WW domain-containing oxidoreductase

Overview
NameWW domain-containing oxidoreductase
Smed IDSMED30006610
Length (bp)3641
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WW domain-containing oxidoreductase (SMED30006610) t-SNE clustered cells

Violin plots show distribution of expression levels for WW domain-containing oxidoreductase (SMED30006610) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WW domain-containing oxidoreductase (SMED30006610) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WW domain-containing oxidoreductase (SMED30006610) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006610

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30006610SMESG000077648.1 SMESG000016314.1 SmedASXL_015688SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30006610SMESG000077649.1 SmedASXL_012490SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006610SMESG000077649.1 SmedASXL_012490SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30006610SMESG000077649.1 dd_Smed_v4_11724_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006610SMESG000077649.1 dd_Smed_v4_11724_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006610SMESG000077649.1 dd_Smed_v4_11724_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006610SMESG000077649.1 dd_Smed_v4_11724_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30006610SMESG000077649.1 SMESG000005424.1 OX_Smed_1.0.08052ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WW domain-containing oxidoreductase vs. Ensembl Human
Match: WWOX (WW domain containing oxidoreductase [Source:HGNC Symbol;Acc:HGNC:12799])

HSP 1 Score: 105.916 bits (263), Expect = 3.944e-31
Identity = 67/220 (30.45%), Postives = 112/220 (50.91%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR------AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWNYLTTKINQIKIVNQ 1187
            + ++V +A   + P+S+++DG ET+FQVN L  FY+ ++L   L         RV+ +S ESHR      ++ +L+   L+P+  +Y    +Y  S LC IL     + +L    +  +        HPGN++Y ++I R   +   +F    PFTK++ Q AAT + C      +   G YFNN C C P+   QS+     LW  L+ ++ Q ++ +Q
Sbjct:  204 LHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLC---RSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSN------AVHPGNMMY-SNIHRSWWVYTLLFTLARPFTKSMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLW-ALSERLIQERLGSQ 412          

HSP 2 Score: 50.8322 bits (120), Expect = 3.944e-31
Identity = 37/164 (22.56%), Postives = 66/164 (40.24%), Query Frame = 2
Query:  119 DTESEYELPPGWT-KSINNGTIIYNNHIINISQLYSPLRDIKIH-KSDVCY---EKIRYNKSCGFRPPKERHKRFI------------------QKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTK 541
            DT+SE ELPPGW  ++  +G + Y NH    +Q   P    +     D+ Y   ++   N    F     +   ++                  Q++D  +T+ +++   + + K  +V G  SGIG E           +IL C N+ +    +   L ++ K
Sbjct:   11 DTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHK 174          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Human
Match: WWOX (WW domain containing oxidoreductase [Source:HGNC Symbol;Acc:HGNC:12799])

HSP 1 Score: 70.4774 bits (171), Expect = 1.475e-20
Identity = 47/159 (29.56%), Postives = 82/159 (51.57%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR------AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTL 1004
            + ++V +A   + P+S+++DG ET+FQVN L  FY+ ++L   L         RV+ +S ESHR      ++ +L+   L+P+  +Y    +Y  S LC IL     + +L    +  +        HPGN++Y ++I R   +   +F    PFTK++
Sbjct:  204 LHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLC---RSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSN------AVHPGNMMY-SNIHRSWWVYTLLFTLARPFTKSM 352          

HSP 2 Score: 50.8322 bits (120), Expect = 1.475e-20
Identity = 37/164 (22.56%), Postives = 66/164 (40.24%), Query Frame = 2
Query:  119 DTESEYELPPGWT-KSINNGTIIYNNHIINISQLYSPLRDIKIH-KSDVCY---EKIRYNKSCGFRPPKERHKRFI------------------QKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTK 541
            DT+SE ELPPGW  ++  +G + Y NH    +Q   P    +     D+ Y   ++   N    F     +   ++                  Q++D  +T+ +++   + + K  +V G  SGIG E           +IL C N+ +    +   L ++ K
Sbjct:   11 DTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHK 174          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Human
Match: WWOX (WW domain containing oxidoreductase [Source:HGNC Symbol;Acc:HGNC:12799])

HSP 1 Score: 68.5514 bits (166), Expect = 1.017e-12
Identity = 47/159 (29.56%), Postives = 82/159 (51.57%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR------AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTL 1004
            + ++V +A   + P+S+++DG ET+FQVN L  FY+ ++L   L         RV+ +S ESHR      ++ +L+   L+P+  +Y    +Y  S LC IL     + +L    +  +        HPGN++Y ++I R   +   +F    PFTK++
Sbjct:    2 LHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLC---RSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSN------AVHPGNMMY-SNIHRSWWVYTLLFTLARPFTKSM 150          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Human
Match: WDR91 (WD repeat domain 91 [Source:HGNC Symbol;Acc:HGNC:24997])

HSP 1 Score: 73.9442 bits (180), Expect = 1.259e-12
Identity = 77/344 (22.38%), Postives = 147/344 (42.73%), Query Frame = 1
Query: 2503 FHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXXXXXXXXXXXALPH----------GVISLYDAESWSAIQTNLITLKSDFTVNCMY--CSSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSK----SIPKESSHLNDFVIPLSWAEKP-----YGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKING-TTLLDSVYLNAGHNSPVICID 3468
            + EH S + H +    S    ASLDV G  K+W+ N P  ++  +   K  + S +W ++   ++LLG+  G+V++YD    + + E+ I+   PRI  +    + + FVC +   S ++  + + P           G + L+D ++    Q           +NC     + N +  G ++G I+L D++  E                     C   W R+++   Y +  S      ++ +    K    +I K    ++++ +P S A  P     Y G + +  PR  L   A+ +  N + + +  G ++ K+ G   +L+S     GH +PV+ +D
Sbjct:  404 YGEHHSSIMHCRVD-CSGRRVASLDVDGVIKVWSFN-PIMQTKASSISKSPLLSLEWATKRDRLLLLGSGVGTVRLYDTEAKKNLCEININDNMPRILSLACSPNGASFVCSAAAPSLTSQVDFSAPDIGSKGMNQVPGRLLLWDTKTMKQ-QLQFSLDPEPIAINCTAFNHNGNLLVTGAADGVIRLFDMQQHE---------------------CAMSW-RAHYGEVYSVEFSYDEN-TVYSIGEDGKFIQWNIHKSGLKVSEYSLP-SDATGPFVLSGYSGYKQVQVPRGRLF--AFDSEGNYMLTCSATGGVIYKLGGDEKVLESCLSLGGHRAPVVTVD 718          

HSP 2 Score: 71.633 bits (174), Expect = 6.772e-12
Identity = 41/141 (29.08%), Postives = 67/141 (47.52%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKK-KSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLW 1776
            +++ L  + + +TL     E K D+ K  +    VD LQ  +Q  DL +L   W   E   F  L+   + T   +K+ +F+ +LV   +  + +K   FF    T  L ++ EW DWF  P + +P  +  F  YF+R W
Sbjct:   12 VREYLLFRGFTHTLRQLDAEIKADKEKGFRVDKIVDQLQQLMQVYDLAALRDYWSYLERRLFSRLEDIYRPTIHKLKTSLFRFYLVYTIQTNRNDKAQEFFAKQATE-LQNQAEWKDWFVLPFLPSPDTNPTFATYFSRQW 151          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Human
Match: WDR91 (WD repeat domain 91 [Source:HGNC Symbol;Acc:HGNC:24997])

HSP 1 Score: 73.559 bits (179), Expect = 1.599e-12
Identity = 82/367 (22.34%), Postives = 155/367 (42.23%), Query Frame = 1
Query: 2503 FHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXXXXXXXXXXXALPH----------GVISLYDAESWSAIQTNLITLKSDFTVNCMY--CSSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSK----SIPKESSHLNDFVIPLSWAEKP-----YGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKING-TTLLDSVYLNAGHNSPVICIDSYPYDLEDSDNVVVLSGTMEGTI 3537
            + EH S + H +    S    ASLDV G  K+W+ N P  ++  +   K  + S +W ++   ++LLG+  G+V++YD    + + E+ I+   PRI  +    + + FVC +   S ++  + + P           G + L+D ++    Q           +NC     + N +  G ++G I+L D++  E                     C   W R+++   Y +  S      ++ +    K    +I K    ++++ +P S A  P     Y G + +  PR  L   A+ +  N + + +  G ++ K+ G   +L+S     GH +PV+ +D         D    L+ +M+G I
Sbjct:  369 YGEHHSSIMHCRVD-CSGRRVASLDVDGVIKVWSFN-PIMQTKASSISKSPLLSLEWATKRDRLLLLGSGVGTVRLYDTEAKKNLCEININDNMPRILSLACSPNGASFVCSAAAPSLTSQVDFSAPDIGSKGMNQVPGRLLLWDTKTMKQ-QLQFSLDPEPIAINCTAFNHNGNLLVTGAADGVIRLFDMQQHE---------------------CAMSW-RAHYGEVYSVEFSYDEN-TVYSIGEDGKFIQWNIHKSGLKVSEYSLP-SDATGPFVLSGYSGYKQVQVPRGRLF--AFDSEGNYMLTCSATGGVIYKLGGDEKVLESCLSLGGHRAPVVTVDWS----TAMDCGTCLTASMDGKI 702          

HSP 2 Score: 66.2402 bits (160), Expect = 3.420e-10
Identity = 34/107 (31.78%), Postives = 52/107 (48.60%), Query Frame = 1
Query: 1456 VDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLW 1776
            VD LQ  +Q  DL +L   W   E   F  L+   + T   +K+ +F+ +LV   +  + +K   FF    T  L ++ EW DWF  P + +P  +  F  YF+R W
Sbjct:   11 VDQLQQLMQVYDLAALRDYWSYLERRLFSRLEDIYRPTIHKLKTSLFRFYLVYTIQTNRNDKAQEFFAKQATE-LQNQAEWKDWFVLPFLPSPDTNPTFATYFSRQW 116          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Celegans
Match: sorf-1 (Suppressor of organelle fusion 1 [Source:UniProtKB/Swiss-Prot;Acc:Q23533])

HSP 1 Score: 73.9442 bits (180), Expect = 3.554e-14
Identity = 41/144 (28.47%), Postives = 72/144 (50.00%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKKKSRY----FVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLW 1776
            ++  L+ K    +L +F +E       K++ Y     +D + +AI  +D+D+L  +W+ +    F  LD +  K A   ++  ++ FLV C + K   K N FF+ M +  L +  +WADWF FP   +  + + F  YF + W
Sbjct:   12 VRNYLAAKSMVTSLKAFDQESSF---AKEANYQVDRCIDEMTDAIDKHDVDTLCAMWESWNARVFHSLDTEGIKQAQCYEASAYRLFLVRCVQKKNISKCNEFFRKMSSLTLNNP-QWADWFAFPYNHHAKDTEPFRKYFDKTW 151          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Celegans
Match: sorf-1 (Suppressor of organelle fusion 1 [Source:UniProtKB/Swiss-Prot;Acc:Q23533])

HSP 1 Score: 73.9442 bits (180), Expect = 3.554e-14
Identity = 41/144 (28.47%), Postives = 72/144 (50.00%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKKKSRY----FVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLW 1776
            ++  L+ K    +L +F +E       K++ Y     +D + +AI  +D+D+L  +W+ +    F  LD +  K A   ++  ++ FLV C + K   K N FF+ M +  L +  +WADWF FP   +  + + F  YF + W
Sbjct:   12 VRNYLAAKSMVTSLKAFDQESSF---AKEANYQVDRCIDEMTDAIDKHDVDTLCAMWESWNARVFHSLDTEGIKQAQCYEASAYRLFLVRCVQKKNISKCNEFFRKMSSLTLNNP-QWADWFAFPYNHHAKDTEPFRKYFDKTW 151          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Celegans
Match: E04F6.15 (pep chromosome:WBcel235:II:7208773:7210287:-1 gene:WBGene00017131.1 transcript:E04F6.15.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:E04F6.15)

HSP 1 Score: 60.4622 bits (145), Expect = 7.406e-13
Identity = 57/211 (27.01%), Postives = 89/211 (42.18%), Query Frame = 3
Query:  561 IVFSAGIMSPPFSVSEDGFETSFQVNVLSLF-YIQEML-------------LSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWNYL 1151
            ++ +AG+  P    + DGFE  F +N L+ F  I+E+L             ++S+ S H  VK           R +++L+      ++Q Y  F  YA S +C IL    +  K    +   +   +  HPG+ V  T + R   +     +   PFTK  SQ AAT + C +    K  SG Y+ + C  D   L +     E L   L
Sbjct:  111 LILNAGVFGPSEKTTSDGFEAHFGINHLAHFILIKELLPVLRESAPSRIVIVTSMLSKHTCVK--------PDSRIVEKLDTLCPKEATQWY--FRLYAKSKMCNIL----TAFKLHRDEFKNRISVYAVHPGSGV-RTDLHRDFGLWSIADFLSIPFTKNASQGAATSLYCAVHPEVKELSGKYWES-CWDDEKNLDKKVSRDEELQEAL 305          

HSP 2 Score: 33.4982 bits (75), Expect = 7.406e-13
Identity = 19/67 (28.36%), Postives = 35/67 (52.24%), Query Frame = 2
Query:  332 QKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVD 532
            ++F S + + +V++  +LS K   + G  SGIG+E    LI K   +++   N    +   KS L++
Sbjct:    9 RQFHSRTNALEVLDGIDLSGKTFAITGTTSGIGVETAKALILKGAHVVMINRNYTASEASKKSLLIE 75          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Celegans
Match: dhs-8 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:U4PLQ0])

HSP 1 Score: 67.3958 bits (163), Expect = 7.427e-12
Identity = 59/215 (27.44%), Postives = 92/215 (42.79%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSC---ESHRAIKELNLCE----LNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCIC-DPTLLGQSKINGEMLWNYLTTKINQI 1172
            I  ++ +AG+  P  + ++DGFE+ + VNV++ F +  +LL  +         RVV+LS      H   K + + E    L       +    Y  S +  +LI      K    +       +  HPG+ V  T I R   + KFI +  +PFTK  SQ AAT + C      +  SG Y+ +   C D   + +     E L   L  K+ QI
Sbjct:   51 IHGLILNAGVFRPAAAKTKDGFESHYGVNVVAHFTLLRILLPVV---RRSAPSRVVFLSSTLSSKHGFKKSMGISEKMSILQGEDSSASTLQMYGASKMADMLIA----FKLHRDEYKNGISTYSVHPGSGV-RTDIFRNSLLGKFIGFVTTPFTKNASQGAATTVYCATHPEVEKISGKYWES---CWDNDKIDKKTARDEELQEALWKKLEQI 254          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Celegans
Match: dhs-8 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:U4PLQ0])

HSP 1 Score: 67.781 bits (164), Expect = 1.326e-11
Identity = 59/215 (27.44%), Postives = 92/215 (42.79%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSC---ESHRAIKELNLCE----LNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCIC-DPTLLGQSKINGEMLWNYLTTKINQI 1172
            I  ++ +AG+  P  + ++DGFE+ + VNV++ F +  +LL  +         RVV+LS      H   K + + E    L       +    Y  S +  +LI      K    +       +  HPG+ V  T I R   + KFI +  +PFTK  SQ AAT + C      +  SG Y+ +   C D   + +     E L   L  K+ QI
Sbjct:  107 IHGLILNAGVFRPAAAKTKDGFESHYGVNVVAHFTLLRILLPVV---RRSAPSRVVFLSSTLSSKHGFKKSMGISEKMSILQGEDSSASTLQMYGASKMADMLIA----FKLHRDEYKNGISTYSVHPGSGV-RTDIFRNSLLGKFIGFVTTPFTKNASQGAATTVYCATHPEVEKISGKYWES---CWDNDKIDKKTARDEELQEALWKKLEQI 310          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Fly
Match: Wwox (gene:FBgn0031972 transcript:FBtr0079550)

