Alpha-mannosidase

Overview
NameAlpha-mannosidase
Smed IDSMED30006606
Length (bp)3119
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-mannosidase (SMED30006606) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-mannosidase (SMED30006606) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-mannosidase (SMED30006606) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-mannosidase (SMED30006606) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006606

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30006606SMESG000029088.1 Contig5520GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30006606SMESG000045085.1 SMESG000045072.1 PL08003B1F04ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30006606SMESG000045085.1 SMESG000045072.1 Contig5520GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30006606SMESG000045085.1 SMESG000045072.1 dd_Smed_v4_1942_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006606SMESG000045085.1 SMESG000045072.1 dd_Smed_v4_1942_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-mannosidase vs. Ensembl Human
Match: MAN2B1 (mannosidase alpha class 2B member 1 [Source:HGNC Symbol;Acc:HGNC:6826])

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 399/984 (40.55%), Postives = 572/984 (58.13%), Query Frame = 2
Query:  125 GYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRK--DINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL----------SQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWH-RIPVNVLHGDEYKISHSNGSLVPSQLV--PITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINS-KDKIVIGNKYLKLTY--DNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNG---QKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSK------NTNISKFDQYSALLDNLPSGVNILSLENHFN--LNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKW--NSTNDNYQNFFTSNQMIVTLFPGQIRTF 2983
            GY +C   +PN+LNVH++ HTHDDVGWLKTVDQY+YG +++IQ AGVQYIL++VISAL  +P R+F YVEIA+F RWW QQ +  +  V+ LV +GRL+F  GGW MNDEA THY +I+DQM+LGL FL  TFG  GRP V+W IDPFGHS EQA++FA MGFDG FF RLDY+DK  R+    ME + + S         LFT VL + Y  P   C+D  C D P+++DP   +YN ++ VD F +    Q + Y+TNH ++ MG DFQ++NAN  F NLDKLI  VN   K   ++V YSTPACY   +NK      +K+DDFFPYA GP+ +WTGYF+SR ALK + + S N  QVC QL  L             +   LN+        M V QHHDAVSGT +QHVA DYA++L+ G   CE +++++L++L         F  C  LNIS C +S   +      V++YNPLG  ++ W  R+PV+      + +   NG  VPS +V  P ++   H P          EL F + LPALG+++ ++ +  +     ++       S    + I N++++ T+  D G L+ + N+   + + + Q   +Y +  G+    Q SGAYIFRP   + +P+++  ++ ++K  LV EVHQ FS W   V RLY     LE EW+VGPIP+ D+ GKE++ ++ T +++   F+TDSNGR+I+ R+ + R  +   QTEPVAGNYYPVN+ +++ + N +     L + TDR+ G  S ++G +E+MVHRR L DD  GV EPL E   +G+G  VRG+  +  D      +  RL + +    P VV +       N       Q+S L  +LP  V++L+L +     +   +++Q    E+        + LN + +F +  IT + E  L ANQ  +   RLKW  N+    +Q  +  +   +TL P +IRTF
Sbjct:   51 GYETCPTVQPNMLNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRFIYVEIAFFSRWWHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLEDTFGNDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVWRASTSLKPPTADLFTGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVATAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVNAQAKGSSVHVLYSTPACYLWELNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVGLAANVGPYGSGDSAPLNE-------AMAVLQHHDAVSGTSRQHVANDYARQLAAGWGPCEVLLSNALARL---RGFKDHFTFCQQLNISICPLSQTAAR---FQVIVYNPLG-RKVNWMVRLPVS---EGVFVVKDPNGRTVPSDVVIFPSSDSQAHPP----------ELLFSASLPALGFSTYSVAQVPRWKPQARAPQPIPRRSWSPALTIENEHIRATFDPDTGLLMEIMNMNQQLLLPVRQTFFWYNASIGDNESDQASGAYIFRPNQQKPLPVSRWAQIHLVKTPLVQEVHQNFSAWCSQVVRLYPGQRHLELEWSVGPIPVGDTWGKEVISRFDTPLETKGRFYTDSNGREILERRRDYRPTWKLNQTEPVAGNYYPVNTRIYITDGNMQ-----LTVLTDRSQGGSSLRDGSLELMVHRRLLKDDGRGVSEPLME---NGSGAWVRGRHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGLRRDLPPSVHLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLVANQLREAASRLKWTTNTGPTPHQTPYQLDPANITLEPMEIRTF 999          
BLAST of Alpha-mannosidase vs. Ensembl Human
Match: MAN2B1 (mannosidase alpha class 2B member 1 [Source:HGNC Symbol;Acc:HGNC:6826])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 398/985 (40.41%), Postives = 572/985 (58.07%), Query Frame = 2
Query:  125 GYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL----------SQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWH-RIPVNVLHGDEYKISHSNGSLVPSQLV--PITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINS-KDKIVIGNKYLKLTY--DNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNG---QKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSK------NTNISKFDQYSALLDNLPSGVNILSLENHFN--LNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKW--NSTNDNYQNFFTSNQMIVTLFPGQIRTF 2983
            GY +C   +PN+LNVH++ HTHDDVGWLKTVDQY+YG +++IQ AGVQYIL++VISAL  +P R+F YVEIA+F RWW QQ +  +  V+ LV +GRL+F  GGW MNDEA THY +I+DQM+LGL FL  TFG  GRP V+W IDPFGHS EQA++FA MGFDG FF RLDY+DK  R+    ME + + S         LFT VL + Y  P   C+D  C D P+++DP   +YN ++ VD F +    Q + Y+TNH ++ MG DFQ++NAN  F NLDKLI  VN  +     ++V YSTPACY   +NK      +K+DDFFPYA GP+ +WTGYF+SR ALK + + S N  QVC QL  L             +   LN+        M V QHHDAVSGT +QHVA DYA++L+ G   CE +++++L++L         F  C  LNIS C +S   +      V++YNPLG  ++ W  R+PV+      + +   NG  VPS +V  P ++   H P          EL F + LPALG+++ ++ +  +     ++       S    + I N++++ T+  D G L+ + N+   + + + Q   +Y +  G+    Q SGAYIFRP   + +P+++  ++ ++K  LV EVHQ FS W   V RLY     LE EW+VGPIP+ D+ GKE++ ++ T +++   F+TDSNGR+I+ R+ + R  +   QTEPVAGNYYPVN+ +++ + N +     L + TDR+ G  S ++G +E+MVHRR L DD  GV EPL E   +G+G  VRG+  +  D      +  RL + +    P VV +       N       Q+S L  +LP  V++L+L +     +   +++Q    E+        + LN + +F +  IT + E  L ANQ  +   RLKW  N+    +Q  +  +   +TL P +IRTF
Sbjct:   51 GYETCPTVQPNMLNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRFIYVEIAFFSRWWHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLEDTFGNDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVWRASTSLKPPTADLFTGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVATAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVNAQQAKGSSVHVLYSTPACYLWELNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVGLAANVGPYGSGDSAPLNE-------AMAVLQHHDAVSGTSRQHVANDYARQLAAGWGPCEVLLSNALARL---RGFKDHFTFCQQLNISICPLSQTAAR---FQVIVYNPLG-RKVNWMVRLPVS---EGVFVVKDPNGRTVPSDVVIFPSSDSQAHPP----------ELLFSASLPALGFSTYSVAQVPRWKPQARAPQPIPRRSWSPALTIENEHIRATFDPDTGLLMEIMNMNQQLLLPVRQTFFWYNASIGDNESDQASGAYIFRPNQQKPLPVSRWAQIHLVKTPLVQEVHQNFSAWCSQVVRLYPGQRHLELEWSVGPIPVGDTWGKEVISRFDTPLETKGRFYTDSNGREILERRRDYRPTWKLNQTEPVAGNYYPVNTRIYITDGNMQ-----LTVLTDRSQGGSSLRDGSLELMVHRRLLKDDGRGVSEPLME---NGSGAWVRGRHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGLRRDLPPSVHLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLVANQLREAASRLKWTTNTGPTPHQTPYQLDPANITLEPMEIRTF 1000          
BLAST of Alpha-mannosidase vs. Ensembl Human
Match: MAN2B2 (mannosidase alpha class 2B member 2 [Source:HGNC Symbol;Acc:HGNC:29623])

