30.720.50coord: 1648..1726
e-value: 6.6E-7
score: 31.7
IPR037197WWE domain superfamilySUPERFAMILYSSF117839WWE domaincoord: 1655..1721
IPR035983HECT, E3 ligase catalytic domainSUPERFAMILYSSF56204Hect, E3 ligase catalytic domaincoord: 3708..4057
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 240..1233
IPR009060UBA-like superfamilySUPERFAMILYSSF46934UBA-likecoord: 1380..1427