HSP 1 Score: 120.939 bits (302), Expect = 9.330e-29
Identity = 71/206 (34.47%), Postives = 110/206 (53.40%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR----AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLW 1142
            Q    ID ++ +AG+ + P++ + DG ET+FQV+ LS FY+  + L +LF      K R++ LS ESHR     ++ L +  L+P  ++Y    +Y  + LC +L  +    +W      R    F  HPGN+V ++ ++R     + +F    PFTK+L QAAAT I C  +N     SG YFNN   C+P+ L +S    + LW
Sbjct:  198 QSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLT-LQLETLFD----YKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWK----QRGISVFSLHPGNMV-SSDLSRNYWFYRLLFAIVRPFTKSLQQAAATSIYCATANELTGLSGLYFNNCFFCEPSKLSKSAALQQQLW 393          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Fly
Match: Wwox (gene:FBgn0031972 transcript:FBtr0343384)

HSP 1 Score: 120.939 bits (302), Expect = 9.330e-29
Identity = 71/206 (34.47%), Postives = 110/206 (53.40%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR----AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLW 1142
            Q    ID ++ +AG+ + P++ + DG ET+FQV+ LS FY+  + L +LF      K R++ LS ESHR     ++ L +  L+P  ++Y    +Y  + LC +L  +    +W      R    F  HPGN+V ++ ++R     + +F    PFTK+L QAAAT I C  +N     SG YFNN   C+P+ L +S    + LW
Sbjct:  198 QSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLT-LQLETLFD----YKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWK----QRGISVFSLHPGNMV-SSDLSRNYWFYRLLFAIVRPFTKSLQQAAATSIYCATANELTGLSGLYFNNCFFCEPSKLSKSAALQQQLW 393          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Fly
Match: CG6005 (gene:FBgn0038672 transcript:FBtr0343992)

HSP 1 Score: 70.8626 bits (172), Expect = 1.574e-12
Identity = 36/141 (25.53%), Postives = 73/141 (51.77%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKK-KSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLW 1776
            +++ L  + + +TL +   E++ ++ +  ++   ++   NA+Q +DL +L  +W   +   F  L+         +++ + K +LV  + + + EKV+ FF  +    L  ++EW DWF FP  KN  E   F ++FT+ W
Sbjct:   11 LREYLVFRGFSSTLKALDLEQRTEKDQHFRAERILEQFNNAVQASDLQALRSLWFHLDNNIFSKLEHTYAVAVKKLENSLLKYYLVTAYSSNRPEKVSEFFNKLAG-DLQQQSEWKDWFYFPFCKNAEESPTFALFFTKQW 150          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Fly
Match: CG6005 (gene:FBgn0038672 transcript:FBtr0083719)

HSP 1 Score: 70.8626 bits (172), Expect = 1.574e-12
Identity = 36/141 (25.53%), Postives = 73/141 (51.77%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKK-KSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLW 1776
            +++ L  + + +TL +   E++ ++ +  ++   ++   NA+Q +DL +L  +W   +   F  L+         +++ + K +LV  + + + EKV+ FF  +    L  ++EW DWF FP  KN  E   F ++FT+ W
Sbjct:   11 LREYLVFRGFSSTLKALDLEQRTEKDQHFRAERILEQFNNAVQASDLQALRSLWFHLDNNIFSKLEHTYAVAVKKLENSLLKYYLVTAYSSNRPEKVSEFFNKLAG-DLQQQSEWKDWFYFPFCKNAEESPTFALFFTKQW 150          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Fly
Match: CG11200 (gene:FBgn0034500 transcript:FBtr0086299)

HSP 1 Score: 63.929 bits (154), Expect = 3.518e-10
Identity = 54/188 (28.72%), Postives = 94/188 (50.00%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSP-HNGVKCRVVWL-SCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNV---VYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNG 1085
            +++ ++DL++ +AGIM  PF ++ DG+E+ F +N L  F +  +LL  L +    G   R+V + SC +   I  +N  ++N +   Y G  +Y+ S L +IL  ++ +   D+     +    V HPG V   ++  S T   PI K +F+      KT  + + T +   I  S +   G Y +NG
Sbjct:  143 ERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKEGRNSRIVNVSSCVN--LIGRINYKDINGTKHYYPG-TAYSQSKLAQILFTRHLQTLLDAEKSHVQ--VNVVHPGIVDTDLFEHSATTSVPIFKKLFF------KTPERGSRTVVFAAIDPSIEGQGGTYLSNG 319          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Zebrafish
Match: wdr91 (WD repeat domain 91 [Source:NCBI gene;Acc:402898])

HSP 1 Score: 85.5001 bits (210), Expect = 2.052e-16
Identity = 89/352 (25.28%), Postives = 153/352 (43.47%), Query Frame = 1
Query: 2503 FHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXXXXXXXXXX----XALPHGVISLYDAESWSAIQTNLITLKSDFTVNCMY--CSSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKIN-GTTLLDSVYLNAGHNSPVICIDSYPYDLEDSDNVVVLSGTMEGTI 3537
            + EH S + H +    S    ASLDV G  K+WA N P  ++  T+  K  + S +W ++   ++LLG+  G+VK+YD    + + EM ID   PRI  +    S + FVC +   S +   +    SA   G + L+D ++    Q           +NC     + N +  G ++G I+L D++  E  +  S    +G EV +V           ++D N +  +    +   +++         E S   D V P   +   Y G + +  PR  L   A+ +    + + +  G  + ++N     L+SV   AGH +PV+ +D         D    L+ +M+G I
Sbjct:  390 YGEHHSSIMHCRVD-CSGRRVASLDVDGVVKVWAFN-PIMQTKATIMSKSPLLSLEWAAKPDRLLLLGSGVGTVKLYDTDAKKCLYEMTIDDVHPRILSLACSPSGTSFVCSAAAHSGAVMESEPRGSAPVSGQLLLWDTKTVKQ-QLQFALEPGPVAINCTAFNHNGNLLVTGAADGIIRLFDMQRYE--SALSWKAHDG-EVYSV---------EFSYDENTVFSIGEDGKFVQWNIHRCGVK-QSEYSLSQDAVGPFVLSG--YSGYKQVQVPRGRLF--AFDSEGQHVLTCSSTGGNIYRLNKAEAGLESVLSLAGHKAPVVTVDW----CSAMDCGTCLTASMDGKI 717          

HSP 2 Score: 70.8626 bits (172), Expect = 7.122e-12
Identity = 40/141 (28.37%), Postives = 68/141 (48.23%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKK-KSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLW 1776
            +++ L  + + +TL     E K D+ K  +    +D LQ  IQ+ DL  L + W   E   F  L+   + T   +++ +++ +L+   + K  EK   FFQ      L ++ EW DWF  P +  P ++  F  YF+R W
Sbjct:   15 VREYLIYRGFTSTLKHLDSEIKTDKEKGFRVDKIMDQLQLLIQSCDLTGLKEYWANLERRLFCRLEDVYKPTVSKLRTSLYRFYLIHTVQVKNVEKTQEFFQKQA-LELQAQAEWRDWFSLPFIPAPEQNPSFSAYFSRQW 154          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Zebrafish
Match: wdr91 (WD repeat domain 91 [Source:NCBI gene;Acc:402898])

HSP 1 Score: 85.5001 bits (210), Expect = 2.087e-16
Identity = 89/352 (25.28%), Postives = 153/352 (43.47%), Query Frame = 1
Query: 2503 FHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXXXXXXXXXX----XALPHGVISLYDAESWSAIQTNLITLKSDFTVNCMY--CSSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKIN-GTTLLDSVYLNAGHNSPVICIDSYPYDLEDSDNVVVLSGTMEGTI 3537
            + EH S + H +    S    ASLDV G  K+WA N P  ++  T+  K  + S +W ++   ++LLG+  G+VK+YD    + + EM ID   PRI  +    S + FVC +   S +   +    SA   G + L+D ++    Q           +NC     + N +  G ++G I+L D++  E  +  S    +G EV +V           ++D N +  +    +   +++         E S   D V P   +   Y G + +  PR  L   A+ +    + + +  G  + ++N     L+SV   AGH +PV+ +D         D    L+ +M+G I
Sbjct:  390 YGEHHSSIMHCRVD-CSGRRVASLDVDGVVKVWAFN-PIMQTKATIMSKSPLLSLEWAAKPDRLLLLGSGVGTVKLYDTDAKKCLYEMTIDDVHPRILSLACSPSGTSFVCSAAAHSGAVMESEPRGSAPVSGQLLLWDTKTVKQ-QLQFALEPGPVAINCTAFNHNGNLLVTGAADGIIRLFDMQRYE--SALSWKAHDG-EVYSV---------EFSYDENTVFSIGEDGKFVQWNIHRCGVK-QSEYSLSQDAVGPFVLSG--YSGYKQVQVPRGRLF--AFDSEGQHVLTCSSTGGNIYRLNKAEAGLESVLSLAGHKAPVVTVDW----CSAMDCGTCLTASMDGKI 717          

HSP 2 Score: 70.8626 bits (172), Expect = 7.183e-12
Identity = 40/141 (28.37%), Postives = 68/141 (48.23%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKK-KSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLW 1776
            +++ L  + + +TL     E K D+ K  +    +D LQ  IQ+ DL  L + W   E   F  L+   + T   +++ +++ +L+   + K  EK   FFQ      L ++ EW DWF  P +  P ++  F  YF+R W
Sbjct:   15 VREYLIYRGFTSTLKHLDSEIKTDKEKGFRVDKIMDQLQLLIQSCDLTGLKEYWANLERRLFCRLEDVYKPTVSKLRTSLYRFYLIHTVQVKNVEKTQEFFQKQA-LELQAQAEWRDWFSLPFIPAPEQNPSFSAYFSRQW 154          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Zebrafish
Match: si:dkey-94e7.2 (si:dkey-94e7.2 [Source:ZFIN;Acc:ZDB-GENE-070912-611])

HSP 1 Score: 73.559 bits (179), Expect = 8.019e-14
Identity = 59/205 (28.78%), Postives = 93/205 (45.37%), Query Frame = 3
Query:  546 REIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFW-FFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEM---LW 1142
            R + L++ +AG+M  P+S + DGFE  F VN L  F    +    +         R++ LS  +H +   + L ++N S + Y+   +Y  S L  IL  +    KLK      D     +  HPG  +  T + R+  +   I W    PFTKT  Q A T I C +     + SG Y+++   C P+   ++  + EM   LW
Sbjct:   50 RSLHLLINNAGVMMCPYSKTADGFEMQFGVNHLGHFL---LTFLLIDLLKRSAPSRIINLSSMAH-SWGTITLDDIN-SERNYHSRRAYGQSKLANILFTRSLAKKLK------DTGVTSYAVHPG--IVRTELKRHMNLGLLIMWKVVRPFTKTPVQGAQTTIYCAVQPELDAESGGYYSD---CRPSRCTRAARDDEMAEKLW 238          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Zebrafish
Match: rdh12 (retinol dehydrogenase 12 [Source:ZFIN;Acc:ZDB-GENE-040718-9])

HSP 1 Score: 66.2402 bits (160), Expect = 1.000e-13
Identity = 54/212 (25.47%), Postives = 98/212 (46.23%), Query Frame = 3
Query:  537 QKF-REID---LIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLL---GQSKINGEMLWN 1145
            Q+F RE+D   +++ +AG+M  P+  + DGFE    VN L  +    +    +         R+V +S  +H     +   +L+ S   YN   +Y  S L  +L  +    +L+  ++  +        HPG V   + + R+  ++  +F FFS F K+  + A T I C ++   +S SG +F++   C P  +   G+S+     LW+
Sbjct:  114 QRFLREVDHLHILINNAGVMMCPYMKTADGFEMQIGVNHLGHYL---LTYLLIGLLKRSAPSRIVVVSSLAHN-FGWIRFHDLH-SQGSYNSGLAYCQSKLANVLFTRELARRLQGSNVTVNS------VHPGTV--RSELVRHSTLMSLLFAFFSMFLKSPKEGAQTSIYCAVAEELQSISGKHFSD---CAPAFVAPQGRSEETARKLWD 309          

HSP 2 Score: 31.5722 bits (70), Expect = 1.000e-13
Identity = 17/41 (41.46%), Postives = 22/41 (53.66%), Query Frame = 2
Query:  371 NTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNL 493
            +T  L  K ALV G  SGIG E    L ++   +IL C +L
Sbjct:   37 STVRLDGKVALVTGANSGIGKETALDLASRGARVILACRDL 77          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Zebrafish
Match: si:dkey-94e7.2 (si:dkey-94e7.2 [Source:ZFIN;Acc:ZDB-GENE-070912-611])

HSP 1 Score: 73.1738 bits (178), Expect = 2.379e-13
Identity = 56/203 (27.59%), Postives = 91/203 (44.83%), Query Frame = 3
Query:  546 REIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFW-FFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEM---LW 1142
            R + L++ +AG+M  P+S + DGFE  F VN L  F    +    +         R++ LS  +H +   + L ++N S + Y+   +Y  S L  IL  +    K   +        +  HPG  +  T + R+  +   I W    PFTKT  Q A T I C +     + SG Y+++   C P+   ++  + EM   LW
Sbjct:   94 RSLHLLINNAGVMMCPYSKTADGFEMQFGVNHLGHFL---LTFLLIDLLKRSAPSRIINLSSMAH-SWGTITLDDIN-SERNYHSRRAYGQSKLANILFTRSLAKKLKGVTS------YAVHPG--IVRTELKRHMNLGLLIMWKVVRPFTKTPVQGAQTTIYCAVQPELDAESGGYYSD---CRPSRCTRAARDDEMAEKLW 280          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Xenopus
Match: wdr91 (WD repeat domain 91 [Source:NCBI gene;Acc:780034])

HSP 1 Score: 126.331 bits (316), Expect = 6.540e-29
Identity = 174/754 (23.08%), Postives = 331/754 (43.90%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKKKS-RYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLWXXXXXXXXXXXXXQV-----VRSVMSYDSDLENYFSLDMRLENCINQITTKEPDMIKQKYNLTDSNAGKSQIISQV---ISNLHGSGRTLHDVSDLLCDFRLTRENKQIEYRRASKSNKPKGI--SLIIQNKTKSTSPNTFLRKKAVPFINVENVDAKDIIWKGEAKDTLTKIDEQSN-QSSPNLADLDNS-VSMIE-----NSINSTVIGNIAPQASSEIN-KNSSAD---------------SFGIKQFSSKISQKIFKPKLSITTTAPKVTVFHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXXXXXXXXXXXA-----------LPHGVISLYDAESW-SAIQTNLITLKSDFTVNCMYC--SSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKIN--GTTLLDSVYLNAGHNSPVICID 3468
            +K+ L+ + + NTL  F  + K D+ K       V+ L   +Q+ DL+ L++ W   E   F  L+   + T   +K+ +F+ +LV   ++ +T+K + FFQ   T  L ++ EW +WF  P +  P  ++ F  YF+R W D F +S+ NF   +     V  ++++ SD +    L  + EN I  +  K   +  + Y L      +  ++ ++   +SN+   G      S+L  +   +  N  +     + S +  G   SL+ QNK K   P + L   + P  +  +V  K  +   +A+     +      +SSPN+  +  +  SM++           ++   A Q S+E   +NS AD               + G     ++  +K  +P + ++        + EH S + H +    S    ASLDV G  KIW+++         +S K  + S +W ++   ++LLG++ G+V++YD    + + E+ I    PRI  +    S + FVC +   +  + ++             +P G + L+D ++    +Q +L  +     VNC     + N +  G ++G I+L D++  ++    S     G EV +V           ++D N +  +    +   +D+    + +  E S  +D   P   +   Y G + + FPR  L   A+ +    + + +  G ++ K+N  G+TL + + L  GH +PV+ +D
Sbjct:   12 VKEYLTFRGFTNTLKYFEVDIKADKDKGFCVDRIVEQLLQFVQSYDLNGLVEYWAYLERRLFSRLEDVYRPTIHKLKTSLFRYYLVYTIQSSRTDKAHEFFQKQAT-ELQNQAEWKEWFALPFLPTPDSNRTFSTYFSRQWADTFTVSLHNFLSVLFQCMPVPKILTFQSDYQKIACL--QEENEI--MRQKLFALQAETYRLRKDGPSEPLVLHKLPHYVSNMDRLGD-----SELGSNIMSSHSNTNMN----TPSQRTSGFLSSLLAQNK-KPPPPKSTLPSVSSPTQSGGSVPLKKEVAVSQAQKAKELVGGTKEVRSSPNILGVPGTESSMVQQRHKRQQERKELLSKTASQVSTEKKAENSDADPDLRSDTQNDTVDAVTRGSGASGARKEEKPAQPFIVLSQDE-----YAEHHSSIMHCRVD-CSGRRVASLDVDGVIKIWSLDGIMQTKASAIS-KSALLSLEWATKRDRLLLLGSEVGTVRLYDTEAKKNLCEIGIVEDMPRILSLACSPSGASFVCSAAAATSPSQTDPTYYSYGESGNNQVP-GKLLLWDTKTMKQQLQFSLEPVP--IAVNCTAFNHNGNLLVTGAADGFIRLFDMQ--QHQCALSWKAHMG-EVYSVD---------FSYDENAVYSIGEDGKFIQWDIHKSGQKV-SEYSLPSDATGPFMLSG--YSGYKQVQFPRGRLF--AFDSEGKYMLTCSSTGGVIYKLNSDGSTLENCLSL-GGHRAPVVTVD 722          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Xenopus
Match: runx1 (RUNX family transcription factor 1 [Source:Xenbase;Acc:XB-GENE-483164])