HSP 1 Score: 255.373 bits (651), Expect = 3.657e-70
Identity = 278/1058 (26.28%), Postives = 455/1058 (43.01%), Query Frame = 2
Query:  125 GYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRN-RVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYD-SYCTPPGFCFDDKCS---------DDPIMDD--PTLHDYNVQKRVDDFADYV---IKQSKA-YQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD--INVFYSTPACYTLAXXXXXXX-XXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQL--HVLSQQNRTDLN-----KKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINS--------KDKIVIGNKYLK----------LTYDNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNGQ-KSGA----YIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSE-------WGMIVTRLY-----NDSNIL----ETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTL--FDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVF----SKNTNISKFDQYSALLDNLPSGVN--ILSL----------ENHFNL----NNEIDYQIIRVENVFYQ---------FGHSIKLNFQKMFRSI-KITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQM-----IVTLFPGQIRTFKI 2989
            G  S  P     +   ++ H+H DVGW+ TV +    Y  N+          +V+  L     R+F  VE  +F  WW    S  +  +V+ L+ EGRL+F++GG  M+DEA TH    I Q++ G  FL +TFG   RP  SW +DPFG S     +FA  GF+     R+DY  K      + ++F+ +GS   ++    +FT+++   SYCTP    F ++             P  D   P + +      ++ +A+ +   +KQ  A ++T H+L P GCD QF NA+  F N+D L+ H+N    +  ++V Y+T   Y  A++ +        + DF PY++ P   WTG++TSRS+LKG  + ++ +    + +    L    R  L+     +++  +   +   QHHDA++GTE   V   YA  L+ G+     ++ S               VL  L   +  A S +          +YNPL  T      + V        +++   G  VPSQ   I N T        E+ + Y+L   + +P L Y     IR               + S        + +     +YL           L  D   + S+   QSN +V +TQ+   +  Y  NG  K G     Y+F P    ++P  +A ++ I+ G LVTE+ Q F            I +RL      +D  +L    E E+  GP+ +N    +E VL+  T+++S    ++D+NG Q+      +R  Y       +A NYYP+    F+     ++ K  LV+ ++RA G+ S  NG +E+M+HRR    FD + G    LN+T       +V    W+         +  +  +L + +RPVV+F         +    Q  A+   LP  ++  ILS+          E+  NL      E    + RV    Y              + +N + + +++  +  V E +L+    L  + R  W +    ++   TS        I+T+ P +IRTF I
Sbjct:   20 GVQSAGP-----IRAFVVPHSHMDVGWVYTVQESMRAYAANV--------YTSVVEELARGQQRRFIAVEQEFFRLWWDGVASDQQKYQVRQLLEEGRLEFVIGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGI--RPQFSWHVDPFGASATTPTLFALAGFNAHLGSRIDYDLKAAMQEARGLQFVWRGSPSLSE-RQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNGVAVFPKPPQDGVYPNMSEPVTPANINLYAEALVANVKQRAAWFRTPHVLWPWGCDKQFFNASVQFANMDPLLDHINSHAAELGVSVQYATLGDYFRALHALNVTWRVRDHHDFLPYSTEPFQAWTGFYTSRSSLKGLARRASALLYAGESMFTRYLWPAPRGHLDPTWALQQLQQLRWAVSEVQHHDAITGTESPKVRDMYATHLASGMLGMRKLMAS--------------IVLDELQPQAPMAASSDAGPAGHFAS-VYNPLAWTVTTIVTLTVGF---PGVRVTDEAGHPVPSQ---IQNST--------ETPSAYDLLILTTIPGLSYRHYN-IRPTAGAQEGTQEPAATVASTLQFGRRLRRRTSHAGRYLVPVANDCYIVLLDQDTNLMHSIWERQSNRTVRVTQE---FLEYHVNGDVKQGPISDNYLFTP-GKAAVPAWEAVEMEIVAGQLVTEIRQYFYRNMTAQNYTYAIRSRLTHVPQGHDGELLCHRIEQEYQAGPLELN----REAVLRTSTNLNSQQVIYSDNNGYQM------QRRPYVSYVNNSIARNYYPMVQSAFM-----EDGKSRLVLLSERAHGISSQGNGQVEVMLHRRLWNNFDWDLGYNLTLNDTS------VVHPVLWLLLGSWSLTTALRQRSALALQHRPVVLFGDLAGTAPKLPGPQQQEAV--TLPPNLHLQILSIPGWRYSSNHTEHSQNLRKGHRGEAQADLRRVLLRLYHLYEVGEDPVLSQPVTVNLEAVLQALGSVVAVEERSLTGTWDLSMLHRWSWRTGPGRHRGDTTSPSRPPGGPIITVHPKEIRTFFI 1004          
BLAST of Alpha-mannosidase vs. Ensembl Human
Match: MAN2A2 (mannosidase alpha class 2A member 2 [Source:HGNC Symbol;Acc:HGNC:6825])

HSP 1 Score: 253.447 bits (646), Expect = 4.185e-69
Identity = 226/848 (26.65%), Postives = 384/848 (45.28%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSF---LPTKIHNYLFTNVLYD--SYCTP-PGFC--FDDKCSDDPIMDDP------TLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQF---QNANHNFVNLDKLI-FHVNRLRKDINVFYSTPACYTLAXXXXXXXXXXX--------XDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL--SQQNRTDLNKK-------IISMAMK-MGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLI--SKETVNYD----FVLCNLLNISFCAISDNISY---TKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQL-VPITNCTKHLPERPKESLANYELTFQSVLPAL------------GYASLTII-------RXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMR-YYFSYQGNGQKSGAYIFRPTTNESMPLT--KAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGP-IPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNE 2497
            L V ++ H+H+D GW+KT D+YY            Q+ILN+++S L E+P R+F + E+++F +WW   +   R  V+ LV  G+L+   GGW M DEA +HY ++IDQ+  G  +L +  G    P   W +DPFG+S     +        +   R+ Y  K+   AT ++EF+ + ++     T I  ++     YD    C P P  C  FD K      ++ P       + + NV +R     D   K+S+ +++N LLVP+G DF++   Q  +  F N  +L  F  +R    +   + T + Y  A+ K                + DFF YA   + YWTGY+TSR   K   +      +  + L+ L  +   R+ L  +       +++ A + +G+ QHHDA++GT K+ V  DY  RL   L + + VI  +   L+   KET ++D    F+  +   +S  A+ +       +    V+++NPL   R     + VN       ++    G  +  Q+    ++ T+ +P+        Y+++    LPAL            G+ +L          R    +           +      + N+Y+++ +     +  S  + +       DM+   +  + +  KSGAY+F P   E+ P    + P L + +G   +EV   +      V RLYN   +      +   + I D   KE+ L   TDIDS   FFTD NG Q+  R+  K+         P+  N+YP+    ++     ++ +K L +HT +A GV S K+G +E+++ RR + DDN G+G+ L +
Sbjct:  166 LQVFVVPHSHNDPGWIKTFDKYY--------TEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINVQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGAT--PRSGWAVDPFGYSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSQLFRSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFFNSRPNLHVQAQFGTLSDYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHARRSGLAGRYPLSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQERFSMVSLLVN---SPRVRVLSEEGQPLAVQISAHWSSATEAVPD-------VYQVSVPVRLPALGLGVLQLQLGLDGHRTLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKDKSGAYLFLP-DGEAKPYVPKEPPVLRVTEGPFFSEVVAYYEHIHQAV-RLYNLPGVEGLSLDISSLVDIRDYVNKELALHIHTDIDSQGIFFTDLNGFQVQPRRYLKKL--------PLQANFYPMPVMAYI-----QDAQKRLTLHTAQALGVSSLKDGQLEVILDRRLMQDDNRGLGQGLKD 978          
BLAST of Alpha-mannosidase vs. Ensembl Human
Match: MAN2A2 (mannosidase alpha class 2A member 2 [Source:HGNC Symbol;Acc:HGNC:6825])

HSP 1 Score: 253.447 bits (646), Expect = 4.185e-69
Identity = 226/848 (26.65%), Postives = 384/848 (45.28%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSF---LPTKIHNYLFTNVLYD--SYCTP-PGFC--FDDKCSDDPIMDDP------TLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQF---QNANHNFVNLDKLI-FHVNRLRKDINVFYSTPACYTLAXXXXXXXXXXX--------XDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL--SQQNRTDLNKK-------IISMAMK-MGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLI--SKETVNYD----FVLCNLLNISFCAISDNISY---TKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQL-VPITNCTKHLPERPKESLANYELTFQSVLPAL------------GYASLTII-------RXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMR-YYFSYQGNGQKSGAYIFRPTTNESMPLT--KAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGP-IPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNE 2497
            L V ++ H+H+D GW+KT D+YY            Q+ILN+++S L E+P R+F + E+++F +WW   +   R  V+ LV  G+L+   GGW M DEA +HY ++IDQ+  G  +L +  G    P   W +DPFG+S     +        +   R+ Y  K+   AT ++EF+ + ++     T I  ++     YD    C P P  C  FD K      ++ P       + + NV +R     D   K+S+ +++N LLVP+G DF++   Q  +  F N  +L  F  +R    +   + T + Y  A+ K                + DFF YA   + YWTGY+TSR   K   +      +  + L+ L  +   R+ L  +       +++ A + +G+ QHHDA++GT K+ V  DY  RL   L + + VI  +   L+   KET ++D    F+  +   +S  A+ +       +    V+++NPL   R     + VN       ++    G  +  Q+    ++ T+ +P+        Y+++    LPAL            G+ +L          R    +           +      + N+Y+++ +     +  S  + +       DM+   +  + +  KSGAY+F P   E+ P    + P L + +G   +EV   +      V RLYN   +      +   + I D   KE+ L   TDIDS   FFTD NG Q+  R+  K+         P+  N+YP+    ++     ++ +K L +HT +A GV S K+G +E+++ RR + DDN G+G+ L +
Sbjct:  166 LQVFVVPHSHNDPGWIKTFDKYY--------TEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINVQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGAT--PRSGWAVDPFGYSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSQLFRSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFFNSRPNLHVQAQFGTLSDYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHARRSGLAGRYPLSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQERFSMVSLLVN---SPRVRVLSEEGQPLAVQISAHWSSATEAVPD-------VYQVSVPVRLPALGLGVLQLQLGLDGHRTLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKDKSGAYLFLP-DGEAKPYVPKEPPVLRVTEGPFFSEVVAYYEHIHQAV-RLYNLPGVEGLSLDISSLVDIRDYVNKELALHIHTDIDSQGIFFTDLNGFQVQPRRYLKKL--------PLQANFYPMPVMAYI-----QDAQKRLTLHTAQALGVSSLKDGQLEVILDRRLMQDDNRGLGQGLKD 978          
BLAST of Alpha-mannosidase vs. Ensembl Celegans
Match: aman-1 (Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q20829])