HSP 1 Score: 58.9214 bits (141), Expect = 4.206e-18
Identity = 45/163 (27.61%), Postives = 75/163 (46.01%), Query Frame = 2
Query:  119 DTESEYELPPGWT-KSINNGTIIYNNHIINISQLYSPL--------------------RDIKIHKSDVCYEKIRY-NKSCGFR---PPKERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVD 532
            DT+SE E+PPGW  +S  +G + Y NH+   +Q   P                      + +I+  D   ++  Y +    F     P + + R  QK+D  +T+ +++   +LS K  +V G  +GIG E    L     ++IL C NL K + E K K+++
Sbjct:   11 DTDSEDEMPPGWEERSTKDGWVYYANHLDEKTQWEHPKTGKRKRIAGDLPYGWEQETDENGQIYFVDHLNQRTTYLDPRLAFTVEDQPTKMNTR--QKYDGNTTAMEILQGCDLSGKVVIVTGANTGIGFETARSLALHGTLVILACRNLQKGN-EAKHKILE 170          

HSP 2 Score: 54.299 bits (129), Expect = 4.206e-18
Identity = 51/159 (32.08%), Postives = 80/159 (50.31%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR--AIKE----LNLCELNPSSQEYNGFYSYALSSLCKILIVKY--SKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTL 1004
            + +++ +A  +  P+ ++EDG E +FQVN L  FY+  +L   L      +  RVV +S ESHR   IK+    L+L  L+P  ++Y    +Y  S LC IL  K    +L    +  +        HPGN++Y +SI R       +F    PFTK++
Sbjct:  204 LHVLICNAAYLGGPWQLTEDGLEMTFQVNHLGHFYLVSLLQDVL---QRSIPSRVVVVSSESHRFTEIKDSSGKLDLNLLSPLKKDYWAMLAYNRSKLCNILFSKELNRRLSPHGVTSN------AVHPGNMMY-SSIHRNWWGYTLLFALVRPFTKSM 352          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Xenopus
Match: runx1 (RUNX family transcription factor 1 [Source:Xenbase;Acc:XB-GENE-483164])

HSP 1 Score: 58.5362 bits (140), Expect = 4.719e-18
Identity = 45/163 (27.61%), Postives = 75/163 (46.01%), Query Frame = 2
Query:  119 DTESEYELPPGWT-KSINNGTIIYNNHIINISQLYSPL--------------------RDIKIHKSDVCYEKIRY-NKSCGFR---PPKERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVD 532
            DT+SE E+PPGW  +S  +G + Y NH+   +Q   P                      + +I+  D   ++  Y +    F     P + + R  QK+D  +T+ +++   +LS K  +V G  +GIG E    L     ++IL C NL K + E K K+++
Sbjct:   11 DTDSEDEMPPGWEERSTKDGWVYYANHLDEKTQWEHPKTGKRKRIAGDLPYGWEQETDENGQIYFVDHLNQRTTYLDPRLAFTVEDQPTKMNTR--QKYDGNTTAMEILQGCDLSGKVVIVTGANTGIGFETARSLALHGTLVILACRNLQKGN-EAKHKILE 170          

HSP 2 Score: 54.6842 bits (130), Expect = 4.719e-18
Identity = 51/159 (32.08%), Postives = 80/159 (50.31%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR--AIKE----LNLCELNPSSQEYNGFYSYALSSLCKILIVKY--SKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTL 1004
            + +++ +A  +  P+ ++EDG E +FQVN L  FY+  +L   L      +  RVV +S ESHR   IK+    L+L  L+P  ++Y    +Y  S LC IL  K    +L    +  +        HPGN++Y +SI R       +F    PFTK++
Sbjct:  204 LHVLICNAAYLGGPWQLTEDGLEMTFQVNHLGHFYLVSLLQDVL---QRSIPSRVVVVSSESHRFTEIKDSSGKLDLNLLSPLKKDYWAMLAYNRSKLCNILFSKELNRRLSPHGVTSN------AVHPGNMMY-SSIHRNWWGYTLLFALVRPFTKSM 352          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Xenopus
Match: wdr91 (WD repeat domain 91 [Source:NCBI gene;Acc:780034])

HSP 1 Score: 77.0258 bits (188), Expect = 1.098e-13
Identity = 42/141 (29.79%), Postives = 74/141 (52.48%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKKKS-RYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLW 1776
            +K+ L+ + + NTL  F  + K D+ K       V+ L   +Q+ DL+ L++ W   E   F  L+   + T   +K+ +F+ +LV   ++ +T+K + FFQ   T  L ++ EW +WF  P +  P  ++ F  YF+R W
Sbjct:   12 VKEYLTFRGFTNTLKYFEVDIKADKDKGFCVDRIVEQLLQFVQSYDLNGLVEYWAYLERRLFSRLEDVYRPTIHKLKTSLFRYYLVYTIQSSRTDKAHEFFQKQAT-ELQNQAEWKEWFALPFLPTPDSNRTFSTYFSRQW 151          

HSP 2 Score: 73.559 bits (179), Expect = 1.364e-12
Identity = 79/337 (23.44%), Postives = 149/337 (44.21%), Query Frame = 1
Query: 2503 FHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXXXXXXXXXXXA-----------LPHGVISLYDAESWSAIQTNLITLKSDFTVNCMYC--SSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKIN--GTTLLDSVYLNAGHNSPVICID 3468
            + EH S + H +    S    ASLDV G  KIW+++         +S K  + S +W ++   ++LLG++ G+V++YD    + + E+ I    PRI  +    S + FVC +   +  + ++             +P G + L+D ++    Q           VNC     + N +  G ++G I+L D++  ++    S     G EV +V           ++D N +  +    +   +D+    + +  E S  +D   P   +   Y G + + FPR  L   A+ +    + + +  G ++ K+N  G+TL + + L  GH +PV+ +D
Sbjct:  276 YAEHHSSIMHCRVD-CSGRRVASLDVDGVIKIWSLDGIMQTKASAIS-KSALLSLEWATKRDRLLLLGSEVGTVRLYDTEAKKNLCEIGIVEDMPRILSLACSPSGASFVCSAAAATSPSQTDPTYYSYGESGNNQVP-GKLLLWDTKTMKQ-QLQFSLEPVPIAVNCTAFNHNGNLLVTGAADGFIRLFDMQ--QHQCALSWKAHMG-EVYSVD---------FSYDENAVYSIGEDGKFIQWDIHKSGQKV-SEYSLPSDATGPFMLS--GYSGYKQVQFPRGRLF--AFDSEGKYMLTCSSTGGVIYKLNSDGSTLENCLSL-GGHRAPVVTVD 590          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Xenopus
Match: wdr91 (WD repeat domain 91 [Source:NCBI gene;Acc:780034])

HSP 1 Score: 77.0258 bits (188), Expect = 1.193e-13
Identity = 42/141 (29.79%), Postives = 74/141 (52.48%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKKKS-RYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLW 1776
            +K+ L+ + + NTL  F  + K D+ K       V+ L   +Q+ DL+ L++ W   E   F  L+   + T   +K+ +F+ +LV   ++ +T+K + FFQ   T  L ++ EW +WF  P +  P  ++ F  YF+R W
Sbjct:   12 VKEYLTFRGFTNTLKYFEVDIKADKDKGFCVDRIVEQLLQFVQSYDLNGLVEYWAYLERRLFSRLEDVYRPTIHKLKTSLFRYYLVYTIQSSRTDKAHEFFQKQAT-ELQNQAEWKEWFALPFLPTPDSNRTFSTYFSRQW 151          

HSP 2 Score: 74.7146 bits (182), Expect = 5.597e-13
Identity = 80/338 (23.67%), Postives = 153/338 (45.27%), Query Frame = 1
Query: 2503 FHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXXXXXXXXXXXA-----------LPHGVISLYDAESW-SAIQTNLITLKSDFTVNCMYC--SSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKIN--GTTLLDSVYLNAGHNSPVICID 3468
            + EH S + H +    S    ASLDV G  KIW+++         +S K  + S +W ++   ++LLG++ G+V++YD    + + E+ I    PRI  +    S + FVC +   +  + ++             +P G + L+D ++    +Q +L  +     VNC     + N +  G ++G I+L D++  ++    S     G EV +V           ++D N +  +    +   +D+    + +  E S  +D   P   +   Y G + + FPR  L   A+ +    + + +  G ++ K+N  G+TL + + L  GH +PV+ +D
Sbjct:  300 YAEHHSSIMHCRVD-CSGRRVASLDVDGVIKIWSLDGIMQTKASAIS-KSALLSLEWATKRDRLLLLGSEVGTVRLYDTEAKKNLCEIGIVEDMPRILSLACSPSGASFVCSAAAATSPSQTDPTYYSYGESGNNQVP-GKLLLWDTKTMKQQLQFSLEPVP--IAVNCTAFNHNGNLLVTGAADGFIRLFDMQ--QHQCALSWKAHMG-EVYSVD---------FSYDENAVYSIGEDGKFIQWDIHKSGQKV-SEYSLPSDATGPFMLS--GYSGYKQVQFPRGRLF--AFDSEGKYMLTCSSTGGVIYKLNSDGSTLENCLSL-GGHRAPVVTVD 614          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Mouse
Match: Wwox (WW domain-containing oxidoreductase [Source:MGI Symbol;Acc:MGI:1931237])

HSP 1 Score: 111.309 bits (277), Expect = 3.267e-33
Identity = 70/219 (31.96%), Postives = 114/219 (52.05%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSL--FSPHNGVKCRVVWLSCESHR------AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWNYLTTKINQIKI 1178
            + ++V +AG  + P+ +++DG ET+FQVN L  FY+ ++L   L   SP      RV+ +S ESHR      +  +L+L  L+P   +Y    +Y  S LC IL     + +L    +  +        HPGN++Y ++I R   + K +F    PFTK++ Q AAT + C ++   +   G YFNN C C P+   QS+     LW  L+ ++ Q ++
Sbjct:  204 LHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSSP-----ARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSN------AVHPGNMMY-SAIHRNSWVYKLLFTLARPFTKSMQQGAATTVYCAVAPELEGLGGMYFNNCCRCLPSEEAQSEETARALWE-LSERLIQDRL 409          

HSP 2 Score: 52.373 bits (124), Expect = 3.267e-33
Identity = 39/164 (23.78%), Postives = 66/164 (40.24%), Query Frame = 2
Query:  119 DTESEYELPPGWT-KSINNGTIIYNNHIINISQLYSPLRDIKIH-KSDVCY---EKIRYNKSCGFRPPKERHKRFI------------------QKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTK 541
            DT+SE ELPPGW  ++  +G + Y NH    +Q   P    +     D+ Y   ++   N    F     +   ++                  Q++D  +T+ +++   + + K  LV G  SGIG E           +IL C NL +    +   L ++ K
Sbjct:   11 DTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHK 174          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Mouse
Match: Wwox (WW domain-containing oxidoreductase [Source:MGI Symbol;Acc:MGI:1931237])

HSP 1 Score: 73.9442 bits (180), Expect = 3.745e-22
Identity = 51/161 (31.68%), Postives = 84/161 (52.17%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSL--FSPHNGVKCRVVWLSCESHR------AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTL 1004
            + ++V +AG  + P+ +++DG ET+FQVN L  FY+ ++L   L   SP      RV+ +S ESHR      +  +L+L  L+P   +Y    +Y  S LC IL     + +L    +  +        HPGN++Y ++I R   + K +F    PFTK++
Sbjct:  204 LHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSSP-----ARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSN------AVHPGNMMY-SAIHRNSWVYKLLFTLARPFTKSM 352          

HSP 2 Score: 52.373 bits (124), Expect = 3.745e-22
Identity = 39/164 (23.78%), Postives = 66/164 (40.24%), Query Frame = 2
Query:  119 DTESEYELPPGWT-KSINNGTIIYNNHIINISQLYSPLRDIKIH-KSDVCY---EKIRYNKSCGFRPPKERHKRFI------------------QKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTK 541
            DT+SE ELPPGW  ++  +G + Y NH    +Q   P    +     D+ Y   ++   N    F     +   ++                  Q++D  +T+ +++   + + K  LV G  SGIG E           +IL C NL +    +   L ++ K
Sbjct:   11 DTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHK 174          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Mouse
Match: Wwox (WW domain-containing oxidoreductase [Source:MGI Symbol;Acc:MGI:1931237])

HSP 1 Score: 73.9442 bits (180), Expect = 4.381e-22
Identity = 51/161 (31.68%), Postives = 84/161 (52.17%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSL--FSPHNGVKCRVVWLSCESHR------AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTL 1004
            + ++V +AG  + P+ +++DG ET+FQVN L  FY+ ++L   L   SP      RV+ +S ESHR      +  +L+L  L+P   +Y    +Y  S LC IL     + +L    +  +        HPGN++Y ++I R   + K +F    PFTK++
Sbjct:  204 LHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSSP-----ARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSN------AVHPGNMMY-SAIHRNSWVYKLLFTLARPFTKSM 352          

HSP 2 Score: 52.373 bits (124), Expect = 4.381e-22
Identity = 39/164 (23.78%), Postives = 66/164 (40.24%), Query Frame = 2
Query:  119 DTESEYELPPGWT-KSINNGTIIYNNHIINISQLYSPLRDIKIH-KSDVCY---EKIRYNKSCGFRPPKERHKRFI------------------QKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTK 541
            DT+SE ELPPGW  ++  +G + Y NH    +Q   P    +     D+ Y   ++   N    F     +   ++                  Q++D  +T+ +++   + + K  LV G  SGIG E           +IL C NL +    +   L ++ K
Sbjct:   11 DTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHK 174          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Mouse
Match: Rdh11 (retinol dehydrogenase 11 [Source:MGI Symbol;Acc:MGI:102581])

HSP 1 Score: 70.0922 bits (170), Expect = 8.152e-14
Identity = 55/206 (26.70%), Postives = 95/206 (46.12%), Query Frame = 3
Query:  546 REIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYAL----SSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWN 1145
            + + L++ +AG+M  P+S + DGFE    VN L  F    +    L         R+V LS   H      +L  ++  + +   FYS  L    S L  IL  K    +LK   +        +  HPG V  ++ +TRY  I+++++  F  F KT  + A T + C ++   +S SG +F++  +   +  G+++I    LW+
Sbjct:  116 KHLHLLINNAGVMMCPYSKTADGFEMHIGVNHLGHFL---LTHLLLEKLKESAPSRIVNLSSLGH------HLGRIHFHNLQGEKFYSAGLAYCHSKLANILFTKELAKRLKGSGVTT------YSVHPGTV--HSELTRYSSIMRWLWQLFFVFIKTPQEGAQTSLYCALTEGLESLSGSHFSDCQLAWVSYQGRNEIIARRLWD 304          

HSP 2 Score: 28.1054 bits (61), Expect = 8.152e-14
Identity = 16/58 (27.59%), Postives = 27/58 (46.55%), Query Frame = 2
Query:  380 NLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTKISGN 553
             L  K A+V G  +GIG E    L  +   + L C ++ K +L  +    +   ++GN
Sbjct:   35 QLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELAAR----EIQAVTGN 88          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Mouse
Match: Rdh11 (retinol dehydrogenase 11 [Source:MGI Symbol;Acc:MGI:102581])

HSP 1 Score: 70.0922 bits (170), Expect = 1.052e-13
Identity = 55/206 (26.70%), Postives = 95/206 (46.12%), Query Frame = 3
Query:  546 REIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYAL----SSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWN 1145
            + + L++ +AG+M  P+S + DGFE    VN L  F    +    L         R+V LS   H      +L  ++  + +   FYS  L    S L  IL  K    +LK   +        +  HPG V  ++ +TRY  I+++++  F  F KT  + A T + C ++   +S SG +F++  +   +  G+++I    LW+
Sbjct:  100 KHLHLLINNAGVMMCPYSKTADGFEMHIGVNHLGHFL---LTHLLLEKLKESAPSRIVNLSSLGH------HLGRIHFHNLQGEKFYSAGLAYCHSKLANILFTKELAKRLKGSGVTT------YSVHPGTV--HSELTRYSSIMRWLWQLFFVFIKTPQEGAQTSLYCALTEGLESLSGSHFSDCQLAWVSYQGRNEIIARRLWD 288          

HSP 2 Score: 27.7202 bits (60), Expect = 1.052e-13
Identity = 16/58 (27.59%), Postives = 27/58 (46.55%), Query Frame = 2
Query:  380 NLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTKISGN 553
             L  K A+V G  +GIG E    L  +   + L C ++ K +L  +    +   ++GN
Sbjct:   19 QLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELAAR----EIQAVTGN 72          
BLAST of WW domain-containing oxidoreductase vs. UniProt/SwissProt
Match: sp|Q91WL8|WWOX_MOUSE (WW domain-containing oxidoreductase OS=Mus musculus OX=10090 GN=Wwox PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 2.005e-32
Identity = 70/219 (31.96%), Postives = 114/219 (52.05%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSL--FSPHNGVKCRVVWLSCESHR------AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWNYLTTKINQIKI 1178
            + ++V +AG  + P+ +++DG ET+FQVN L  FY+ ++L   L   SP      RV+ +S ESHR      +  +L+L  L+P   +Y    +Y  S LC IL     + +L    +  +        HPGN++Y ++I R   + K +F    PFTK++ Q AAT + C ++   +   G YFNN C C P+   QS+     LW  L+ ++ Q ++
Sbjct:  204 LHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSSP-----ARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSN------AVHPGNMMY-SAIHRNSWVYKLLFTLARPFTKSMQQGAATTVYCAVAPELEGLGGMYFNNCCRCLPSEEAQSEETARALWE-LSERLIQDRL 409          

HSP 2 Score: 52.373 bits (124), Expect = 2.005e-32
Identity = 39/164 (23.78%), Postives = 66/164 (40.24%), Query Frame = 2
Query:  119 DTESEYELPPGWT-KSINNGTIIYNNHIINISQLYSPLRDIKIH-KSDVCY---EKIRYNKSCGFRPPKERHKRFI------------------QKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTK 541
            DT+SE ELPPGW  ++  +G + Y NH    +Q   P    +     D+ Y   ++   N    F     +   ++                  Q++D  +T+ +++   + + K  LV G  SGIG E           +IL C NL +    +   L ++ K
Sbjct:   11 DTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHK 174          
BLAST of WW domain-containing oxidoreductase vs. UniProt/SwissProt
Match: sp|Q9NZC7|WWOX_HUMAN (WW domain-containing oxidoreductase OS=Homo sapiens OX=9606 GN=WWOX PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.755e-30
Identity = 67/220 (30.45%), Postives = 112/220 (50.91%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR------AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWNYLTTKINQIKIVNQ 1187
            + ++V +A   + P+S+++DG ET+FQVN L  FY+ ++L   L         RV+ +S ESHR      ++ +L+   L+P+  +Y    +Y  S LC IL     + +L    +  +        HPGN++Y ++I R   +   +F    PFTK++ Q AAT + C      +   G YFNN C C P+   QS+     LW  L+ ++ Q ++ +Q
Sbjct:  204 LHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLC---RSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSN------AVHPGNMMY-SNIHRSWWVYTLLFTLARPFTKSMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLW-ALSERLIQERLGSQ 412          

HSP 2 Score: 50.8322 bits (120), Expect = 1.755e-30
Identity = 37/164 (22.56%), Postives = 66/164 (40.24%), Query Frame = 2
Query:  119 DTESEYELPPGWT-KSINNGTIIYNNHIINISQLYSPLRDIKIH-KSDVCY---EKIRYNKSCGFRPPKERHKRFI------------------QKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTK 541
            DT+SE ELPPGW  ++  +G + Y NH    +Q   P    +     D+ Y   ++   N    F     +   ++                  Q++D  +T+ +++   + + K  +V G  SGIG E           +IL C N+ +    +   L ++ K
Sbjct:   11 DTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHK 174          
BLAST of WW domain-containing oxidoreductase vs. UniProt/SwissProt
Match: sp|Q5R9W5|WWOX_PONAB (WW domain-containing oxidoreductase OS=Pongo abelii OX=9601 GN=WWOX PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.970e-30
Identity = 66/220 (30.00%), Postives = 113/220 (51.36%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR------AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWNYLTTKINQIKIVNQ 1187
            + ++V +A   + P+S+++DG ET+FQVN L  FY+ ++L   L         RV+ +S ESHR      ++ +L+   L+P+  +Y    +Y  S LC +L     + +L    +  +        HPGN++Y ++I R   +   +F    PFTK++ Q AAT + C  +   +   G YFNN C C P+   QS+     LW  L+ ++ Q ++ +Q
Sbjct:  204 LHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLC---RSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNVLFSNELHRRLSPRGVTSN------AVHPGNMMY-SNIHRSWWVYTLLFTLARPFTKSMQQGAATTVYCAAAPELEGLGGMYFNNCCRCMPSPEAQSEETARTLW-ALSERLIQERLGSQ 412          

HSP 2 Score: 50.0618 bits (118), Expect = 1.970e-30
Identity = 39/168 (23.21%), Postives = 64/168 (38.10%), Query Frame = 2
Query:  119 DTESEYELPPGWT-KSINNGTIIYNNHIINISQLYSPLRDIKIHKSDVCYEKIRY------------------NKSCGFRPPK--------ERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTK 541
            DT+SE ELPPGW  ++  +G + Y NH    +Q   P    K  K       + Y                  NK   +  P+               Q++D  +T+ +++   + + K  +V G  SGIG E           +IL C N+ +    +   L ++ K
Sbjct:   11 DTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHP----KTGKRKRVAGDLPYGWEQGTDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTALEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHK 174          
BLAST of WW domain-containing oxidoreductase vs. UniProt/SwissProt
Match: sp|Q05B30|WDR91_XENTR (WD repeat-containing protein 91 OS=Xenopus tropicalis OX=8364 GN=wdr91 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 7.815e-29
Identity = 174/754 (23.08%), Postives = 332/754 (44.03%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKK-KSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLWXXXXXXXXXXXXXQV-----VRSVMSYDSDLENYFSLDMRLENCINQITTKEPDMIKQKYNLTDSNAGKSQIISQV---ISNLHGSGRTLHDVSDLLCDFRLTRENKQIEYRRASKSNKPKGI--SLIIQNKTKSTSPNTFLRKKAVPFINVENVDAKDIIWKGEAKDTLTKIDEQSN-QSSPNLADLDNS-VSMIE-----NSINSTVIGNIAPQASSEIN-KNSSAD---------------SFGIKQFSSKISQKIFKPKLSITTTAPKVTVFHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXXXXXXXXXXXA-----------LPHGVISLYDAESW-SAIQTNLITLKSDFTVNCMYC--SSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKIN--GTTLLDSVYLNAGHNSPVICID 3468
            +K+ L+ + + NTL  F  + K D+ K  +    V+ L   +Q+ DL+ L++ W   E   F  L+   + T   +K+ +F+ +LV   ++ +T+K + FFQ   T  L ++ EW +WF  P +  P  ++ F  YF+R W D F +S+ NF   +     V  ++++ SD +    L  + EN I  +  K   +  + Y L      +  ++ ++   +SN+   G      S+L  +   +  N  +     + S +  G   SL+ QNK K   P + L   + P  +  +V  K  +   +A+     +      +SSPN+  +  +  SM++           ++   A Q S+E   +NS AD               + G     ++  +K  +P + ++        + EH S + H +    S    ASLDV G  KIW+++         +S K  + S +W ++   ++LLG++ G+V++YD    + + E+ I    PRI  +    S + FVC +   +  + ++             +P G + L+D ++    +Q +L  +     VNC     + N +  G ++G I+L D++  ++    S     G EV +V           ++D N +  +    +   +D+    + +  E S  +D   P   +   Y G + + FPR  L   A+ +    + + +  G ++ K+N  G+TL + + L  GH +PV+ +D
Sbjct:   12 VKEYLTFRGFTNTLKYFEVDIKADKDKGFRVDRIVEQLLQFVQSYDLNGLVEYWAYLERRLFSRLEDVYRPTIHKLKTSLFRYYLVYTIQSSRTDKAHEFFQKQAT-ELQNQAEWKEWFALPFLPTPDSNRTFSTYFSRQWADTFTVSLHNFLSVLFQCMPVPKILTFQSDYQKIACL--QEENEI--MRQKLFALQAETYRLRKDGPSEPLVLHKLPHYVSNMDRLGD-----SELGSNIMSSHSNTNMN----TPSQRTSGFLSSLLAQNK-KPPPPKSTLPSVSSPTQSGGSVPLKKEVAVSQAQKAKELVGGTKEVRSSPNILGVPGTESSMVQQRHKRQQERKELLSKTASQVSTEKKAENSDADPDLRSDTQNDTVDAVTRGSGASGARKEEKPAQPFIVLSQDE-----YAEHHSSIMHCRVD-CSGRRVASLDVDGVIKIWSLDGIMQTKASAIS-KSALLSLEWATKRDRLLLLGSEVGTVRLYDTEAKKNLCEIGIVEDMPRILSLACSPSGASFVCSAAAATSPSQTDPTYYSYGESGNNQVP-GKLLLWDTKTMKQQLQFSLEPVP--IAVNCTAFNHNGNLLVTGAADGFIRLFDMQ--QHQCALSWKAHMG-EVYSVD---------FSYDENAVYSIGEDGKFIQWDIHKSGQKV-SEYSLPSDATGPFMLSG--YSGYKQVQFPRGRLF--AFDSEGKYMLTCSSTGGVIYKLNSDGSTLENCLSL-GGHRAPVVTVD 722          
BLAST of WW domain-containing oxidoreductase vs. UniProt/SwissProt
Match: sp|Q9VLU5|WWOX_DROME (WW domain-containing oxidoreductase OS=Drosophila melanogaster OX=7227 GN=Wwox PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 9.352e-28
Identity = 71/206 (34.47%), Postives = 110/206 (53.40%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR----AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLW 1142
            Q    ID ++ +AG+ + P++ + DG ET+FQV+ LS FY+  + L +LF      K R++ LS ESHR     ++ L +  L+P  ++Y    +Y  + LC +L  +    +W      R    F  HPGN+V ++ ++R     + +F    PFTK+L QAAAT I C  +N     SG YFNN   C+P+ L +S    + LW
Sbjct:  198 QSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLT-LQLETLFD----YKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWK----QRGISVFSLHPGNMV-SSDLSRNYWFYRLLFAIVRPFTKSLQQAAATSIYCATANELTGLSGLYFNNCFFCEPSKLSKSAALQQQLW 393          
BLAST of WW domain-containing oxidoreductase vs. TrEMBL
Match: A0A154PPU7 (WW domain-containing oxidoreductase OS=Dufourea novaeangliae OX=178035 GN=WN55_06275 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 8.024e-39
Identity = 79/221 (35.75%), Postives = 123/221 (55.66%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR-----AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWNYLTTKINQIKIVN 1184
            QK+  + +++ +AG+ + P+ ++EDG+ET+FQVN LS FY   +L   + S HN    RVV +S ESHR      +++ +   L+P + +Y    +Y  S LC IL  +    +W S+        F CHPGN+V ++S++RY  IL+F+F    PFTK+L QAA+T + C  +   +  +G YFNN   CDP+           LW+     ++Q  IVN
Sbjct:  195 QKYGTLHILILNAGVFAIPYELTEDGYETTFQVNHLSHFYFTLLLEHPIRSCHN---ARVVVVSSESHRFSTLQTVEDFHQLNLSPPAYKYWFMGAYNDSKLCNILFTQELAKRWPSVSV------FSCHPGNMV-SSSLSRYSWILRFLFMLVRPFTKSLQQAASTSVFCATAPELEGVTGVYFNNCYCCDPSTTALDSALARRLWS-----VSQEMIVN 400          

HSP 2 Score: 54.6842 bits (130), Expect = 8.024e-39
Identity = 43/150 (28.67%), Postives = 67/150 (44.67%), Query Frame = 2
Query:  119 DTESEYELPPGWTKSIN-NGTIIYNNHIINISQLYSPLRD-IKIHKSDV--CYEK-----------IRYNKSCGFRPPK--------ERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIK 499
            D++SE ELPPGW +    +G + Y NH    +Q   P     KI + ++   +E+              N++  +  P+        E  +   Q+FD  ST+  V+   +L  K A+V G  +GIG E    L    C +IL C +L K
Sbjct:    7 DSDSEDELPPGWEEMTTIDGNVYYVNHYTKGTQWTHPRTGRQKIVEGELPSGWERRVTDDGKVLFVDHMNRTTTYSDPRLAFATEYRELSQPVRQRFDGSSTALAVLYGRDLRGKVAIVTGANTGIGFETARSLALHGCKVILTCRDLKK 156          
BLAST of WW domain-containing oxidoreductase vs. TrEMBL
Match: A0A151X589 (WW domain-containing oxidoreductase OS=Trachymyrmex zeteki OX=64791 GN=ALC60_05629 PE=4 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.897e-38
Identity = 74/207 (35.75%), Postives = 118/207 (57.00%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR-----AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLW 1142
            QKF+ +D+++ +AG+   P+ +++DG+ET+FQVN LS FY+  +L  ++ S +N    R+V +S ESHR      I++L+   L+  + +Y    +Y  S LC IL V+    +W S+        F CHPGN+V+ TS++R+  + + +F    PFTK+L QAA+T I C  +   +  +G YFNN C C P+           LW
Sbjct:  194 QKFKFLDILILNAGVFGLPYQLTKDGYETTFQVNHLSQFYLTLLLKQTIQSSNNP---RIVVVSSESHRFSSIQTIEDLHQLTLSLPAYKYWAMAAYNESKLCNILFVQELARQWPSVGV------FACHPGNLVF-TSLSRHWWLYRLLFALARPFTKSLQQAASTIIFCATAPELEGVTGSYFNNCCHCQPSNAALDSALAAQLW 390          