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 369/959 (38.48%), Postives = 559/959 (58.29%), Query Frame = 2
Query:   68 VSLIINILFFG---IYSSPTTCGYNSCNP--GKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLY-DSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNR-LRKDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDK----IVIGNKYLKLTYDN-GFXXXXXXXXXXXXXXITQDMRYYFSYQG----NGQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIP--INDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFD---QYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFY-QFGHSIK-LNFQKMFRSIKITEVIELNLSANQFL 2875
            ++L +  LF G   IYSS   C +N+C+     PNV+  H+I HTHDD+GW+KTVDQY++G +  +   GVQYI NTVI  L +NP+R+FS+ E  + +RW+       R++++ LV  G+++ + GGW  NDEAT+HYV IIDQM+LGL  L + FGECG+P+  WQIDPFGHS E ANI+  MG+  ++F R+ Y +K+ R+  K +EF+   S   T   N LFT   + D+Y  P GFC+D  C DDPIMD+  +  YNV+++VD F D+V  Q+    TN +++ MG DFQ+ NAN  +VNLDKLI +VN    K + V YSTPACYT A+      L +K+DDFFPYASG +SYWTGYFTSR A KG ++ ++ + Q+ KQL V++     D +  I  +     + QHHDAV+GT K++V  DY ++L+ G+S+ E VIN  + K+ + + ++   VLC L+N + C     I+ +   +V+I+N  G       RIP +       + +H N  ++ SQ+V     T  + +        YE+     +P LGY ++ + +              + N++ K    + I N+YL   +D+ G+L  ++   +    +I Q+   +F Y+G    + Q SGAYIFRP T + + LT    L ++ G ++ EV Q  S +     RL    N +E EW VGPIP    +   KE V +Y T++ S N  FTDSNGRQ + R  +  T + ++ TEP+AGNYYP+ S  ++     K+      + TDRA G+ +  +G++EIM+HRR  +DD+FGV E L+E G DG GL+  GK  + F  +    S++R  ++  F++PV+ F+KN    +F+   +YS L   LP G+++L+LE     ++     +IR EN+++ + G+SIK  +   +F +  I    EL L AN+ +
Sbjct:    1 MNLQVIFLFLGLLVIYSS-QDCAWNTCHKVDQDPNVITAHLIPHTHDDLGWIKTVDQYFWGAKPELVPVGVQYIYNTVIDELLKNPDRRFSFAETGFLWRWYTSNSDFDRHQLQKLVKNGQIEIIGGGWVQNDEATSHYVDIIDQMTLGLQRLEQIFGECGKPVTGWQIDPFGHSREMANIYREMGYSSVYFARIHYLEKQIRLKNKTLEFMWNTSDDITD--NKLFTGAFFNDNYGPPEGFCWDSLCGDDPIMDNLNIEGYNVKEKVDAFVDHVKNQAAHQSTNQVMLLMGSDFQYTNANSWYVNLDKLIKYVNADTSKKVRVIYSTPACYTKAVQAKTPTLSVKHDDFFPYASGRHSYWTGYFTSRPAFKGMIRQASCMLQLAKQLDVIANLGPED-DSDIEILREASALVQHHDAVTGTAKENVTRDYEKQLAKGVSEVEVVINDFMKKM-NPDGLDPKLVLCPLINETICK---PINGSSEFSVVIFNSNGRYFNGTIRIPYSQKTA-VLRDAHKN--VLESQIVE----TFQIDQLKDTDRLPYEIHVFVRVPPLGYTTVFVEK-------GSKPERVHFNNRKKFNTNVEIQNEYLIAGFDSQGYLSYITEKATKKKRSIRQE---FFYYEGIDSKDDQPSGAYIFRPKTQQPIALTSKLALEVVPGAIINEVRQKVSPFVSQQIRLPRGKNYIEFEWIVGPIPKETKNPITKEFVTRYTTEVHSKNQSFTDSNGRQAMERFFDGATSFEYSDTEPIAGNYYPITSFGYI-----KDENAQFSVITDRAQGMVA-SDGVVEIMLHRRCFYDDHFGVEEALDEPGKDGAGLVAMGKHIVLFTDVKASTSQLRPLAIDNFHQPVLAFNKNPEKFEFNRLLEYSGLKFELPIGIHLLTLEKWHKKSS-----LIRFENIYHGEEGNSIKEFDPTHIFTNFDIVSFKELLLGANRVV 923          
BLAST of Alpha-mannosidase vs. Ensembl Celegans
Match: aman-1 (Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q20829])

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 369/959 (38.48%), Postives = 559/959 (58.29%), Query Frame = 2
Query:   68 VSLIINILFFG---IYSSPTTCGYNSCNP--GKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLY-DSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNR-LRKDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDK----IVIGNKYLKLTYDN-GFXXXXXXXXXXXXXXITQDMRYYFSYQG----NGQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIP--INDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFD---QYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFY-QFGHSIK-LNFQKMFRSIKITEVIELNLSANQFL 2875
            ++L +  LF G   IYSS   C +N+C+     PNV+  H+I HTHDD+GW+KTVDQY++G +  +   GVQYI NTVI  L +NP+R+FS+ E  + +RW+       R++++ LV  G+++ + GGW  NDEAT+HYV IIDQM+LGL  L + FGECG+P+  WQIDPFGHS E ANI+  MG+  ++F R+ Y +K+ R+  K +EF+   S   T   N LFT   + D+Y  P GFC+D  C DDPIMD+  +  YNV+++VD F D+V  Q+    TN +++ MG DFQ+ NAN  +VNLDKLI +VN    K + V YSTPACYT A+      L +K+DDFFPYASG +SYWTGYFTSR A KG ++ ++ + Q+ KQL V++     D +  I  +     + QHHDAV+GT K++V  DY ++L+ G+S+ E VIN  + K+ + + ++   VLC L+N + C     I+ +   +V+I+N  G       RIP +       + +H N  ++ SQ+V     T  + +        YE+     +P LGY ++ + +              + N++ K    + I N+YL   +D+ G+L  ++   +    +I Q+   +F Y+G    + Q SGAYIFRP T + + LT    L ++ G ++ EV Q  S +     RL    N +E EW VGPIP    +   KE V +Y T++ S N  FTDSNGRQ + R  +  T + ++ TEP+AGNYYP+ S  ++     K+      + TDRA G+ +  +G++EIM+HRR  +DD+FGV E L+E G DG GL+  GK  + F  +    S++R  ++  F++PV+ F+KN    +F+   +YS L   LP G+++L+LE     ++     +IR EN+++ + G+SIK  +   +F +  I    EL L AN+ +
Sbjct:    1 MNLQVIFLFLGLLVIYSS-QDCAWNTCHKVDQDPNVITAHLIPHTHDDLGWIKTVDQYFWGAKPELVPVGVQYIYNTVIDELLKNPDRRFSFAETGFLWRWYTSNSDFDRHQLQKLVKNGQIEIIGGGWVQNDEATSHYVDIIDQMTLGLQRLEQIFGECGKPVTGWQIDPFGHSREMANIYREMGYSSVYFARIHYLEKQIRLKNKTLEFMWNTSDDITD--NKLFTGAFFNDNYGPPEGFCWDSLCGDDPIMDNLNIEGYNVKEKVDAFVDHVKNQAAHQSTNQVMLLMGSDFQYTNANSWYVNLDKLIKYVNADTSKKVRVIYSTPACYTKAVQAKTPTLSVKHDDFFPYASGRHSYWTGYFTSRPAFKGMIRQASCMLQLAKQLDVIANLGPED-DSDIEILREASALVQHHDAVTGTAKENVTRDYEKQLAKGVSEVEVVINDFMKKM-NPDGLDPKLVLCPLINETICK---PINGSSEFSVVIFNSNGRYFNGTIRIPYSQKTA-VLRDAHKN--VLESQIVE----TFQIDQLKDTDRLPYEIHVFVRVPPLGYTTVFVEK-------GSKPERVHFNNRKKFNTNVEIQNEYLIAGFDSQGYLSYITEKATKKKRSIRQE---FFYYEGIDSKDDQPSGAYIFRPKTQQPIALTSKLALEVVPGAIINEVRQKVSPFVSQQIRLPRGKNYIEFEWIVGPIPKETKNPITKEFVTRYTTEVHSKNQSFTDSNGRQAMERFFDGATSFEYSDTEPIAGNYYPITSFGYI-----KDENAQFSVITDRAQGMVA-SDGVVEIMLHRRCFYDDHFGVEEALDEPGKDGAGLVAMGKHIVLFTDVKASTSQLRPLAIDNFHQPVLAFNKNPEKFEFNRLLEYSGLKFELPIGIHLLTLEKWHKKSS-----LIRFENIYHGEEGNSIKEFDPTHIFTNFDIVSFKELLLGANRVV 923          
BLAST of Alpha-mannosidase vs. Ensembl Celegans
Match: aman-1 (Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q20829])

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 369/959 (38.48%), Postives = 559/959 (58.29%), Query Frame = 2
Query:   68 VSLIINILFFG---IYSSPTTCGYNSCNP--GKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLY-DSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNR-LRKDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDK----IVIGNKYLKLTYDN-GFXXXXXXXXXXXXXXITQDMRYYFSYQG----NGQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIP--INDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFD---QYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFY-QFGHSIK-LNFQKMFRSIKITEVIELNLSANQFL 2875
            ++L +  LF G   IYSS   C +N+C+     PNV+  H+I HTHDD+GW+KTVDQY++G +  +   GVQYI NTVI  L +NP+R+FS+ E  + +RW+       R++++ LV  G+++ + GGW  NDEAT+HYV IIDQM+LGL  L + FGECG+P+  WQIDPFGHS E ANI+  MG+  ++F R+ Y +K+ R+  K +EF+   S   T   N LFT   + D+Y  P GFC+D  C DDPIMD+  +  YNV+++VD F D+V  Q+    TN +++ MG DFQ+ NAN  +VNLDKLI +VN    K + V YSTPACYT A+      L +K+DDFFPYASG +SYWTGYFTSR A KG ++ ++ + Q+ KQL V++     D +  I  +     + QHHDAV+GT K++V  DY ++L+ G+S+ E VIN  + K+ + + ++   VLC L+N + C     I+ +   +V+I+N  G       RIP +       + +H N  ++ SQ+V     T  + +        YE+     +P LGY ++ + +              + N++ K    + I N+YL   +D+ G+L  ++   +    +I Q+   +F Y+G    + Q SGAYIFRP T + + LT    L ++ G ++ EV Q  S +     RL    N +E EW VGPIP    +   KE V +Y T++ S N  FTDSNGRQ + R  +  T + ++ TEP+AGNYYP+ S  ++     K+      + TDRA G+ +  +G++EIM+HRR  +DD+FGV E L+E G DG GL+  GK  + F  +    S++R  ++  F++PV+ F+KN    +F+   +YS L   LP G+++L+LE     ++     +IR EN+++ + G+SIK  +   +F +  I    EL L AN+ +
Sbjct:    1 MNLQVIFLFLGLLVIYSS-QDCAWNTCHKVDQDPNVITAHLIPHTHDDLGWIKTVDQYFWGAKPELVPVGVQYIYNTVIDELLKNPDRRFSFAETGFLWRWYTSNSDFDRHQLQKLVKNGQIEIIGGGWVQNDEATSHYVDIIDQMTLGLQRLEQIFGECGKPVTGWQIDPFGHSREMANIYREMGYSSVYFARIHYLEKQIRLKNKTLEFMWNTSDDITD--NKLFTGAFFNDNYGPPEGFCWDSLCGDDPIMDNLNIEGYNVKEKVDAFVDHVKNQAAHQSTNQVMLLMGSDFQYTNANSWYVNLDKLIKYVNADTSKKVRVIYSTPACYTKAVQAKTPTLSVKHDDFFPYASGRHSYWTGYFTSRPAFKGMIRQASCMLQLAKQLDVIANLGPED-DSDIEILREASALVQHHDAVTGTAKENVTRDYEKQLAKGVSEVEVVINDFMKKM-NPDGLDPKLVLCPLINETICK---PINGSSEFSVVIFNSNGRYFNGTIRIPYSQKTA-VLRDAHKN--VLESQIVE----TFQIDQLKDTDRLPYEIHVFVRVPPLGYTTVFVEK-------GSKPERVHFNNRKKFNTNVEIQNEYLIAGFDSQGYLSYITEKATKKKRSIRQE---FFYYEGIDSKDDQPSGAYIFRPKTQQPIALTSKLALEVVPGAIINEVRQKVSPFVSQQIRLPRGKNYIEFEWIVGPIPKETKNPITKEFVTRYTTEVHSKNQSFTDSNGRQAMERFFDGATSFEYSDTEPIAGNYYPITSFGYI-----KDENAQFSVITDRAQGMVA-SDGVVEIMLHRRCFYDDHFGVEEALDEPGKDGAGLVAMGKHIVLFTDVKASTSQLRPLAIDNFHQPVLAFNKNPEKFEFNRLLEYSGLKFELPIGIHLLTLEKWHKKSS-----LIRFENIYHGEEGNSIKEFDPTHIFTNFDIVSFKELLLGANRVV 923          
BLAST of Alpha-mannosidase vs. Ensembl Celegans
Match: aman-2 (Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q2PJ74])