HSP 2 Score: 58.151 bits (139), Expect = 1.897e-38
Identity = 46/156 (29.49%), Postives = 73/156 (46.79%), Query Frame = 2
Query:  119 DTESEYELPPGWT-KSINNGTIIYNNHIINISQLYSPLRDIK-IHKSDV--CYE-------KIRY----NKSCGFRPPK--------ERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELK 517
            D++SE ELPPGW  ++  +G + Y NH    +Q   P    K I   D+   +E       K+ Y    N++  +  P+        E  +   Q+FD  ST+  V++  +L  K ALV G  +GIG E    L    C +IL C ++ K +  ++
Sbjct:    6 DSDSEDELPPGWEERTTLDGNVYYVNHYTKGTQWTHPRTGRKKIVNGDLPPGWERCISDDGKVLYIDHTNRTTTYTDPRLAFATEYREMSQIIRQRFDGSSTALAVLHGRDLRNKVALVTGANTGIGYETARSLALHGCNVILACRDMEKANEAIR 161          
BLAST of WW domain-containing oxidoreductase vs. TrEMBL
Match: A0A0N0BGS5 (WW domain-containing oxidoreductase OS=Melipona quadrifasciata OX=166423 GN=WN51_13253 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.966e-38
Identity = 72/195 (36.92%), Postives = 115/195 (58.97%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR-----AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTL 1106
            QK+R +++++ +AGI + P+ +++DG+ET+FQVN LS FY   +L   + S     K RVV +S ESHR      I++ +   L+P + +Y    +Y  S LC IL  +    +W S++       F CHPGN+V ++S++RY   L+F+F    PFTK+L QAA+T + C  +   +  + CYFNN   C P++
Sbjct:  194 QKYRVLNILILNAGIFAIPYQLTKDGYETTFQVNYLSQFYFTLLLEHPIRSCR---KSRVVIVSSESHRFSSLQTIEDFHQLILSPPAYKYWYMEAYNNSKLCNILFAQELANRWPSVNV------FSCHPGNMV-SSSLSRYSWTLRFLFMLVRPFTKSLQQAASTSVFCATAPELEGVTKCYFNNCYYCIPSI 378          

HSP 2 Score: 62.7734 bits (151), Expect = 2.966e-38
Identity = 44/154 (28.57%), Postives = 67/154 (43.51%), Query Frame = 2
Query:  119 DTESEYELPPGWTK-SINNGTIIYNNHIINISQLYSPL--------------------RDIKI----HKSDVCYEKIRYNKSCGFRPPKERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCD 505
            D++SE ELPPGW + + N G + Y NH    +Q   P                      D ++    HK+   Y   R   +  +R   E  +   Q+FD  ST+  V++  +L  K A+V G  +GIG E    L    C ++L C +L K +
Sbjct:    7 DSDSEDELPPGWEEMTTNTGNVYYVNHYTKGTQWTHPRTGRTKIVEGELPSGWKKCVSEDGQVLFVHHKNTTTYTDPRLAFATEYR---ESSQPVRQRFDGSSTALSVLHGRDLRNKIAIVTGANTGIGFETARSLALHGCKVVLACRDLKKAE 157          
BLAST of WW domain-containing oxidoreductase vs. TrEMBL
Match: A0A195DRL7 (WW domain-containing oxidoreductase OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_12686 PE=4 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 5.558e-38
Identity = 73/207 (35.27%), Postives = 119/207 (57.49%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR-----AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLW 1142
            QKF+ +D+++ +AG+   P+ +++DG+ET+FQVN LS FY+  +L  ++ S +N    R+V +S ESHR     ++++L+   L+  + +Y    +Y  S LC IL V+    +W S+        F CHPGN+V +TS++R+  + + +F    PFTK+L QAA+T I C  +   +  +G YFNN C C P+           LW
Sbjct:  194 QKFKFLDILILNAGVFGLPYQLTKDGYETTFQVNHLSQFYLTLLLKQTIQSSNNP---RIVVVSSESHRFSSIRSVEDLHQLTLSVPAYKYWAMAAYNESKLCNILFVQELARQWPSVGV------FGCHPGNLV-STSLSRHWWLYRLLFALARPFTKSLQQAASTIIFCATAPELEGVTGSYFNNCCHCQPSNAALDSALAAQLW 390          

HSP 2 Score: 58.5362 bits (140), Expect = 5.558e-38
Identity = 46/156 (29.49%), Postives = 73/156 (46.79%), Query Frame = 2
Query:  119 DTESEYELPPGWT-KSINNGTIIYNNHIINISQLYSPLRDIK-IHKSDV--CYE-------KIRY----NKSCGFRPPK--------ERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELK 517
            D++SE ELPPGW  ++  +G + Y NH    +Q   P    K I   D+   +E       K+ Y    N++  +  P+        E  +   Q+FD  ST+  V++  +L  K ALV G  +GIG E    L    C +IL C ++ K +  ++
Sbjct:    6 DSDSEDELPPGWEERTTLDGNVYYVNHYTKGTQWMHPRTGRKKIVNGDLPSGWERCISDDGKVLYIDHTNRTTTYTDPRLAFATEYREMSQIIRQRFDGSSTALAVLHGRDLRNKVALVTGANTGIGYETARSLALHGCNVILACRDMEKANEAIR 161          
BLAST of WW domain-containing oxidoreductase vs. TrEMBL
Match: A0A088A8B9 (Uncharacterized protein OS=Apis mellifera OX=7460 GN=Wwox PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 8.127e-38
Identity = 78/221 (35.29%), Postives = 123/221 (55.66%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR-----AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWNYLTTKINQIKIVN 1184
            QK+R + +++ +AG+ + P+ +++DG+ET+FQVN LS FY   +L   + S HN    RVV +S ESHR      +++ +   L+P + +Y    +Y  S LC IL  +     W S++       F CHPGN+V ++S++RY   L+ +F    PFTK+L QAA+T I C  +   +  +GCYFNN   CDP+           LW+     ++Q  I+N
Sbjct:  195 QKYRTLHILILNAGVFAIPYQLTKDGYETTFQVNHLSQFYFTLLLEHPIRSCHNS---RVVIVSSESHRFSSLRTVEDFHQLSLSPPAYKYWFMGAYNNSKLCNILFAQELAKYWPSVNV------FSCHPGNMV-SSSLSRYSWTLRLLFMLVRPFTKSLQQAASTSIFCATAPELEGVTGCYFNNCYRCDPSNAALDSALATRLWS-----VSQEMIIN 400          

HSP 2 Score: 53.9138 bits (128), Expect = 8.127e-38
Identity = 39/150 (26.00%), Postives = 63/150 (42.00%), Query Frame = 2
Query:  119 DTESEYELPPGWTK-SINNGTIIYNNHIINISQLYSPL--------------RDIKIHKSDVCYEKIRYNKSCGFRPPK--------ERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIK 499
            +++SE ELPPGW + +  NG + Y NH    +Q   P                + ++ +          N +  +  P+        E      Q+FD  ST+  V++  +L  K A+V G  +GIG E    L    C +I+ C +L K
Sbjct:    7 ESDSEDELPPGWEEMTTANGNVYYVNHYTKGTQWTHPRTGRTKTVEGELPSGWERRVAEDGQVLFVDHINHTTTYTDPRLAFATEYRELSHPMRQRFDGSSTALSVLHGRDLRGKIAIVTGANTGIGFETARSLALHGCTVIIACRDLKK 156          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Cavefish
Match: wdr91 (WD repeat domain 91 [Source:NCBI gene;Acc:103023610])

HSP 1 Score: 129.413 bits (324), Expect = 2.959e-30
Identity = 172/762 (22.57%), Postives = 301/762 (39.50%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKK-KSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLWXXXXXXXXXXXXXQVVRSVMSYDSDLENYFSLDMRLENCINQITTKEPDMIKQKYNLTDSNA--GKSQIISQVISNLHGSGRT--------------------LHDVSDLLCDFRLTRENKQIEYRRASKSNKPKGISLIIQNKTKSTSPNTFLRKKAVPFINVENVDAKDIIWKGEAKDTLTKIDEQSNQSSPNLADLDNSVSMIENSINSTVIGNIAPQASSEINKNSSADSFGIKQFSSKISQKIFKPKLSITTTAPKVTVFHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXX------XXXXXXXXXALP-HGVISLYDAESWSAIQTNLITLKSDFTVNCMYC--SSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSH--LNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKIN-GTTLLDSVYLNAGHNSPVICIDSYPYDLEDSDNVVVLSGTMEGTI 3537
            +++ L  + + + L     E K D+ K  +    +D LQ+ IQT DL  L + W   +   F  L+   + T + +++ +F+ +LV   +N+  EK   FFQ      L  + EW DWF  P +  P ++  F  YF+  W D                  ++   L N+ S+   L  CI+ I   +P ++     +  S +   +S+ + Q++  L G  +                     L D  DL+   R T  N     R    +  P+G       +T    P +   + A   +  ++  A  +  +G  K    K D    +  P     D+                     +++    S     G++Q   K+SQ+ +                 EH S + H +    S    ASLDV G  K+W+ N P  ++  T+  K  + S +W ++   ++LLG+  G+V++YD    + + EM ID A PRI  +    S + FVC +                ++LP  G + L+D ++    Q           VNC     + N +  G ++G I+L D++  E  +  S    +G EV +V           ++D N +  +    +   F   N  +S  K+S +    D V P   +   Y G + +  PR  L   A+ +    + + +  G L+ ++N G   L+SV    GH +PV+ +D         D    L+ +M+G I
Sbjct:   12 VREYLIYRGFTSALKHLDSEIKSDKEKGFRVDKIIDQLQHFIQTYDLAGLKEYWGYLDRRLFSRLEDVYRPTVNKLRTSLFRYYLVHTIQNQ--EKTQEFFQKQAA-ELQGQAEWRDWFVLPFIPVPEQNPAFSPYFSLQWAD------------------TFLVSLHNFLSV---LFQCISLIFPPQPVLLSFDAEVQRSTSIQEESEQLRQMLFALQGESKAKKAEEMVHHKLPAYVQHMDRLGDTEDLVTSQRAT--NPITPSRNFFSTFLPQGRR--TPARTPQGPPGSSPTQAA---LGRKDPTAGQVRVRGSEK----KADSSDTEGQPETDTTDS--------------------PTNQTRSGSEVGGPGVEQPFIKLSQEEYG----------------EHHSSIMHCRVD-CSGRRVASLDVDGVVKVWSFN-PIMQTKATIMSKSPLLSLEWATKPDRLLLLGSGVGTVRLYDTEAKKNLYEMTIDDAHPRILSLAYSPSGTSFVCSAAANVSRPGSVTEMMPRASLPVSGQLLLWDTKTVKQ-QLQFALEPGPVAVNCTAFNHNGNLLVTGAADGWIRLFDMQRYE--SVMSWKAHDG-EVYSV---------EFSYDENTVFSIGEDGK---FIQWNIHRSGVKQSEYSLSQDAVGPFVLSG--YSGYKQVQVPRGRLF--AFDSEGQHVLTCSSTGGLIYRLNKGEAGLESVLSLGGHKAPVVTVDW----CSAVDCGTCLTASMDGKI 676          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Cavefish
Match: wdr91 (WD repeat domain 91 [Source:NCBI gene;Acc:103023610])

HSP 1 Score: 90.1225 bits (222), Expect = 6.690e-18
Identity = 92/357 (25.77%), Postives = 157/357 (43.98%), Query Frame = 1
Query: 2503 FHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXX------XXXXXXXXXALP-HGVISLYDAESWSAIQTNLITLKSDFTVNCMY--CSSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSH--LNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKIN-GTTLLDSVYLNAGHNSPVICIDSYPYDLEDSDNVVVLSGTMEGTI 3537
            + EH S + H +    S    ASLDV G  K+W+ N P  ++  T+  K  + S +W ++   ++LLG+  G+V++YD    + + EM ID A PRI  +    S + FVC +                ++LP  G + L+D ++    Q           VNC     + N +  G ++G I+L D++  E  +  S    +G EV +V           ++D N +  +    +   F   N  +S  K+S +    D V P   +   Y G + +  PR  L   A+ +    + + +  G L+ ++N G   L+SV    GH +PV+ +D         D    L+ +M+G I
Sbjct:  388 YGEHHSSIMHCRVD-CSGRRVASLDVDGVVKVWSFN-PIMQTKATIMSKSPLLSLEWATKPDRLLLLGSGVGTVRLYDTEAKKNLYEMTIDDAHPRILSLAYSPSGTSFVCSAAANVSRPGSVTEMMPRASLPVSGQLLLWDTKTVKQ-QLQFALEPGPVAVNCTAFNHNGNLLVTGAADGWIRLFDMQRYE--SVMSWKAHDG-EVYSV---------EFSYDENTVFSIGEDGK---FIQWNIHRSGVKQSEYSLSQDAVGPFVLSG--YSGYKQVQVPRGRLF--AFDSEGQHVLTCSSTGGLIYRLNKGEAGLESVLSLGGHKAPVVTVDW----CSAVDCGTCLTASMDGKI 718          

HSP 2 Score: 68.9366 bits (167), Expect = 2.834e-11
Identity = 40/141 (28.37%), Postives = 67/141 (47.52%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKK-KSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLW 1776
            +++ L  + + + L     E K D+ K  +    +D LQ+ IQT DL  L + W   +   F  L+   + T + +++ +F+ +LV   + K  EK   FFQ      L  + EW DWF  P +  P ++  F  YF+  W
Sbjct:   12 VREYLIYRGFTSALKHLDSEIKSDKEKGFRVDKIIDQLQHFIQTYDLAGLKEYWGYLDRRLFSRLEDVYRPTVNKLRTSLFRYYLVHTIQMKNQEKTQEFFQKQAA-ELQGQAEWRDWFVLPFIPVPEQNPAFSPYFSLQW 151          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Cavefish
Match: zgc:153441 (retinol dehydrogenase 12-like [Source:NCBI gene;Acc:103027802])

HSP 1 Score: 83.9593 bits (206), Expect = 8.336e-17
Identity = 57/206 (27.67%), Postives = 98/206 (47.57%), Query Frame = 3
Query:  549 EIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKY--SKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRY----QPILKFIFWFFSP-FTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWN 1145
             +D+++ +AG+M  P S++EDG+ET F VN L  F    + +  L    N    R++ +S  +H+  K ++  +LN +   YN   SY  S L  +L  +    ++K   +        F  HPG  V  T + RY     P++  +    +    KT  Q A T I C I+   + ++GCYF++  + +P L  +  +    LW+
Sbjct:  132 RLDILINNAGVMMCPHSLTEDGYETQFAVNHLGHFL---LTVLLLDMLKNSTPSRIINVSSIAHKGGK-IHFDDLNFNKTPYNSLISYRQSKLANVLFTRELSRRIKGSGVTA------FAVHPG--VIRTELGRYVEMRHPVVSTLLSLPAILLMKTPKQGAQTTIYCTITEGLEKYNGCYFSDCRMMEPALEAKDDLAAMRLWD 325          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Cavefish
Match: zgc:153441 (retinol dehydrogenase 12-like [Source:NCBI gene;Acc:103027802])