HSP 1 Score: 224.557 bits (571), Expect = 5.799e-60
Identity = 208/831 (25.03%), Postives = 380/831 (45.73%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVL----YD--SYCTP-PGFC--FDDK------CSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQ---NANHNFVNLDKLIFHVNRLRK-DINVFYSTPACY----TLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSR---SALKGFVQYSNNVFQVCKQLHVLSQQNRTDLN--KKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLAN--YELTFQSVLPALGYASLTIIRXXXXXXXX---------XXXXXXXINSKDKIVIGNKYLKLTYD--NGFXXXXXXXXXXXXXXITQDMRYYFSYQ-----GNGQK---SGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIP---------INDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGV 2479
            L V +I H+H D GW+ T ++YY     NI        L+ +   L E    +F Y EI++F  WW+ Q   ++ +VK  +  G+ + + GGW M DEA  HY S+I ++  G +++    G+   P   W IDPFG S    ++  S         R+ Y  K +    KN+EF  +  F  T  H  L ++++    YD    C P P  C  FD +       S D  +    ++D NV  R +   D   K+S+ ++ N +  P+G DF++      N  + N  KL  ++N   + +++  + T + Y      AI+  G++L   + DFF YA   + YW+GYFTSR     L   +Q+     ++   L  + ++   +    +K+++    + + QHHD V+GT K HV  DY Q++ D L+ CE +++ +L  L+  ++ N   +  + +N +   + +   Y     V+++N L   R E   I V+ L         ++  +   Q+ P+    +   E+    + N  +EL F   L  +   S  ++++  ++            K ++ K+ ++     + N  ++  +D  NG +   ++L  +  +++     +Y + +      NG +   +GAY+F P         ++    ++KG++V +V    +          ND  IL+T      +P         +   +  E+ L++ + ++S + FFTD NG Q+I R+   +         P   N+YP+++ V++ +   +     + IH+ +A GV S  +G IEIM+ RR   DDN G+
Sbjct:  181 LEVIVIPHSHCDPGWIMTFEEYYNRQTRNI--------LDGMAKHLAEKDEMRFIYAEISFFETWWRDQADEIKKKVKGYLEAGKFEIVTGGWVMTDEANAHYHSMITELFEGHEWIQNHLGKSAIPQSHWSIDPFGLSPSMPHLLTSANITNAVIQRVHYSVKRELALKKNLEFYWRQLFGSTG-HPDLRSHIMPFYSYDIPHTCGPEPSVCCQFDFRRMPEGGKSCDWGIPPQKINDDNVAHRAEMIYDQYRKKSQLFKNNVIFQPLGDDFRYDIDFEWNSQYENYKKLFEYMNSKSEWNVHAQFGTLSDYFKKLDTAISASGEQLPTFSGDFFTYADRDDHYWSGYFTSRPFYKQLDRVLQHYLRSAEIAFTLANIEEEGMVEAKIFEKLVTARRALSLFQHHDGVTGTAKDHVVLDYGQKMIDALNACEDILSEALVVLLGIDSTNKMQMDEHRVNENL--LPEKRVYKIGQNVVLFNTLSRNRNEPICIQVDSLDAG----VEADPPIKKQQVSPVIAYDE---EKKTLVVKNGIFELCFMLSLGPMESVSFRLVKNTTTSKVEIITNNAAEFKETSFKSSSTSGDFTVKNDKVEAEFDGENGMIKRATSLVDDKPIDLNSHFIHYGARKSKRKFANGNEDNPAGAYLFLPDGEARELKKQSSDWILVKGEVVQKVFATPN----------NDLKILQTYTLYQGLPWIDLDNEVDVRSKENFELALRFSSSVNSGDEFFTDLNGMQMIKRRRQTKL--------PTQANFYPMSAGVYIEDDTTR-----MSIHSAQALGVSSLSSGQIEIMLDRRLSSDDNRGL 970          
BLAST of Alpha-mannosidase vs. Ensembl Celegans
Match: aman-3 (Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:O01574])

HSP 1 Score: 136.346 bits (342), Expect = 2.810e-32
Identity = 121/456 (26.54%), Postives = 196/456 (42.98%), Query Frame = 2
Query:   95 FGIYSSPTTCGYNSCNPG----KPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDK---CSDD---------PIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQ-----NANH-NFVNLDKLIFHVNRLR----------KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALK--GFVQYS--NNVFQVCKQLHVLSQQNRTDLNKKIISMAMK-MGVAQHHDAVSGTEKQHVAFDYAQRL 1351
            F ++ S    G N+  P     +   L V+++  TH D GWL+T ++Y               IL+ +   + +N   +F + E  +F RWW  Q+  V+  VK LV EGRL+   G W M DEA  ++   +D +  G  F++K FG   +P   W  DPFG+S     +F   G       R+ ++ K+   + K + F  +  F  T   + L T +L  ++      C  D    C  D         P      + + NV  + +   + + K S+ Y+   +L+  G DF+F      N  H NF+ +   I   +R+            D+  +YS              +    + DFFPY      YWTGY+T+R   K  G + +S   N   +   L V  +Q +   N K +  A + + + QHHDA++GT K  V  +Y++ L
Sbjct:  112 FDLFESVVAKG-NTLPPASKKSRTEKLKVYVLPFTHVDPGWLETFERY---------TKSTNQILDNMHQFMMKNEKMRFMWAEFVFFERWWSLQNEQVKEDVKKLVTEGRLELATGSWVMTDEANPYFPVSVDNIVEGFQFIHKNFG--IKPQTMWSNDPFGYSNSVPYLFKKSGVHRTVINRIHHKLKQTLQSQKAIPFKWRQYFDATGEDDVL-TQILPYTHYDILNSCGSDASVCCEFDFKRMTHWSCPGPKPEKITNANVAAKAEKLVNQLEKMSEMYKAPVILMMHGDDFRFDMIEEWNQQHDNFIPVFDEINKGSRVEIRFGTFTDYFNDLEKWYSN---------NKDSEPPTVSGDFFPYMCALGDYWTGYYTTRPFFKRQGRLLHSLIRNGDIMLSMLRVNLKQRKIGENVKRLEAARRNLALFQHHDAITGTSKVSVMDNYSELL 545          
BLAST of Alpha-mannosidase vs. Ensembl Fly
Match: LManII (gene:FBgn0027611 transcript:FBtr0080030)

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 408/992 (41.13%), Postives = 580/992 (58.47%), Query Frame = 2
Query:   29 AKL*NFIMAFILVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLI--SKETVN-------YDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSV-LPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYD-NGFXXXXXXXXXXXXXXITQDMRYYFSYQGN-----GQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFD--------YIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDN--------LPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKW 2899
            AK   +++ F  +  LI +     I    + CGY SC+P KPN+LNVH+++HTHDDVGWLKTVDQYYYG    IQ AGVQYI+++V+ AL  +P ++F YVE A+F++WW++Q   V+  VK+LV +GRL+F+ G W MNDEATTHY S+IDQ S GL  LN TFGECGRP V WQIDPFGHS E A++FA MGFDG+FF RLDY+DK++R+ TKN E I  GS    +  + LF+  LY++Y  P GFCFD  C+D PI+D     D NV++R+D F D+   QS+ Y+TN+++V MG DF +Q A   + NLDKLI + N  +    +IN+ YSTP+CY  +++  G     K+DDFFPYAS P++YWTGYFTSR  LK F +  N+  QVCKQL  L+ +   + +  +  M   +G+ QHHDA++GTEK+ VA DYA+R+S     C +   ++L++L   SK+ V        ++F  C LLNI+ C +S+         + +YNPL  T  E+ RIPV       Y+I  + G  + SQ VPI      +  R   S A YE+ F +  +PALGY +  + +   +   T+S  +    S    VIGN +++L +D NGF          ++  ++Q+  +Y    GN      + SGAYIFRP  N+    T   ++ + KGDLV EVHQ F++W   V R+YN  +  E EW VGPIPI+D  GKE++ ++ +DI SD  F TDSNGR++I R+IN R  ++    E VAGNYYP+ +     +++ ++    + I TDRA G  S K+G +E+MVHRR L DD FGVGE LNET   G+GLI RGK  + F          +  I    +LE L     P   F  N      D++     N        LP  V++L+LE        + ++ I        +   ++ N + +  +  +  + E  L  N +L + +RL++
Sbjct:    3 AKTSVWLVFFCALGCLIHDADLRSIQPKASQCGYQSCHPTKPNMLNVHLVAHTHDDVGWLKTVDQYYYGSETKIQKAGVQYIIDSVVEALLRDPEKRFIYVESAFFFKWWKEQKPKVQEAVKMLVEQGRLEFIGGAWSMNDEATTHYQSVIDQFSWGLRLLNDTFGECGRPRVGWQIDPFGHSREMASMFAQMGFDGMFFGRLDYQDKDERLMTKNAEMIWHGSANLGEEAD-LFSGALYNNYQAPDGFCFDILCNDAPIIDGKHSPDNNVKERIDTFLDFAKTQSQYYRTNNIIVTMGGDFTYQAAQVYYKNLDKLIRYGNERQANGSNINLLYSTPSCYLKSLHDAGITWPTKSDDFFPYASDPHAYWTGYFTSRPTLKRFERDGNHFLQVCKQLSALAPKKPEEFDPHLTFMRETLGIMQHHDAITGTEKEKVALDYAKRMSVAFRACGATTRNALNQLTVQSKDNVKDTSAKYVFEFKTCALLNITSCPVSEA---NDRFALTLYNPLAHTVNEYVRIPVPY---SNYRIIDNKGVTLESQAVPIPQVLIDIKHR--NSTAKYEIVFLATNIPALGYRTYYVEKLDSTEGNTRSKALPKRTSS-VTVIGNSHIQLGFDTNGF--LSEVTADGLTRLVSQEFLFYEGAVGNNAEFLNRSSGAYIFRPNENKIHFATDQVEIEVYKGDLVHEVHQKFNDWISQVVRVYNKDSYAEFEWLVGPIPIDDGIGKEVITRFNSDIASDGIFRTDSNGREMIKRKINHRDTWSVKINEAVAGNYYPITT-----KIDVEDDTARMAILTDRAQGGSSLKDGSLELMVHRRLLKDDAFGVGEALNETEY-GDGLIARGKHHLFFGKSTDREGVSLKGIERLTQLEKL----LPTWKFFSNMEDYSADEWQTAFTNIFSGISLVLPKPVHLLTLEPWHENQLLVRFEHIMENGEDASYSQPVQFNVKNVLSAFDVEGIRETTLDGNAWLDESRRLQF 972          
BLAST of Alpha-mannosidase vs. Ensembl Fly
Match: LManII (gene:FBgn0027611 transcript:FBtr0080031)

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 406/992 (40.93%), Postives = 581/992 (58.57%), Query Frame = 2
Query:   29 AKL*NFIMAFILVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLI--SKETVN-------YDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSV-LPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYD-NGFXXXXXXXXXXXXXXITQDMRYYFSYQGN-----GQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFD--------YIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDN--------LPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKW 2899
            AK   +++ F  +  LI +     I    + CGY SC+P KPN+LNVH+++HTHDDVGWLKTVDQYYYG    IQ AGVQYI+++V+ AL  +P ++F YVE A+F++WW++Q   V+  VK+LV +GRL+F+ G W MNDEATTHY S+IDQ S GL  LN TFGECGRP V WQIDPFGHS E A++FA MGFDG+FF RLDY+DK++R+ TKN E I  GS    +  + LF+  LY++Y  P GFCFD  C+D PI+D     D NV++RVD F  YV + ++ ++T ++++ MG DF +QNA+  + NLDKLI + N  +    +IN+ YSTP+CY  +++  G     K+DDFFPYAS P++YWTGYFTSR  LK F +  N+  QVCKQL  L+ +   + +  +  M   +G+ QHHDA++GTEK+ VA DYA+R+S     C +   ++L++L   SK+ V        ++F  C LLNI+ C +S+         + +YNPL  T  E+ RIPV       Y+I  + G  + SQ VPI      +  R   S A YE+ F +  +PALGY +  + +   +   T+S  +    S    VIGN +++L +D NGF          ++  ++Q+  +Y    GN      + SGAYIFRP  N+    T   ++ + KGDLV EVHQ F++W   V R+YN  +  E EW VGPIPI+D  GKE++ ++ +DI SD  F TDSNGR++I R+IN R  ++    E VAGNYYP+ +     +++ ++    + I TDRA G  S K+G +E+MVHRR L DD FGVGE LNET   G+GLI RGK  + F          +  I    +LE L     P   F  N      D++     N        LP  V++L+LE        + ++ I        +   ++ N + +  +  +  + E  L  N +L + +RL++
Sbjct:    3 AKTSVWLVFFCALGCLIHDADLRSIQPKASQCGYQSCHPTKPNMLNVHLVAHTHDDVGWLKTVDQYYYGSETKIQKAGVQYIIDSVVEALLRDPEKRFIYVESAFFFKWWKEQKPKVQEAVKMLVEQGRLEFIGGAWSMNDEATTHYQSVIDQFSWGLRLLNDTFGECGRPRVGWQIDPFGHSREMASMFAQMGFDGMFFGRLDYQDKDERLMTKNAEMIWHGSANLGEEAD-LFSGALYNNYQAPDGFCFDILCNDAPIIDGKHSPDNNVKERVDAFLAYVTEMAEHFRTPNVILTMGEDFHYQNADMWYKNLDKLIKYGNERQANGSNINLLYSTPSCYLKSLHDAGITWPTKSDDFFPYASDPHAYWTGYFTSRPTLKRFERDGNHFLQVCKQLSALAPKKPEEFDPHLTFMRETLGIMQHHDAITGTEKEKVALDYAKRMSVAFRACGATTRNALNQLTVQSKDNVKDTSAKYVFEFKTCALLNITSCPVSEA---NDRFALTLYNPLAHTVNEYVRIPVPY---SNYRIIDNKGVTLESQAVPIPQVLIDIKHR--NSTAKYEIVFLATNIPALGYRTYYVEKLDSTEGNTRSKALPKRTSS-VTVIGNSHIQLGFDTNGF--LSEVTADGLTRLVSQEFLFYEGAVGNNAEFLNRSSGAYIFRPNENKIHFATDQVEIEVYKGDLVHEVHQKFNDWISQVVRVYNKDSYAEFEWLVGPIPIDDGIGKEVITRFNSDIASDGIFRTDSNGREMIKRKINHRDTWSVKINEAVAGNYYPITT-----KIDVEDDTARMAILTDRAQGGSSLKDGSLELMVHRRLLKDDAFGVGEALNETEY-GDGLIARGKHHLFFGKSTDREGVSLKGIERLTQLEKL----LPTWKFFSNMEDYSADEWQTAFTNIFSGISLVLPKPVHLLTLEPWHENQLLVRFEHIMENGEDASYSQPVQFNVKNVLSAFDVEGIRETTLDGNAWLDESRRLQF 972          
BLAST of Alpha-mannosidase vs. Ensembl Fly
Match: LManV (gene:FBgn0032068 transcript:FBtr0079742)

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 403/1009 (39.94%), Postives = 589/1009 (58.37%), Query Frame = 2
Query:   50 MAFILVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD---INVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSK----DKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNGQKSGAYIFRPTTNESMPLTK-APKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFT-QTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPV-VVFSKNTNISKFDQYSA-LLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQF-GHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQ----NFFTSN-------------QMIVTLFPGQIRTFKI 2989
            M F+ +V L +  L     S+   CGY SC+  K N++N+H++ H+HDDVGWLKTVDQYYYG+R+NIQ AGVQYI++TVIS L +NP+R+F  VE ++F +WW +Q  T+R  VK+LVNEGRLQF+ G W MNDEA  +Y S+IDQ ++GL FL+ TFG CGRP V WQIDPFGHS EQA+I+A MGFDG FF R+D+ DK +R+    +E I   S   +++   LFT +LY  Y   PGFCFD  CSDDPI+D  + +D NV+ RVDDF  Y  + ++ ++TNH+++PMG DFQ+++A  N+ N+DKLI +VN  +      N+ YSTP CY  +++K  +    K  DFFPY S  NS+WTGY+TSR   K F +  N++ QV KQL   ++ + T   + +  +   MGV QHHDA++GTEKQHV+ DY + L D +         +L KL +    N +F  C  LNIS CA + + +   ++T  +YN L  T  ++ R+PV     + Y+++   G +V S++VP+      L  R  +S   +EL F++ +  +    +  + SK+S++  +  +    N++    ++ ++    +KL  DN   +      + VS NI Q    Y +Y      SGAY+FR        + +   + T+  G LV EVHQ FSE+   V R+  D   +E EW VGPIP+ +  G E+V  + ++I S+  F+TDSNGR++I R+ +KR D+      +P +GNYYP+ S + L + N     K L I  DRA G  S K+G IE+M+HRR + DD +GVGE LNE    G  LI RGK ++  +  D   S  R E+ K F+ P+   FSKNT  +     S    D+ P  V++L+LE  FN ++EI   ++RVEN      G  +  N + +F  +   E+ E  L  N  L D+K+ K+++     +     ++TS+             +  VTL+P QIRTF I
Sbjct:    1 MKFLGIV-LCVAFLALQAKSAQAVCGYESCHETKSNMINIHLVPHSHDDVGWLKTVDQYYYGHRNNIQHAGVQYIIDTVISELIKNPDRRFIQVETSFFSKWWNEQSETMRAVVKMLVNEGRLQFINGAWSMNDEAAVNYQSVIDQFTVGLKFLDDTFGVCGRPRVGWQIDPFGHSREQASIYAQMGFDGEFFSRMDHNDKGRRMNDLALEMIWDASESLSQVK--LFTGLLYTFYWDTPGFCFDVHCSDDPIIDSDS-YDNNVKSRVDDFIAYAAQVAEKFRTNHIMIPMGGDFQYEDAEVNYKNMDKLIKYVNERQSSGSKYNIIYSTPTCYLNSVHKSVQSYPNKTLDFFPYGSDTNSFWTGYYTSRPTQKRFERDGNHILQVAKQLSAFAELSSTQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAIVGGVKTAGDALRKLTN--LPNGEFESCLQLNISECAFTKDGADNVVVT--LYNALAHTTKQYVRVPVK---NENYQVTDEKGRVVASEIVPVPAEVLALEFR--DSDTQHELVFKASVDKIANYYIKKVDSKESSNGVRVISQPKANAETYDDEETIVQTSLIKLVLDNKTGLLKRVEMNGVSENIEQSYGLYRTYD-----SGAYVFRQYNQGDFVIQEDGVEFTVYDGALVKEVHQRFSEYISQVIRISEDKPYVEFEWLVGPIPVEEEFGTEVVTIFSSEIASNGVFYTDSNGRELIRREKDKREDFTPELAVQPTSGNYYPITSRIALQDSN-----KRLAILNDRAQGGTSMKDGQIELMLHRRLVRDDGYGVGEALNEEKY-GQPLIARGKVFLILNAADESTSAER-EAEKEFHLPLWKFFSKNTGSTTAAAKSVPSFDDFPKSVHLLTLEP-FN-DDEI---LLRVENFKDHIEGKVVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMKQFKFHAEGSGIRGSEPEYYTSSHKPLSANQTQDAAEFAVTLYPMQIRTFII 979          
BLAST of Alpha-mannosidase vs. Ensembl Fly
Match: LManV (gene:FBgn0032068 transcript:FBtr0345752)