HSP 1 Score: 83.9593 bits (206), Expect = 9.279e-17
Identity = 57/206 (27.67%), Postives = 98/206 (47.57%), Query Frame = 3
Query:  549 EIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKY--SKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRY----QPILKFIFWFFSP-FTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWN 1145
             +D+++ +AG+M  P S++EDG+ET F VN L  F    + +  L    N    R++ +S  +H+  K ++  +LN +   YN   SY  S L  +L  +    ++K   +        F  HPG  V  T + RY     P++  +    +    KT  Q A T I C I+   + ++GCYF++  + +P L  +  +    LW+
Sbjct:  126 RLDILINNAGVMMCPHSLTEDGYETQFAVNHLGHFL---LTVLLLDMLKNSTPSRIINVSSIAHKGGK-IHFDDLNFNKTPYNSLISYRQSKLANVLFTRELSRRIKGSGVTA------FAVHPG--VIRTELGRYVEMRHPVVSTLLSLPAILLMKTPKQGAQTTIYCTITEGLEKYNGCYFSDCRMMEPALEAKDDLAAMRLWD 319          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Cavefish
Match: rdh12l (retinol dehydrogenase 12-like [Source:NCBI gene;Acc:103044420])

HSP 1 Score: 73.1738 bits (178), Expect = 2.190e-13
Identity = 53/206 (25.73%), Postives = 100/206 (48.54%), Query Frame = 3
Query:  546 REIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSL--FSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRY-QPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEM---LWN 1145
            +++++++ +AG+M  P+  + DGFE    VN +  F +  +L+  +   SP      R+V +S  +H+    +N+ ++N S + Y+   +Y+ S L  +L  +      D          +V HPG  V  T + R+     + + W   PFTKT  Q A T I C ++   ++ SG Y+++   C P     + ++ +M   LW+
Sbjct:   97 KQVNILINNAGVMVCPYGKTADGFEMQIGVNHMGHFLLTFLLMDLIKKSSP-----ARIVNVSSMAHK-WGTINIDDIN-SEKSYDKSKAYSQSKLANVLFTRCLAKHLDGTGV----TVYVLHPG--VVQTELWRHLNRAQQGVMWMVKPFTKTSVQGAQTTIYCAVAPELETESGKYYSD---CAPASCSNAAMDDDMAKRLWD 286          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Sea Lamprey
Match: wdr91 (WD repeat domain 91 [Source:NCBI gene;Acc:402898])

HSP 1 Score: 80.8777 bits (198), Expect = 9.234e-16
Identity = 79/360 (21.94%), Postives = 161/360 (44.72%), Query Frame = 1
Query: 2503 FHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXXXXXX------XXXXXALPHGVISLYDAESWSAIQTNLITLKSD-FTVNCMY--CSSNTIFAGCSNGSIKLIDIRVPENYNT-NSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPY-----GGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKINGTTLLDSVYLNAGHNSPVICIDSYPYDLEDSDNVVVLSGTMEGTI 3537
            + EH S + H K    S S  AS+DV G  K+W+ + P+ ++  T+  K  + S +W ++   ++LLG+  GSV+ YD  + + V ++ +D+A+PR+  +    +   FVC +   +         ++  +   G +SL+DA++    Q +L TL  +   + C+    + N +  G ++G I+L D+   + Y+   S     G+       +C  ++S    D   +  + +  +   + ++     + +   H +        A  P+      G +  + PR  L +    +  + L  +A  GI+ +  +G+  L       GH +PV+ ++         D  + L+ +M+G I
Sbjct:  353 YSEHHSPIMHCKFD-ASGSRVASVDVDGVVKVWSCS-PTPQTHTTVMAKSPLLSLEWATKPHRLLLLGSGIGSVRFYDTDQKKSVADVTLDMAYPRVLALACSPTGGSFVCGAAASAHGNGTSPPEAAGGSATRGQLSLWDAKTLR--QQHLFTLDPEPVAITCVSFNHNGNLLVCGATDGLIRLYDV---QRYDCLMSWRAHHGE-------VCSVEFS---GDETGVFSMGADGKFTQWHLQREGARVAELEVHAD--------AAGPFEVCGCSGYKQTHAPRGRLFAFEPSSGQHVLTCSAHGGIVYRLESGS--LSPCLTLGGHRAPVVTVEW----TTAMDCGMCLTASMDGKI 681          

HSP 2 Score: 69.3218 bits (168), Expect = 4.108e-12
Identity = 38/145 (26.21%), Postives = 67/145 (46.21%), Query Frame = 1
Query: 1357 IKQILSIKEYKNTLHSFFEEEKIDRPKKKSRYFVDIL-----QNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLW 1776
            ++  L  + +  TL ++  E + DR    S   VD +     Q  + + DL SL  +W   E   F  L+     T   +++ + +A++    +  + +K   FFQ +G  +  S +EW +WF  P + +P  H  F  YFT+ W
Sbjct:   12 VRDFLVFRGFAATLRAYEAELRGDR---DSGARVDTISLPPSQLCVSSLDLQSLRDLWAHLEKRLFSRLEHAHLLTTCKLRTGVLRAYVAHSVQAGRPDKTLEFFQRVGPELHGS-SEWREWFALPFLPSPETHSTFSAYFTKQW 152          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Sea Lamprey
Match: rdh14b (retinol dehydrogenase 14b [Source:ZFIN;Acc:ZDB-GENE-030131-6605])

HSP 1 Score: 56.225 bits (134), Expect = 1.874e-8
Identity = 49/187 (26.20%), Postives = 86/187 (45.99%), Query Frame = 3
Query:  549 EIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRY-------QPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNN 1082
             +D++V +AG+   P++++EDGFET F VN L  F +  +LL  L         RVV +S   ++  + +N  +L  S + Y+   +Y  S L  ++  +    +L+   +  +        HPG  V  T++ R+       +P+   + W  + F +T  Q A T +    S      SG YF +
Sbjct:  134 RLDVLVNNAGVFRCPYALTEDGFETQFGVNHLGHFLLTALLLPLL---GRSAPSRVVVVSSALYKQGR-INFDDL-ASERSYDPAAAYGRSKLANVMFARELARRLRGQGVTAN------ALHPG--VVRTNLGRHVSMPALARPLFNLLAW--AAF-RTPEQGARTAVFLAASPDVADVSGAYFGD 304          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Yeast
Match: ENV9 (Protein proposed to be involved in vacuolar functions; mutant shows defect in CPY processing and defects in vacuolar morphology; has similarity to oxidoreductases, found in lipid particles; required for replication of Brome mosaic virus in S. cerevisiae, a model system for studying replication of positive-strand RNA viruses in their natural hosts [Source:SGD;Acc:S000005772])

HSP 1 Score: 50.447 bits (119), Expect = 8.378e-7
Identity = 52/194 (26.80%), Postives = 83/194 (42.78%), Query Frame = 3
Query:  549 EIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYN-----GFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQ---PILKFIFWFFSP-----FTKTLSQAAATPILCCISN--SFKSFSGCYFNNG 1085
             ID++V +AGIM+ P  +++DGFE   Q N +S F     LL  L       + R++ LS   H    E    +L+  + +Y       ++ YA+S    I   K   +K+  + C         HPG +V NT++  Y    PI+   FW         F  +  Q +   + C +    S +  +G YF  G
Sbjct:  117 HIDVLVNNAGIMAVPLEMTKDGFEVQLQTNYISHFIFTMRLLPLL----RHCRGRIISLSSIGHHL--EFMYWKLS-KTWDYKPNMLFTWFRYAMSKTALIQCTKMLAIKYPDVLC------LSVHPG-LVMNTNLFSYWTRLPIVGIFFWLLFQVVGFFFGVSNEQGSLASLKCALDPNLSVEKDNGKYFTTG 296          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Nematostella
Match: EDO32533 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS7])

HSP 1 Score: 76.6406 bits (187), Expect = 1.140e-23
Identity = 60/220 (27.27%), Postives = 98/220 (44.55%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR-----AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKY--SKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWNYLTTKINQIK 1175
            +K   + ++V +AG++  P+  + D  E +F VN L  F + ++L   L S       R+V LS ESHR        +L++  +  S  +Y+   +Y  S LC I++      +L  + + C+        HPGN++Y TS+         IF     F KT  QAA+T + C +S       G YF N   C+P++          LW      +  +K
Sbjct:  209 KKSMPLHVLVCNAGVLGGPWRCTGDNIEYTFAVNYLGHFLLIKLLQDVLCS---SSPARIVMLSSESHRFQDLNYSDKLHISTVPLSRDKYHSILAYNQSKLCSIMLSMELNRRLSSEGVTCN------AVHPGNLIY-TSLYGKSWCYWLIFRIARLFAKTPEQAASTVVYCAVSPELNGVGGQYFINCRPCEPSVEAADPDKARALWTLSERLVTSLK 418          

HSP 2 Score: 53.1434 bits (126), Expect = 1.140e-23
Identity = 39/150 (26.00%), Postives = 62/150 (41.33%), Query Frame = 2
Query:  116 SDTESEYELPPGW-TKSINNGTIIYNNHIINISQLYSP----LRDI-----------KIHKSDVCYEKIRYNKSCGFRPPKERHK-----RFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKC 502
            S  +S+ ELP  W  ++ + G + Y NH+   +Q   P    +R +              K DV Y     N    F  P+   +        QK+D+ ST+  V+   NL  +  +V G  SGIGL   S L      +++ C ++ K 
Sbjct:   23 SSQDSDEELPVEWEVRTTDTGRVYYANHLTKTTQWQHPKTGKIRKVTGALPPGWLKQSDGKGDVFYINT-VNHQTTFTDPRSSKESTSCINISQKYDASSTTYDVLKDENLDGRVVMVTGASSGIGLATASALAAHGAHVVMACRDMEKA 171          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Nematostella
Match: EDO36070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJM9])

HSP 1 Score: 80.4925 bits (197), Expect = 9.493e-18
Identity = 60/209 (28.71%), Postives = 97/209 (46.41%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSP----FTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWN 1145
            +K   +D+++ +AG+   PF  +EDGFE  F VN LS F    +    L         R++ +S +SH    E++  + N  S+ Y+    YA S L  +L  +    +LK      D     +  HPG ++  T + R  P  KFI  F  P    F K+L Q A T I C +S    + +G Y+++  + +P+   Q     + LW+
Sbjct:  112 KKEERVDILMNNAGVAWIPFKRTEDGFEMMFGVNHLSHFL---LTNLLLDKLKRSAPSRIINVSSKSHLFTSEIDFVDWNDESK-YSMLSRYANSKLANVLFARELAKRLK------DTGVTTYSLHPGTIM--TDLGRDIPGGKFIKVFLWPIQKVFFKSLEQGAQTQICCAVSEEHANETGLYYDDCQVTEPSKAAQDDEAAKKLWD 308          

HSP 2 Score: 29.261 bits (64), Expect = 9.493e-18
Identity = 13/39 (33.33%), Postives = 19/39 (48.72%), Query Frame = 2
Query:  377 ANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNL 493
            A L  K  ++ G  +GIG E    L  +   +I+G  NL
Sbjct:   33 ARLDGKTVIITGATTGIGKETAVDLAKRGARVIIGARNL 71          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Nematostella
Match: EDO47050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNF1])

HSP 1 Score: 55.8398 bits (133), Expect = 3.936e-8
Identity = 49/190 (25.79%), Postives = 87/190 (45.79%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVK---CRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILK---FIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNN 1082
            Q   +++++V +AG+M  P+++++DGFE   Q+ +    +    +L       +G K    R+V +S  +H +   +N  +L  S + Y+ F +YA + +  +L       +L  DS       L    HPG  V NT + R+ P +       +F +P      Q AAT +  C+S   +   G Y  N
Sbjct:   90 QSENQLNVLVNNAGVMLTPYALTKDGFEQ--QIGICHFGHFLLTMLLLDTLKKSGTKDCHSRIVTVSSTAHSS-GSINFEDLQ-SKKSYSRFGAYAQAKVANVLFTYALQRRLSIDSTHVTANAL----HPG--VVNTELFRHLPWIARAPMGLFFLTP-----EQGAATSLYACLSPDLEGVGGKYLAN 264          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Medaka
Match: wdr91 (WD repeat domain 91 [Source:NCBI gene;Acc:101167587])

HSP 1 Score: 128.257 bits (321), Expect = 6.661e-30
Identity = 161/727 (22.15%), Postives = 308/727 (42.37%), Query Frame = 1
Query: 1354 YIKQILSIKEYKNTLHSFFEEEKIDRPKK-KSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLWXXXXXXXXXXXXXQVVRSV--MSYDSDLENYFSLDMRLENCINQITTKEPDMIKQKYNLTDSNAGKSQIISQVISNLHGSGRTLHDVSDLLCDF-RLTRENKQIEYRRASKSNKPKG---ISLIIQNKTKSTSPNTFLRKKAVPFINVENVDAKDIIWKGEAKDTLTKIDEQSNQSSPNLADLDNSVSMIENSINSTVIGNIAPQASSEINKNS-SADSFGIKQFSSKISQKIFKPKLSITTTAPKVTVFHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXX--XXXXXXXXXALP---HGVISLYDAESWSAIQTNLITLKSD-FTVNCMYC--SSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFD-----VRNFSKSIPKESSHLNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKI-NGTTLLDSVYLNAGHNSPVICID 3468
            ++++ L  + + NTL     E K D+ K  +    ++ LQ  +Q+ DL SL + W   +   F  L+   + T + +++ +++ +++   +    EK   FFQ      L  + EW DWF  P +  P ++     YF+R W D F +S+ NF   + + V  + +D++++   SL    E    Q+   +          T+S   K            G G TLH +   + +  RL      +  +RA  +  P      S  +    +++     +   ++P        A+     G+ K       E  +Q++    ++++     E           AP+ ++  +  + +     ++Q   K+SQ+ +                 EH S + H +    S    ASLDV G  K+W+ N P  ++  T+  K  + S +W ++   ++LLGT  G+V++YD    + + EM ID   PRI  +    S S FVC +     S S  S +ALP    G + L+D +  +  Q    +L+ D   +NC     + N +  G ++G I+L D++  E  +  S    +G EV +V           ++D N ++ +    +   ++     V+   + +P++++    FV+        Y G + +  PR  L   A+ +    + + +  G L+ ++ +G   L+ V    GH +PV+ +D
Sbjct:   11 HVREYLIYRGFTNTLKHLDHEIKADKEKGFRVDKMIEQLQQFVQSFDLFSLKEYWLYLDRRLFCRLEDVYKSTVNKLRTSLYRYYVINTIQRGNLEKTQEFFQKQ-ALELQGQPEWRDWFMLPFLPAPEQNPAIAPYFSRQWADTFLVSLHNFLSVLFQCVHILHFDAEVQRMTSLTEENEQLQQQLFAMQ----------TESRDPKD-----------GEGVTLHKLPPYVQNMDRLGDTEDLVSSQRAVSTTTPPSRNFFSTFLPQGRRTSGKTPQMTSGSLP---SHPSGARKEPSAGQVKAN-GGFMETLSQTAKRRGEMEDVEPPAETPFK-------APEGTNSCSSGAETGGGLSVEQAFIKLSQEEYG----------------EHHSSIMHCRVD-CSGRRVASLDVDGVIKVWSFN-PVMQTKATIMSKSPLLSLEWATKPDRLLLLGTGVGTVRLYDTDAKKNLYEMNIDETHPRILSLACSPSGSSFVCSAAALGGSGSVESAAALPAPVSGQLLLWDTK--TVKQQLQFSLEPDPVAINCTAFNHNGNLLVTGAADGVIRLFDMQRLE--SAMSWRAHDG-EVYSV---------EFSYDENTVLSIGEDGKFVQWNIHRCGVKQSEQVLPQDAT--GPFVL------SGYSGYKQVQVPRGRLF--AFDSEGQHVLTCSSTGGLIYRLTSGEPALERVLSLGGHKAPVVTVD 662          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Medaka
Match: wwox (WW domain containing oxidoreductase [Source:NCBI gene;Acc:101170267])