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 403/1009 (39.94%), Postives = 589/1009 (58.37%), Query Frame = 2
Query:   50 MAFILVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD---INVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSK----DKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNGQKSGAYIFRPTTNESMPLTK-APKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFT-QTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPV-VVFSKNTNISKFDQYSA-LLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQF-GHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQ----NFFTSN-------------QMIVTLFPGQIRTFKI 2989
            M F+ +V L +  L     S+   CGY SC+  K N++N+H++ H+HDDVGWLKTVDQYYYG+R+NIQ AGVQYI++TVIS L +NP+R+F  VE ++F +WW +Q  T+R  VK+LVNEGRLQF+ G W MNDEA  +Y S+IDQ ++GL FL+ TFG CGRP V WQIDPFGHS EQA+I+A MGFDG FF R+D+ DK +R+    +E I   S   +++   LFT +LY  Y   PGFCFD  CSDDPI+D  + +D NV+ RVDDF  Y  + ++ ++TNH+++PMG DFQ+++A  N+ N+DKLI +VN  +      N+ YSTP CY  +++K  +    K  DFFPY S  NS+WTGY+TSR   K F +  N++ QV KQL   ++ + T   + +  +   MGV QHHDA++GTEKQHV+ DY + L D +         +L KL +    N +F  C  LNIS CA + + +   ++T  +YN L  T  ++ R+PV     + Y+++   G +V S++VP+      L  R  +S   +EL F++ +  +    +  + SK+S++  +  +    N++    ++ ++    +KL  DN   +      + VS NI Q    Y +Y      SGAY+FR        + +   + T+  G LV EVHQ FSE+   V R+  D   +E EW VGPIP+ +  G E+V  + ++I S+  F+TDSNGR++I R+ +KR D+      +P +GNYYP+ S + L + N     K L I  DRA G  S K+G IE+M+HRR + DD +GVGE LNE    G  LI RGK ++  +  D   S  R E+ K F+ P+   FSKNT  +     S    D+ P  V++L+LE  FN ++EI   ++RVEN      G  +  N + +F  +   E+ E  L  N  L D+K+ K+++     +     ++TS+             +  VTL+P QIRTF I
Sbjct:    1 MKFLGIV-LCVAFLALQAKSAQAVCGYESCHETKSNMINIHLVPHSHDDVGWLKTVDQYYYGHRNNIQHAGVQYIIDTVISELIKNPDRRFIQVETSFFSKWWNEQSETMRAVVKMLVNEGRLQFINGAWSMNDEAAVNYQSVIDQFTVGLKFLDDTFGVCGRPRVGWQIDPFGHSREQASIYAQMGFDGEFFSRMDHNDKGRRMNDLALEMIWDASESLSQVK--LFTGLLYTFYWDTPGFCFDVHCSDDPIIDSDS-YDNNVKSRVDDFIAYAAQVAEKFRTNHIMIPMGGDFQYEDAEVNYKNMDKLIKYVNERQSSGSKYNIIYSTPTCYLNSVHKSVQSYPNKTLDFFPYGSDTNSFWTGYYTSRPTQKRFERDGNHILQVAKQLSAFAELSSTQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAIVGGVKTAGDALRKLTN--LPNGEFESCLQLNISECAFTKDGADNVVVT--LYNALAHTTKQYVRVPVK---NENYQVTDEKGRVVASEIVPVPAEVLALEFR--DSDTQHELVFKASVDKIANYYIKKVDSKESSNGVRVISQPKANAETYDDEETIVQTSLIKLVLDNKTGLLKRVEMNGVSENIEQSYGLYRTYD-----SGAYVFRQYNQGDFVIQEDGVEFTVYDGALVKEVHQRFSEYISQVIRISEDKPYVEFEWLVGPIPVEEEFGTEVVTIFSSEIASNGVFYTDSNGRELIRREKDKREDFTPELAVQPTSGNYYPITSRIALQDSN-----KRLAILNDRAQGGTSMKDGQIELMLHRRLVRDDGYGVGEALNEEKY-GQPLIARGKVFLILNAADESTSAER-EAEKEFHLPLWKFFSKNTGSTTAAAKSVPSFDDFPKSVHLLTLEP-FN-DDEI---LLRVENFKDHIEGKVVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMKQFKFHAEGSGIRGSEPEYYTSSHKPLSANQTQDAAEFAVTLYPMQIRTFII 979          
BLAST of Alpha-mannosidase vs. Ensembl Fly
Match: LManVI (gene:FBgn0032069 transcript:FBtr0079741)

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 397/1034 (38.39%), Postives = 584/1034 (56.48%), Query Frame = 2
Query:   50 MAFILVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD---INVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPIT----------NCTKH--LPERPKESLANY---ELTFQSVLPALGY-----------ASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNGQKSGAYIFRPTTNESMPLT-KAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYN-FTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPV-VVFSKNTNISKFDQYSA-LLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVF-YQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQ----NFFTS-------------NQMIVTLFPGQIRTFKIVSK 2998
            M ++  + L + +L   +  S   CGY +C   K N++N+H++ H+HDDVGWLKTVDQY+YG+R NIQ AGVQYI++TVI+ L ++P R+F  VE ++F +WW +Q  T +  V+ LVNEGRL+F  G W MNDEA  +Y S+IDQ +LGL FL+ TFG C RP + WQIDPFGHS EQA+IFA MG+DG FF R+D+RDK  RI    ME I   S   +  ++ +FT +LY  Y  PPG+CFD  C DDPI+D  + +D NV+ RVDDF  YV   ++ Y++NH+++PMG DFQ+++A  NF N+DKLI +VN  + +    N+FYSTPACY  ++++  +    K  DFFPY S  NSYWTGYFTSR   K F +  N++ QV KQL V ++ N     + +  +   MGV QHHDA++GTEKQHV+ DY + L D +    +     L KL +    N +F  C  LNIS CA + + +   ++T  +YNPL  T  ++ R+PV     + Y+++   G +V S++VP+           N T+H  + +   + +ANY   ++  Q       +           A+L + +  K     K++T    + + + V+    +KL  DN   +  +   + VS NI Q    Y +Y      SGAY+FR        +  +  + T+  G LV EVHQ FSE+   V R+Y   N++E EW VGPI   +  G+E+V+ + + I SD   +TDSNGR++I R  ++R  +      +P A NYYPV S + L     ++ KK + +  DRA G  S  NG +E+M+HRR + DD +GVGE LNE    G  +I RGK ++     D   +  R E+ K  + P    FSKNT  +     S    ++ P  V++L+LE  FN ++E+   ++RVEN   +  G  +  N + +F  +   E+ E  L  N  L D+KR K++  +   +     +FTS             ++  VTL P QIRTF I ++
Sbjct:    1 MKYLCGIVLFVALLAISVRPSEEACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIWDAS--DSLSNDEIFTGLLYRHYSAPPGYCFDVHCGDDPIIDTKS-YDNNVKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNERQAEGSTFNLFYSTPACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQLSVFAELNTKQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILGGVNTARDGLRKLTN--LPNGEFESCLQLNISECAFTKDDADNVVVT--LYNPLAHTSTQYVRVPVK---NENYEVTDEKGRVVASEVVPVAWQVLALEFRNNDTQHELVFKASVDKIANYYIKKVASQETKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVIDNKTGLLKTVEMNGVSENIDQSYGVYRTYD-----SGAYVFRQYHQADFIVQYEGVEFTVYDGALVKEVHQQFSEYISQVIRIYEGKNLVEIEWQVGPIEREEEFGREVVIIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIAL-----QDSKKRIAVLNDRAQGGASMLNGQLELMLHRRLVRDDGYGVGEALNEEKY-GQPMIARGKVYLILSPSDESTAAER-EAEKEIHLPFWKFFSKNTGSTTAAAKSVPSFNDFPKSVHLLTLEP-FN-DDEV---LLRVENFLDHTEGQVVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMKRFKFHHDSSGQKPDAVEYFTSAHKPLAAEQSQEASEFSVTLHPMQIRTFIIKTE 1007          
BLAST of Alpha-mannosidase vs. Ensembl Zebrafish
Match: man2b1 (mannosidase, alpha, class 2B, member 1 [Source:ZFIN;Acc:ZDB-GENE-050327-52])

HSP 1 Score: 773.467 bits (1996), Expect = 0.000e+0
Identity = 433/988 (43.83%), Postives = 604/988 (61.13%), Query Frame = 2
Query:  101 IYSSPT----TCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTD---LNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWH-RIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKI--VIGNKYLKLTYDN--GFXXXXXXXXXXXXXXITQDMRYYFSYQGNG----QKSGAYIFRPTTNESMPLTKAPKLTIIK-GDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFD-QYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHS------IKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQMIVTLFPGQIRTF 2983
            ++S PT     CGY SC   KP++LNVH++ HTHDDVGWLKTVDQY+YG R+NIQ AGVQYIL++VI  L ++P R+F YVE A+FYRWW+QQ+   R  V  LVNEGRL+F+ GGWCM+DEATTHY ++IDQM+LGL FLN TFGECGRP V+W IDPFGH+ E A+IFA MG+DG FF RLDY+DK++R+ TK ME + + S   T     LFT VL + Y  P GFC+D  C D PI DDP L DYNV + V  F +   KQ+  Y+TNH+++ MG DFQ++NAN  + N+DKLI +VN L+     +NV YSTP+CY   +N       +K DDFFPYA   + +WTGYFTSR ALK + + SN+  Q C QL VL     T          +M   MGVAQHHDAVSGTEKQHVA DYA+RL+ G + CE ++++SL+ L   E      V C  LNIS C ++++   +   ++ +YNPLG T + W  R+PVN   G  Y ++ +NG  V S+++P++   K +  R     A  EL FQ   P LGY++  I                   SK+ +   I NK+LK+T+D+  G L SL+NL++  ++ +TQ+  +Y +  GN     Q SGAYIFRP +++   ++K  ++  +   + V EV Q FS W   V RLY D   LE EWTVGP+P+ D  GKE++ +  TDI S   F+TDSNGR+++ R+ + R  ++  QTEP+AGNYYP+NS  ++     K+ K+ L + TDR+ G  S  NG +EIM+HRR L+DD  GVGEPL+E G   +GL+ RG+  +     +      R  +  +  +P++ F           ++S L   LP  V++L++        + D  ++R+E+  YQ   S      + +N QK+F ++++    E++L ANQ+ +D+ RL WN T+         +   VTL P +IRTF
Sbjct:   20 VFSLPTGRNSICGYKSCPATKPSMLNVHLVPHTHDDVGWLKTVDQYFYGDRNNIQHAGVQYILDSVIDQLQKDPARRFIYVETAFFYRWWRQQNQNTRRIVTQLVNEGRLEFINGGWCMSDEATTHYSAVIDQMTLGLRFLNDTFGECGRPRVAWHIDPFGHAREHASIFAQMGYDGFFFGRLDYQDKDRRMKTKEMEMLWRASESLTPPIADLFTGVLPNGYNPPEGFCWDQSCDDAPIRDDPDLEDYNVDEIVQKFLNASHKQADYYKTNHIIMTMGSDFQYENANLWYKNMDKLIKYVNALQAKGSKLNVLYSTPSCYLQELNLANFTWPMKTDDFFPYADDAHDFWTGYFTSRPALKLYERLSNSRLQTCNQLEVLGGPTSTSGPFGEGDSDTMRRAMGVAQHHDAVSGTEKQHVANDYARRLATGWAHCEVLVSNSLAVLSGSEAPR---VFCENLNISVCPLTES---SHKFSMNVYNPLGRT-VRWPVRLPVN---GSVYNVTDANGKAVDSEVIPLSKSRKEV--RQNRGFAKSELVFQVEAPPLGYSTYII--------SMVQDQPPVSRSKNAVPSSIQNKFLKVTFDSTTGLLSSLTNLETQQTIRLTQNFFWYNASAGNNKESHQPSGAYIFRPNSSDPFIISKTAEIQAVSLYNSVQEVTQRFSPWVSQVVRLYEDRRELELEWTVGPVPVEDGLGKEVITRLDTDIQSSGYFYTDSNGREVLERRKDYRPTWDLKQTEPIAGNYYPINSRAYI-----KDDKRQLTVVTDRSQGASSIYNGSLEIMLHRRLLYDDFRGVGEPLSEPGEFAHGLVARGRLLLTLSPPEAAADLHRPLAQSMVLQPLLSFQDGAPSPGTKLEFSGLQAALPPAVHLLTVSQW-----DQDSVLVRLEHQ-YQAKESKTHSQPVTVNLQKLFSTLQVLGASEMSLGANQWKEDMIRLHWN-TDALPPTARDPSSWEVTLKPMEIRTF 975          
BLAST of Alpha-mannosidase vs. Ensembl Zebrafish
Match: man2b1 (mannosidase, alpha, class 2B, member 1 [Source:ZFIN;Acc:ZDB-GENE-050327-52])

HSP 1 Score: 288.886 bits (738), Expect = 8.642e-90
Identity = 138/236 (58.47%), Postives = 173/236 (73.31%), Query Frame = 2
Query:  101 IYSSPT----TCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCS 796
            ++S PT     CGY SC   KP++LNVH++ HTHDDVGWLKTVDQY+YG R+NIQ AGVQYIL++VI  L ++P R+F YVE A+FYRWW+QQ+   R  V  LVNEGRL+F+ GGWCM+DEATTHY ++IDQM+LGL FLN TFGECGRP V+W IDPFGH+ E A+IFA MG+DG FF RLDY+DK++R+ TK ME + + S   T     LFT  L        G+C  D+ +
Sbjct:   20 VFSLPTGRNSICGYKSCPATKPSMLNVHLVPHTHDDVGWLKTVDQYFYGDRNNIQHAGVQYILDSVIDQLQKDPARRFIYVETAFFYRWWRQQNQNTRRIVTQLVNEGRLEFINGGWCMSDEATTHYSAVIDQMTLGLRFLNDTFGECGRPRVAWHIDPFGHAREHASIFAQMGYDGFFFGRLDYQDKDRRMKTKEMEMLWRASESLTPPIADLFTGHL---EFINGGWCMSDEAT 252          
BLAST of Alpha-mannosidase vs. Ensembl Zebrafish
Match: man2a2 (mannosidase, alpha, class 2A, member 2 [Source:ZFIN;Acc:ZDB-GENE-110331-1])

HSP 1 Score: 263.077 bits (671), Expect = 1.810e-72
Identity = 235/857 (27.42%), Postives = 395/857 (46.09%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSF---LPTKIHNYLFTNVLYD--SYCTP-PGFC--FDDKCSDDPIMDDP------TLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNA---NHNFVNLDKLIFHVN-RLRKDINVFYSTPACY--------TLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSR-----------SALKGF-VQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMK-MGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCN--LLNISFCAISDNISYTKLLT-------VLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKL---TYDN------------GFXXXXXXXXXXXXXXITQDMRYYFSYQGNG-----QKSGAYIFRPTTNESMPLTK--APKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNI--LETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGN 2515
            L V ++ H+H+D GW+KT D+YY     N Q    Q+ILN +++ + E+P RKF + EI+YF +WW+  D   +  ++ L+  G+L+ + GGW M DEA  HY ++IDQ+  G  +L +  G    P   W +DPFGHS     +        +   R+ Y  K+   AT+++EF+ + ++     T +  ++     YD    C P P  C  FD K      ++ P       ++D NV +R     D   K+SK +++  LLVP+G DF++  A   +  ++N  KL  ++N      +   ++T + Y         +          + + DFF YA   + YW+GY+TSR           S L+G  + YS     V    H   +      +  +++ A + +G+ QHHDA++GT K+ V  DY  RL   L   + VI ++   LI K    Y F      L      A  D++    L+        ++++NP+   R+    + VN       ++   +G  +P QL         +      S   Y+ +F + LPALG A   +  S  S    +S T+  +  + + + G   L +   T D             GF  +   L+S    +  Q++R    +   G      KSGAY+F P  N + P ++  AP + +++G L  EV   +  +   V R++N   +  L  + T   + I D   KE+ +++ TDI S + F+TD NG QI  R+        + Q  P+  N+YP+ S  ++     ++ +  L +HT +A GV S  +G +E+++ RR + DDN G+G+ L +     N
Sbjct:  166 LQVFVVPHSHNDPGWIKTFDKYY-----NDQ---TQHILNNMVTKMAEDPRRKFIWSEISYFAKWWESADVHKQEVMRKLILSGQLEMVTGGWVMTDEANAHYFAMIDQLIEGHQWLERNLGVT--PRSGWAVDPFGHSATMPYLLKRANISSMLIQRVHYSIKKHFAATRSLEFMWRQAWDIESSTDMFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGSRVNCPWKVPPRAINDANVAERAGVLLDQYRKKSKLFRSKVLLVPLGDDFRYDKALEWDQQYLNYQKLFDYMNSHPEMHVKAQFATLSDYFDAVYKANGVTSGARPPDYPVLSGDFFAYADREDHYWSGYYTSRPFYKNLDRILESHLRGAEILYS---LAVAHARHAGVEGRYPVSDYSLLTDARRNIGLFQHHDAITGTAKEAVVIDYGNRLLRSLVGLKRVIINAAHFLIIKNKDIYRFYQTEPFLETDDRRATQDSLPQRTLIELESSPRYLVLFNPVEQERLCLVTVLVN---SARVRVLTEDGQTLPVQLSAQWMSATEM------SGEVYQASFMARLPALGLAVFHLYDSADSPMTLRSETLLRVPGRGQSIRGLDPLPVRSQTVDGQPFYIQSQSLTLGFSGATGLLESIRRKDDPQEVRVQIQFLTYGTRPSKDKSGAYLFLPDGN-AKPYSQREAPIVRVVEGPLFAEVVAHYQHFQQTV-RIHNVPGVDGLSLDITTM-VDIRDQNNKELAMRFVTDIQSGDTFYTDLNGFQIQPRR--------YFQKLPLQANFYPMPSTAYI-----QDSQYRLTLHTAQALGVTSLASGQLEVILDRRLMQDDNRGLGQGLKDNKRTAN 984          
BLAST of Alpha-mannosidase vs. Ensembl Zebrafish
Match: man2a2 (mannosidase, alpha, class 2A, member 2 [Source:ZFIN;Acc:ZDB-GENE-110331-1])