HSP 1 Score: 98.9821 bits (245), Expect = 2.295e-21
Identity = 62/206 (30.10%), Postives = 103/206 (50.00%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR------AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWN 1145
            + ++V +A + + P++++EDG E++FQ+  L  F + + L   L         RVV +S ESHR      +  +++L  L+P  +EY    +Y  + LC IL     + +L    +  +        HPGN++Y TSI R   ++ F+F    PFTK++ Q AAT + C ++   +   G YFNN   C P+   Q   +   LW 
Sbjct:  201 LHILVCNAAVCTQPWTLTEDGLESTFQICHLGHFLLVQCLQEVL---RRSAPARVVVVSSESHRFTDLLDSSGKVDLALLSPPRKEYWSMLAYNRAKLCNILFSNELHRRLSPRGVTSN------AVHPGNMMY-TSIHRSWWLMTFLFTLARPFTKSMQQGAATTVYCAVAQELEGLGGMYFNNCFRCQPSNQAQDPSSAASLWE 396          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Medaka
Match: rdh12l (retinol dehydrogenase 12 [Source:NCBI gene;Acc:101168330])

HSP 1 Score: 69.707 bits (169), Expect = 2.664e-12
Identity = 53/200 (26.50%), Postives = 91/200 (45.50%), Query Frame = 3
Query:  549 EIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRY-QPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWN 1145
            ++++++ +AG+M  P+  + DGFE    VN L  F +  +L+  +         R+V +S  +H A   +NL +LN S + Y+   +YA S L  +L  +    + +          +  HPG  V  T + R+     +F      PFTK   Q A T I C +  S  + SG Y+++      +  G+     E LW+
Sbjct:   99 KLNILINNAGVMVCPYGKTADGFEMQIGVNHLGHFLLTYLLIDLI---KRSAPARIVTVSSMAH-AWGSINLDDLN-SEKSYSKSKAYAQSKLANVLFTRSLAKRLEGTGV----TAYSLHPG--VVQTDLWRHLSAPEQFFMKIARPFTKNSLQGAQTTIYCAVEPSLDTESGGYYSDCAAASCSSAGKDDTVAEKLWD 287          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Medaka
Match: rdh12 (retinol dehydrogenase 12 [Source:NCBI gene;Acc:101164605])

HSP 1 Score: 70.4774 bits (171), Expect = 3.562e-12
Identity = 55/206 (26.70%), Postives = 95/206 (46.12%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLL---GQSKINGEMLWN 1145
            ++  ++ +++ +AG+M  P++ + DGFE    VN L  F +  +L+  L         R+V +S  +H     +   +L+ S   YN   +Y  S L  +L  +    + +  D     +    HPG V  N+ +TR+  I+  +F  FS F KT  + A T I C  +    S SG +F++   C P  +   G+S      LW+
Sbjct:  163 REVHQLHILINNAGVMMCPYTKTVDGFEMHIGVNHLGHFLLTYLLVGLL---KRSAPARIVVVSSLAHN-FGWIRFHDLH-SQGSYNSGLAYCQSKLANVLFARELARRLNGTDVTVNSV----HPGTV--NSDLTRHSTIMTILFSVFSVFLKTPREGAQTSIYCATAEELHSISGKHFSD---CSPAFVAPQGRSSETARKLWD 354          
BLAST of WW domain-containing oxidoreductase vs. Ensembl Medaka
Match: wwox (WW domain containing oxidoreductase [Source:NCBI gene;Acc:101170267])

HSP 1 Score: 67.0106 bits (162), Expect = 5.732e-11
Identity = 47/160 (29.38%), Postives = 82/160 (51.25%), Query Frame = 3
Query:  552 IDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHR------AIKELNLCELNPSSQEYNGFYSYALSSLCKILIVK--YSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLS 1007
            + ++V +A + + P++++EDG E++FQ+  L  F + + L   L         RVV +S ESHR      +  +++L  L+P  +EY    +Y  + LC IL     + +L    +  +        HPGN++Y TSI R   ++ F+F    PFTK++ 
Sbjct:  201 LHILVCNAAVCTQPWTLTEDGLESTFQICHLGHFLLVQCLQEVL---RRSAPARVVVVSSESHRFTDLLDSSGKVDLALLSPPRKEYWSMLAYNRAKLCNILFSNELHRRLSPRGVTSN------AVHPGNMMY-TSIHRSWWLMTFLFTLARPFTKSMD 350          
BLAST of WW domain-containing oxidoreductase vs. Planmine SMEST
Match: SMESG000077648.1 (SMESG000077648.1)

HSP 1 Score: 1467.6 bits (3798), Expect = 0.000e+0
Identity = 743/743 (100.00%), Postives = 743/743 (100.00%), Query Frame = 1
Query: 1339 MNEKSYIKQILSIKEYKNTLHSFFEEEKIDRPKKKSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLWXXXXXXXXXXXXXQVVRSVMSYDSDLENYFSLDMRLENCINQITTKEPDMIKQKYNLTDSNAGKSQIISQVISNLHGSGRTLHDVSDLLCDFRLTRENKQIEYRRASKSNKPKGISLIIQNKTKSTSPNTFLRKKAVPFINVENVDAKDIIWKGEAKDTLTKIDEQSNQSSPNLADLDNSVSMIENSINSTVIGNIAPQASSEINKNSSADSFGIKQFSSKISQKIFKPKLSITTTAPKVTVFHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXXXXXXXXXXXALPHGVISLYDAESWSAIQTNLITLKSDFTVNCMYCSSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKINGTTLLDSVYLNAGHNSPVICIDSYPYDLEDSDNVVVLSGTMEGTISTIRINSASN 3567
            MNEKSYIKQILSIKEYKNTLHSFFEEEKIDRPKKKSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLWFDNFFLSMFNFFMQVVRSVMSYDSDLENYFSLDMRLENCINQITTKEPDMIKQKYNLTDSNAGKSQIISQVISNLHGSGRTLHDVSDLLCDFRLTRENKQIEYRRASKSNKPKGISLIIQNKTKSTSPNTFLRKKAVPFINVENVDAKDIIWKGEAKDTLTKIDEQSNQSSPNLADLDNSVSMIENSINSTVIGNIAPQASSEINKNSSADSFGIKQFSSKISQKIFKPKLSITTTAPKVTVFHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCESLDRSRSTSSNSALPHGVISLYDAESWSAIQTNLITLKSDFTVNCMYCSSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKINGTTLLDSVYLNAGHNSPVICIDSYPYDLEDSDNVVVLSGTMEGTISTIRINSASN
Sbjct:    1 MNEKSYIKQILSIKEYKNTLHSFFEEEKIDRPKKKSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLWFDNFFLSMFNFFMQVVRSVMSYDSDLENYFSLDMRLENCINQITTKEPDMIKQKYNLTDSNAGKSQIISQVISNLHGSGRTLHDVSDLLCDFRLTRENKQIEYRRASKSNKPKGISLIIQNKTKSTSPNTFLRKKAVPFINVENVDAKDIIWKGEAKDTLTKIDEQSNQSSPNLADLDNSVSMIENSINSTVIGNIAPQASSEINKNSSADSFGIKQFSSKISQKIFKPKLSITTTAPKVTVFHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCESLDRSRSTSSNSALPHGVISLYDAESWSAIQTNLITLKSDFTVNCMYCSSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKINGTTLLDSVYLNAGHNSPVICIDSYPYDLEDSDNVVVLSGTMEGTISTIRINSASN 743          
BLAST of WW domain-containing oxidoreductase vs. Planmine SMEST
Match: SMESG000077648.1 (SMESG000077648.1)

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 415/415 (100.00%), Postives = 415/415 (100.00%), Query Frame = 1
Query: 2323 MIENSINSTVIGNIAPQASSEINKNSSADSFGIKQFSSKISQKIFKPKLSITTTAPKVTVFHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCEXXXXXXXXXXXXALPHGVISLYDAESWSAIQTNLITLKSDFTVNCMYCSSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKINGTTLLDSVYLNAGHNSPVICIDSYPYDLEDSDNVVVLSGTMEGTISTIRINSASN 3567
            MIENSINSTVIGNIAPQASSEINKNSSADSFGIKQFSSKISQKIFKPKLSITTTAPKVTVFHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCESLDRSRSTSSNSALPHGVISLYDAESWSAIQTNLITLKSDFTVNCMYCSSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKINGTTLLDSVYLNAGHNSPVICIDSYPYDLEDSDNVVVLSGTMEGTISTIRINSASN
Sbjct:    1 MIENSINSTVIGNIAPQASSEINKNSSADSFGIKQFSSKISQKIFKPKLSITTTAPKVTVFHEHFSMVTHVKCSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTPNMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCESLDRSRSTSSNSALPHGVISLYDAESWSAIQTNLITLKSDFTVNCMYCSSNTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRSNFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPYGGEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKINGTTLLDSVYLNAGHNSPVICIDSYPYDLEDSDNVVVLSGTMEGTISTIRINSASN 415          
BLAST of WW domain-containing oxidoreductase vs. Planmine SMEST
Match: SMESG000077648.1 (SMESG000077648.1)

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 327/327 (100.00%), Postives = 327/327 (100.00%), Query Frame = 1
Query: 1339 MNEKSYIKQILSIKEYKNTLHSFFEEEKIDRPKKKSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLWXXXXXXXXXXXXXQVVRSVMSYDSDLENYFSLDMRLENCINQITTKEPDMIKQKYNLTDSNAGKSQIISQVISNLHGSGRTLHDVSDLLCDFRLTRENKQIEYRRASKSNKPKGISLIIQNKTKSTSPNTFLRKKAVPFINVENVDAKDIIWKGEAKDTLTKIDEQSNQSSPNLADLDNSV 2319
            MNEKSYIKQILSIKEYKNTLHSFFEEEKIDRPKKKSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLWFDNFFLSMFNFFMQVVRSVMSYDSDLENYFSLDMRLENCINQITTKEPDMIKQKYNLTDSNAGKSQIISQVISNLHGSGRTLHDVSDLLCDFRLTRENKQIEYRRASKSNKPKGISLIIQNKTKSTSPNTFLRKKAVPFINVENVDAKDIIWKGEAKDTLTKIDEQSNQSSPNLADLDNSV
Sbjct:    1 MNEKSYIKQILSIKEYKNTLHSFFEEEKIDRPKKKSRYFVDILQNAIQTNDLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTEKVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLWFDNFFLSMFNFFMQVVRSVMSYDSDLENYFSLDMRLENCINQITTKEPDMIKQKYNLTDSNAGKSQIISQVISNLHGSGRTLHDVSDLLCDFRLTRENKQIEYRRASKSNKPKGISLIIQNKTKSTSPNTFLRKKAVPFINVENVDAKDIIWKGEAKDTLTKIDEQSNQSSPNLADLDNSV 327          
BLAST of WW domain-containing oxidoreductase vs. Planmine SMEST
Match: SMESG000077649.1 (SMESG000077649.1)

HSP 1 Score: 408.297 bits (1048), Expect = 5.769e-132
Identity = 205/220 (93.18%), Postives = 205/220 (93.18%), Query Frame = 3
Query:  537 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWNYLTTKINQIKIVNQKLN 1196
            QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFS               GQSKINGEMLWNYLTTKINQIKIVNQKLN
Sbjct:  170 QKFREIDLIVFSAGIMSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSCESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDCDRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPILCCISNSFKSFS---------------GQSKINGEMLWNYLTTKINQIKIVNQKLN 374          

HSP 2 Score: 287.73 bits (735), Expect = 3.772e-87
Identity = 143/154 (92.86%), Postives = 146/154 (94.81%), Query Frame = 2
Query:  110 MESDTESEYELPPGWTKSINNGTIIYNNHIINISQLYSPLRDIKIHKSDVCYEKIRYNKSCGFRPPKERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTKISGNRFDSFQ 571
            MESDTESEYELPPGWTKSINNGTIIYNNHIINISQLYSPLRDIKIHKSDVCYEKIRYNKSCGFRPPKERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKL +  +I  N  + FQ
Sbjct:    1 MESDTESEYELPPGWTKSINNGTIIYNNHIINISQLYSPLRDIKIHKSDVCYEKIRYNKSCGFRPPKERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLGN--EIVTNFINIFQ 152          
BLAST of WW domain-containing oxidoreductase vs. Planmine SMEST
Match: SMESG000077649.1 (SMESG000077649.1)

HSP 1 Score: 349.747 bits (896), Expect = 5.846e-113
Identity = 169/169 (100.00%), Postives = 169/169 (100.00%), Query Frame = 2
Query:  110 MESDTESEYELPPGWTKSINNGTIIYNNHIINISQLYSPLRDIKIHKSDVCYEKIRYNKSCGFRPPKERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTKISGNRFDSFQRWHYEPTIFSFRGWI 616
            MESDTESEYELPPGWTKSINNGTIIYNNHIINISQLYSPLRDIKIHKSDVCYEKIRYNKSCGFRPPKERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTKISGNRFDSFQRWHYEPTIFSFRGWI
Sbjct:    1 MESDTESEYELPPGWTKSINNGTIIYNNHIINISQLYSPLRDIKIHKSDVCYEKIRYNKSCGFRPPKERHKRFIQKFDSFSTSEQVINTANLSFKRALVIGGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTKISGNRFDSFQRWHYEPTIFSFRGWI 169          
The following BLAST results are available for this feature:
BLAST of WW domain-containing oxidoreductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WWOX3.944e-3130.45WW domain containing oxidoreductase [Source:HGNC S... [more]
WWOX1.475e-2029.56WW domain containing oxidoreductase [Source:HGNC S... [more]
WWOX1.017e-1229.56WW domain containing oxidoreductase [Source:HGNC S... [more]
WDR911.259e-1222.38WD repeat domain 91 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR911.599e-1222.34WD repeat domain 91 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of WW domain-containing oxidoreductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sorf-13.554e-1428.47Suppressor of organelle fusion 1 [Source:UniProtK... [more]
sorf-13.554e-1428.47Suppressor of organelle fusion 1 [Source:UniProtK... [more]
E04F6.157.406e-1327.01pep chromosome:WBcel235:II:7208773:7210287:-1 gene... [more]
dhs-87.427e-1227.44DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
dhs-81.326e-1127.44DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
back to top
BLAST of WW domain-containing oxidoreductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wwox9.330e-2934.47gene:FBgn0031972 transcript:FBtr0079550[more]
Wwox9.330e-2934.47gene:FBgn0031972 transcript:FBtr0343384[more]
CG60051.574e-1225.53gene:FBgn0038672 transcript:FBtr0343992[more]
CG60051.574e-1225.53gene:FBgn0038672 transcript:FBtr0083719[more]
CG112003.518e-1028.72gene:FBgn0034500 transcript:FBtr0086299[more]
back to top
BLAST of WW domain-containing oxidoreductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr912.052e-1625.28WD repeat domain 91 [Source:NCBI gene;Acc:402898][more]
wdr912.087e-1625.28WD repeat domain 91 [Source:NCBI gene;Acc:402898][more]
si:dkey-94e7.28.019e-1428.78si:dkey-94e7.2 [Source:ZFIN;Acc:ZDB-GENE-070912-61... [more]
rdh121.000e-1325.47retinol dehydrogenase 12 [Source:ZFIN;Acc:ZDB-GENE... [more]
si:dkey-94e7.22.379e-1327.59si:dkey-94e7.2 [Source:ZFIN;Acc:ZDB-GENE-070912-61... [more]
back to top
BLAST of WW domain-containing oxidoreductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr916.540e-2923.08WD repeat domain 91 [Source:NCBI gene;Acc:780034][more]
runx14.206e-1827.61RUNX family transcription factor 1 [Source:Xenbase... [more]
runx14.719e-1827.61RUNX family transcription factor 1 [Source:Xenbase... [more]
wdr911.098e-1329.79WD repeat domain 91 [Source:NCBI gene;Acc:780034][more]
wdr911.193e-1329.79WD repeat domain 91 [Source:NCBI gene;Acc:780034][more]
back to top
BLAST of WW domain-containing oxidoreductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wwox3.267e-3331.96WW domain-containing oxidoreductase [Source:MGI Sy... [more]
Wwox3.745e-2231.68WW domain-containing oxidoreductase [Source:MGI Sy... [more]
Wwox4.381e-2231.68WW domain-containing oxidoreductase [Source:MGI Sy... [more]
Rdh118.152e-1426.70retinol dehydrogenase 11 [Source:MGI Symbol;Acc:MG... [more]
Rdh111.052e-1326.70retinol dehydrogenase 11 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of WW domain-containing oxidoreductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91WL8|WWOX_MOUSE2.005e-3231.96WW domain-containing oxidoreductase OS=Mus musculu... [more]
sp|Q9NZC7|WWOX_HUMAN1.755e-3030.45WW domain-containing oxidoreductase OS=Homo sapien... [more]
sp|Q5R9W5|WWOX_PONAB1.970e-3030.00WW domain-containing oxidoreductase OS=Pongo abeli... [more]
sp|Q05B30|WDR91_XENTR7.815e-2923.08WD repeat-containing protein 91 OS=Xenopus tropica... [more]
sp|Q9VLU5|WWOX_DROME9.352e-2834.47WW domain-containing oxidoreductase OS=Drosophila ... [more]
back to top
BLAST of WW domain-containing oxidoreductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A154PPU78.024e-3935.75WW domain-containing oxidoreductase OS=Dufourea no... [more]
A0A151X5891.897e-3835.75WW domain-containing oxidoreductase OS=Trachymyrme... [more]
A0A0N0BGS52.966e-3836.92WW domain-containing oxidoreductase OS=Melipona qu... [more]
A0A195DRL75.558e-3835.27WW domain-containing oxidoreductase OS=Trachymyrme... [more]
A0A088A8B98.127e-3835.29Uncharacterized protein OS=Apis mellifera OX=7460 ... [more]
back to top
BLAST of WW domain-containing oxidoreductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr912.959e-3022.57WD repeat domain 91 [Source:NCBI gene;Acc:10302361... [more]
wdr916.690e-1825.77WD repeat domain 91 [Source:NCBI gene;Acc:10302361... [more]
zgc:1534418.336e-1727.67retinol dehydrogenase 12-like [Source:NCBI gene;Ac... [more]
zgc:1534419.279e-1727.67retinol dehydrogenase 12-like [Source:NCBI gene;Ac... [more]
rdh12l2.190e-1325.73retinol dehydrogenase 12-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of WW domain-containing oxidoreductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wdr919.234e-1621.94WD repeat domain 91 [Source:NCBI gene;Acc:402898][more]
rdh14b1.874e-826.20retinol dehydrogenase 14b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of WW domain-containing oxidoreductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ENV98.378e-726.80Protein proposed to be involved in vacuolar functi... [more]
back to top
BLAST of WW domain-containing oxidoreductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO325331.140e-2327.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360709.493e-1828.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470503.936e-825.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WW domain-containing oxidoreductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr916.661e-3022.15WD repeat domain 91 [Source:NCBI gene;Acc:10116758... [more]
wwox2.295e-2130.10WW domain containing oxidoreductase [Source:NCBI g... [more]
rdh12l2.664e-1226.50retinol dehydrogenase 12 [Source:NCBI gene;Acc:101... [more]
rdh123.562e-1226.70retinol dehydrogenase 12 [Source:NCBI gene;Acc:101... [more]
wwox5.732e-1129.38WW domain containing oxidoreductase [Source:NCBI g... [more]
back to top
BLAST of WW domain-containing oxidoreductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077648.10.000e+0100.00SMESG000077648.1[more]
SMESG000077648.10.000e+0100.00SMESG000077648.1[more]
SMESG000077648.10.000e+0100.00SMESG000077648.1[more]
SMESG000077649.15.769e-13293.18SMESG000077649.1[more]
SMESG000077649.15.846e-113100.00SMESG000077649.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006610 ID=SMED30006610|Name=WW domain-containing oxidoreductase|organism=Schmidtea mediterranea sexual|type=transcript|length=3641bp
AGATCTATATAAATCTTATATGCTTATCATTTCAAGAAATTTTTGAAATT
ATATTCTTTATACACATTTTGTATATTTGAGTAATGTTCGTTAATTTTAT
CATACAATAATGGAAAGTGATACTGAATCTGAATATGAATTACCTCCTGG
ATGGACAAAGTCTATAAACAATGGGACAATTATTTACAACAATCATATAA
TTAATATTTCTCAATTATATTCTCCACTGAGAGATATAAAAATTCACAAA
AGTGATGTGTGTTATGAAAAGATACGATACAATAAATCCTGTGGATTTCG
TCCACCGAAAGAACGTCATAAACGTTTTATTCAAAAATTTGACTCTTTCT
CTACATCTGAACAAGTAATTAATACTGCCAATTTATCGTTTAAACGTGCT
CTTGTCATTGGTGGTTGTTCCGGCATTGGATTGGAAATCGTCAGTCAATT
AATCACCAAAAATTGCATGATCATTTTAGGCTGTCCGAATTTGATAAAAT
GTGATTTGGAATTAAAATCTAAATTAGTTGATTTTACAAAAATTTCGGGA
AATCGATTTGATAGTTTTCAGCGCTGGCATTATGAGCCCACCATTTTCAG
TTTCCGAGGATGGATTTGAAACAAGTTTTCAAGTTAATGTGTTATCTCTG
TTTTATATTCAGGAAATGTTGTTATCGAGTCTATTCAGTCCACATAACGG
TGTTAAATGCCGAGTGGTGTGGCTATCCTGTGAAAGTCACAGAGCTATCA
AGGAATTGAATTTGTGTGAATTGAATCCATCGTCACAGGAATACAATGGA
TTCTATTCCTATGCTCTAAGCAGTCTGTGCAAAATTCTTATTGTTAAATA
TTCAAAATTAAAATGGGATTCAATTGACTGCGACAGGAAACCGTTATTTT
TCGTTTGCCATCCGGGTAATGTTGTCTACAATACGAGTATTACAAGATAT
CAACCAATTTTAAAATTTATATTTTGGTTCTTTAGTCCCTTCACAAAGAC
TCTGAGTCAAGCAGCAGCTACTCCAATTTTATGTTGTATTTCGAATTCTT
TCAAAAGTTTTTCCGGTTGTTACTTTAATAATGGATGTATTTGTGATCCA
ACATTATTAGGACAAAGCAAAATAAATGGAGAAATGTTGTGGAATTATTT
AACAACTAAAATAAATCAAATAAAAATTGTTAATCAAAAACTTAATTAAC
CAATCTAAAGAAAATGTCAACTTAATTCCGAATAAATGAATTCAGATTGA
AGATTAAGATTGAGCGATCTTGTATTGTGTTAAATACATTTGTATTTTTT
GTGTTTAAATATATGTTATTTTATGCGGAATTATAATTATGAATGAAAAA
AGTTATATTAAACAAATTTTATCTATTAAAGAGTATAAAAATACTTTACA
TTCATTCTTTGAAGAAGAGAAAATTGACCGACCCAAGAAAAAATCTCGAT
ATTTTGTTGATATTTTGCAAAATGCTATCCAAACGAACGATTTGGATTCA
TTGATTAAAATTTGGAAAGAATATGAGATTCTTTATTTTAAGTTTCTTGA
TTTTGATAAACAAAAAACGGCAGATATAATGAAATCGGATATGTTTAAAG
CATTTTTAGTAGAATGTTTTAAAAATAAAAAAACGGAAAAAGTCAATATT
TTTTTTCAAACAATGGGGACATACATGTTGACTAGTAGAAATGAATGGGC
TGATTGGTTTGAATTTCCACTTGTGAAAAATCCGTCTGAACACAAAGTTT
TCGGGATTTATTTCACCCGATTGTGGTTTGACAATTTCTTTTTATCCATG
TTTAATTTCTTTATGCAAGTCGTCCGTTCTGTCATGTCTTATGATAGTGA
TTTAGAAAATTACTTTTCTCTTGATATGCGTTTAGAAAATTGCATCAATC
AAATAACAACAAAAGAGCCAGATATGATTAAACAAAAATACAATCTCACT
GATAGTAATGCTGGAAAAAGTCAAATAATATCCCAAGTAATTTCAAATTT
ACACGGATCAGGTAGAACTTTGCATGACGTATCGGATTTACTTTGTGATT
TTCGACTAACTAGAGAAAATAAACAAATTGAATATAGAAGGGCGTCTAAA
AGCAATAAACCAAAGGGTATCTCGCTTATTATTCAAAATAAAACTAAATC
TACATCTCCGAATACATTTTTACGAAAGAAAGCTGTTCCTTTTATCAATG
TGGAAAATGTTGATGCTAAAGATATCATATGGAAAGGAGAAGCCAAAGAC
ACTCTTACAAAAATCGATGAGCAATCTAATCAATCTTCTCCAAATTTGGC
AGACCTAGATAATTCGGTGTCAATGATTGAGAATTCGATTAACTCGACTG
TCATTGGTAATATTGCTCCACAAGCATCTTCTGAAATAAATAAAAATTCA
TCGGCCGATTCTTTTGGAATAAAGCAATTTTCAAGTAAAATATCTCAAAA
GATTTTTAAACCAAAACTTTCCATAACTACTACAGCTCCAAAAGTCACAG
TTTTTCATGAACACTTTTCTATGGTAACCCATGTTAAATGTAGTCGAATA
TCAAATTCGTATTGGGCAAGCTTAGATGTGGGGGGTACTTTCAAAATTTG
GGCTATCAATGATCCATCTTGCAAGTCTTTGCACACTTTATCATTCAAGC
ACACTATTTATTCATTTGATTGGGTATCACAAACACCTAATATGATGCTA
CTCGGAACGAAAGGGGGTTCTGTAAAAATGTATGACGTAACAAAGAATGA
AATTGTTAAAGAGATGATGATTGATTTAGCTTTTCCTCGAATAAACATTG
TACAATCATTTGACAGTGAATCCAAATTTGTATGTGAATCTCTTGATCGG
AGTCGTTCGACCTCTTCAAACAGCGCTCTACCTCATGGAGTAATATCTTT
ATATGACGCTGAGTCCTGGTCTGCAATCCAAACTAATTTGATTACACTAA
AATCTGACTTTACAGTTAATTGCATGTACTGCTCATCAAATACAATCTTT
GCTGGATGTTCTAACGGTTCGATAAAGTTGATTGACATTCGAGTGCCAGA
GAATTACAACACCAATTCACTATCAATCTTCGAAGGGGATGAAGTGATCA
ATGTTAGTTCAATGTGTCGATCGAAGTGGTCAAGATCTAATTTTGATCCC
AACTATTTGATTTGTGTCAGTTCAAAAAGTCAACTAAAAATTTTTGATGT
ACGTAATTTTTCTAAATCTATTCCAAAAGAATCTAGTCATTTAAATGATT
TCGTCATACCGTTATCGTGGGCTGAAAAACCTTATGGCGGTGAACAAACT
ATATATTTCCCACGTGCAAATCTAATATCAGCAGCATATTTAAACAACAC
CAATACCCTTTTTTCTGCTGCTAAGAAAGGAATTCTTGTACAAAAAATAA
ATGGAACTACATTGTTGGATTCAGTCTATCTAAATGCTGGTCACAATAGT
CCTGTTATATGCATAGATAGTTATCCGTACGACTTGGAGGATTCGGATAA
TGTCGTTGTACTTAGTGGGACTATGGAGGGCACCATTTCAACTATTAGAA
TCAATTCAGCAAGCAATATATTTTAACTATTTGAAATTATTTTTCTTGTG
ATTCAATCTTCAATAAAAATTATTGTAGTTTTTAAAAAAAA
back to top

protein sequence of SMED30006610-orf-1

>SMED30006610-orf-1 ID=SMED30006610-orf-1|Name=SMED30006610-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=170bp
MESDTESEYELPPGWTKSINNGTIIYNNHIINISQLYSPLRDIKIHKSDV
CYEKIRYNKSCGFRPPKERHKRFIQKFDSFSTSEQVINTANLSFKRALVI
GGCSGIGLEIVSQLITKNCMIILGCPNLIKCDLELKSKLVDFTKISGNRF
DSFQRWHYEPTIFSFRGWI*
back to top

protein sequence of SMED30006610-orf-2

>SMED30006610-orf-2 ID=SMED30006610-orf-2|Name=SMED30006610-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=746bp
MNEKSYIKQILSIKEYKNTLHSFFEEEKIDRPKKKSRYFVDILQNAIQTN
DLDSLIKIWKEYEILYFKFLDFDKQKTADIMKSDMFKAFLVECFKNKKTE
KVNIFFQTMGTYMLTSRNEWADWFEFPLVKNPSEHKVFGIYFTRLWFDNF
FLSMFNFFMQVVRSVMSYDSDLENYFSLDMRLENCINQITTKEPDMIKQK
YNLTDSNAGKSQIISQVISNLHGSGRTLHDVSDLLCDFRLTRENKQIEYR
RASKSNKPKGISLIIQNKTKSTSPNTFLRKKAVPFINVENVDAKDIIWKG
EAKDTLTKIDEQSNQSSPNLADLDNSVSMIENSINSTVIGNIAPQASSEI
NKNSSADSFGIKQFSSKISQKIFKPKLSITTTAPKVTVFHEHFSMVTHVK
CSRISNSYWASLDVGGTFKIWAINDPSCKSLHTLSFKHTIYSFDWVSQTP
NMMLLGTKGGSVKMYDVTKNEIVKEMMIDLAFPRINIVQSFDSESKFVCE
SLDRSRSTSSNSALPHGVISLYDAESWSAIQTNLITLKSDFTVNCMYCSS
NTIFAGCSNGSIKLIDIRVPENYNTNSLSIFEGDEVINVSSMCRSKWSRS
NFDPNYLICVSSKSQLKIFDVRNFSKSIPKESSHLNDFVIPLSWAEKPYG
GEQTIYFPRANLISAAYLNNTNTLFSAAKKGILVQKINGTTLLDSVYLNA
GHNSPVICIDSYPYDLEDSDNVVVLSGTMEGTISTIRINSASNIF*
back to top

protein sequence of SMED30006610-orf-3

>SMED30006610-orf-3 ID=SMED30006610-orf-3|Name=SMED30006610-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=206bp
MSPPFSVSEDGFETSFQVNVLSLFYIQEMLLSSLFSPHNGVKCRVVWLSC
ESHRAIKELNLCELNPSSQEYNGFYSYALSSLCKILIVKYSKLKWDSIDC
DRKPLFFVCHPGNVVYNTSITRYQPILKFIFWFFSPFTKTLSQAAATPIL
CCISNSFKSFSGCYFNNGCICDPTLLGQSKINGEMLWNYLTTKINQIKIV
NQKLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR039724WDR91
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
IPR001202WW_dom
IPR016040NAD(P)-bd_dom
Vocabulary: biological process
TermDefinition
GO:0045022early endosome to late endosome transport
GO:0043551regulation of phosphatidylinositol 3-kinase activity
GO:0050829defense response to Gram-negative bacterium
GO:0006915apoptotic process
GO:0010212response to ionizing radiation
GO:0016055Wnt signaling pathway
GO:0055114oxidation-reduction process
GO:2000377regulation of reactive oxygen species metabolic process
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016491oxidoreductase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 574..620
e-value: 34.0
score: 7.4
coord: 427..466
e-value: 1.5
score: 16.0
coord: 382..422
e-value: 4.4
score: 13.0
coord: 690..737
e-value: 400.0
score: 0.6
coord: 530..566
e-value: 12.0
score: 10.2
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 487..744
e-value: 2.7E-10
score: 41.4
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 296..481
e-value: 1.6E-10
score: 42.4
IPR039724WD repeat-containing protein 91PANTHERPTHR13083UNCHARACTERIZEDcoord: 7..736
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 382..739