HSP 1 Score: 263.077 bits (671), Expect = 1.810e-72
Identity = 235/857 (27.42%), Postives = 395/857 (46.09%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSF---LPTKIHNYLFTNVLYD--SYCTP-PGFC--FDDKCSDDPIMDDP------TLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNA---NHNFVNLDKLIFHVN-RLRKDINVFYSTPACY--------TLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSR-----------SALKGF-VQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMK-MGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCN--LLNISFCAISDNISYTKLLT-------VLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKL---TYDN------------GFXXXXXXXXXXXXXXITQDMRYYFSYQGNG-----QKSGAYIFRPTTNESMPLTK--APKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNI--LETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGN 2515
            L V ++ H+H+D GW+KT D+YY     N Q    Q+ILN +++ + E+P RKF + EI+YF +WW+  D   +  ++ L+  G+L+ + GGW M DEA  HY ++IDQ+  G  +L +  G    P   W +DPFGHS     +        +   R+ Y  K+   AT+++EF+ + ++     T +  ++     YD    C P P  C  FD K      ++ P       ++D NV +R     D   K+SK +++  LLVP+G DF++  A   +  ++N  KL  ++N      +   ++T + Y         +          + + DFF YA   + YW+GY+TSR           S L+G  + YS     V    H   +      +  +++ A + +G+ QHHDA++GT K+ V  DY  RL   L   + VI ++   LI K    Y F      L      A  D++    L+        ++++NP+   R+    + VN       ++   +G  +P QL         +      S   Y+ +F + LPALG A   +  S  S    +S T+  +  + + + G   L +   T D             GF  +   L+S    +  Q++R    +   G      KSGAY+F P  N + P ++  AP + +++G L  EV   +  +   V R++N   +  L  + T   + I D   KE+ +++ TDI S + F+TD NG QI  R+        + Q  P+  N+YP+ S  ++     ++ +  L +HT +A GV S  +G +E+++ RR + DDN G+G+ L +     N
Sbjct:  166 LQVFVVPHSHNDPGWIKTFDKYY-----NDQ---TQHILNNMVTKMAEDPRRKFIWSEISYFAKWWESADVHKQEVMRKLILSGQLEMVTGGWVMTDEANAHYFAMIDQLIEGHQWLERNLGVT--PRSGWAVDPFGHSATMPYLLKRANISSMLIQRVHYSIKKHFAATRSLEFMWRQAWDIESSTDMFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGSRVNCPWKVPPRAINDANVAERAGVLLDQYRKKSKLFRSKVLLVPLGDDFRYDKALEWDQQYLNYQKLFDYMNSHPEMHVKAQFATLSDYFDAVYKANGVTSGARPPDYPVLSGDFFAYADREDHYWSGYYTSRPFYKNLDRILESHLRGAEILYS---LAVAHARHAGVEGRYPVSDYSLLTDARRNIGLFQHHDAITGTAKEAVVIDYGNRLLRSLVGLKRVIINAAHFLIIKNKDIYRFYQTEPFLETDDRRATQDSLPQRTLIELESSPRYLVLFNPVEQERLCLVTVLVN---SARVRVLTEDGQTLPVQLSAQWMSATEM------SGEVYQASFMARLPALGLAVFHLYDSADSPMTLRSETLLRVPGRGQSIRGLDPLPVRSQTVDGQPFYIQSQSLTLGFSGATGLLESIRRKDDPQEVRVQIQFLTYGTRPSKDKSGAYLFLPDGN-AKPYSQREAPIVRVVEGPLFAEVVAHYQHFQQTV-RIHNVPGVDGLSLDITTM-VDIRDQNNKELAMRFVTDIQSGDTFYTDLNGFQIQPRR--------YFQKLPLQANFYPMPSTAYI-----QDSQYRLTLHTAQALGVTSLASGQLEVILDRRLMQDDNRGLGQGLKDNKRTAN 984          
BLAST of Alpha-mannosidase vs. Ensembl Zebrafish
Match: man2b2 (mannosidase, alpha, class 2B, member 2 [Source:ZFIN;Acc:ZDB-GENE-140106-166])

HSP 1 Score: 254.218 bits (648), Expect = 5.379e-70
Identity = 267/1045 (25.55%), Postives = 466/1045 (44.59%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTV-RNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPT-KIHNYLFTNVLYD-SYCTPPGFCFDDKCS---------DDPIMDD--PTLHDYNVQKRVDDFADYVIK----QSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD--INVFYSTPACY-TLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTD-------LNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXI----------------NSKDKIVIGNKYLKLTYDN--GFXXXXXXXXXXXXXXITQDMRYYFSYQGNGQ-KSGA----YIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVF-------SEWGMIVTRL------YNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDN-------------LPSGVNILSLE--------NHFNLNNE-----IDYQIIRVENVFYQ-----FGHSIKLNFQKMFRSI-KITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTS------NQMIVTLFPGQIRTFKI 2989
            +   +I H+H DVGW+ TV +  + Y  N+         +TV+  L    NRKF  VE  +F  WW    S   + +V+ L+ EGRL+F++GG  M+DEA T     I Q++ G  FL +TFG   RP  +W +DPFG S     +FA  GFD     R+DY  K+     K ++F+ +GS  PT K    +FT+ +   SYCTP    F ++            DP  D   P +     ++ V+ +A  ++     +++ ++++H+L P GCD QF NA+  F N+D L+ ++N       + V Y+T   Y               N DF PY++ P   WTG++ SR+ LKG  + ++++    + L      +  D          K+ ++   +   QHHD ++GTE   VA  Y + L  G+   E ++    +  +  +T++ D +   + N    A +D+ +  +   + +YNPL      +  + V         +   +G  VP+Q+ P             ES   Y+L F   L  L Y   T+   +       +    ++                  +  + + N+  KL +D     L S+++    + V + QD   ++ Y+ NG  +SG     YIF      ++P  K+  + I+ G +++E+ Q F       +    +VTR+            LE  + VGP+ +N    +E V + +T + ++   FTD+NG Q++     KRT Y       VA NYYP+    ++ + +++     +V  ++RA GV S   G +E+M+HRR   +  +  G   N T  D +  +VR   W+     D++ S  + E++++ +RPVV+          DQ   LL+              LP  +++ SL          H +  +E      D  ++R+ +++ +           +N +++ + I K+++V E +L+    + D++R  W  T++  Q    S          VT+ P +IRTF I
Sbjct:   23 IQAFVIPHSHMDVGWVYTVQESMHAYASNV--------YSTVVEELTRVKNRKFIAVEQEFFRLWWTNVASDWHKKQVRQLLLEGRLEFIIGGQVMHDEAVTDVDDAILQLTEGHGFLYETFGV--RPRFAWHVDPFGASATTPVLFALAGFDAHLISRIDYDLKDDMQKNKKLQFVWRGS--PTLKEKQEIFTHTMDQFSYCTPSYIPFSNRSGFYWNGVALFPDPPKDGKYPNMSLPVTKETVELYAQTMVDNIRLRAQWFRSSHVLWPWGCDKQFYNASVQFSNMDVLMNYINTHSDQYGVTVQYATLKDYFQTLHQTNLSWDVRGNQDFLPYSTEPFQAWTGFYGSRNVLKGVARRASSLLYASESLFTRYHISYPDGPVQREWALSKLKALRWAVSEVQHHDGITGTESPKVADMYMEHLLQGMMGAEELL---AAIFLLPQTLSND-IYDQIKNTPTTARTDSENVPE-QHIFVYNPLAWNISTYVNVSVQYAMA---VVLDDDGKAVPAQIQP-----------SMESSTVYDLFFVVELGGLQYRKYTVQFPQSPCDTGSACGATHVAKVVKFNKTNVRQWKKTGRKLLPVLNECYKLMFDQETNLLHSITDRSKKIRVRVQQD---FWEYKANGDVQSGPISDNYIFT-ANGSAVPAYKSVVMEIVPGKVISEIRQYFYREEEDANHTYSVVTRVPVGFKGRLSCFRLEQSYKVGPLEVN----RETVFRTRTSLQNNRTLFTDNNGYQMM-----KRT-YKGYANNTVARNYYPMVRVAYMEDESSR-----VVFLSERAHGVASLSQGQLEVMLHRRLWNNQEWNQG--YNLTLNDSS--VVRPVLWMMLGSPDSLSSIYQQEAVELQHRPVVM--------AIDQPQKLLNQRETFSGPSVHPVVLPQNLHMQSLSIPGWNYSPEHSSGGDEKSEVNFDRILLRITHLYEEGESPVLSQPTTINLKEVMQGIGKVSKVQECSLTGTWNISDLQRWNWK-TDETMQKTDKSGFSGVTQDFNVTISPKEIRTFFI 1004          
BLAST of Alpha-mannosidase vs. Ensembl Xenopus
Match: tnnc1 (troponin C1, slow skeletal and cardiac type [Source:Xenbase;Acc:XB-GENE-480515])

HSP 1 Score: 419.853 bits (1078), Expect = 3.807e-132
Identity = 199/366 (54.37%), Postives = 256/366 (69.95%), Query Frame = 2
Query:  134 SCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLS 1222
            SC       LNVH+I HTH+DVGWLKTVDQYYYG  ++IQ AGVQYIL++V+S L  +P+++F YVE A+F+RWW+QQD  VR  V  LV EGRL+F+ GGW MNDEA THY SIIDQM+LGL FL  TFG+CGRP V+W IDPFGHS EQA +FA MG+DG FF RLDY+DK  R  TK ME + + S   +  +  LFT VL + Y  P GFC+D  C D PI+DDP++ DYN    V  F     +Q++ Y ++H+++ MG DFQ++NA   F N+D+LI +VN  +     +NVFYSTP+CY  ++++      +K DDFFPYA GP+ +WTGYFTSR A KG+ + SNN  QVC Q+  LS
Sbjct:   22 SCPQAPDGFLNVHLIPHTHNDVGWLKTVDQYYYGAHNDIQHAGVQYILDSVVSQLLHDPSKRFIYVESAFFWRWWKQQDELVRRDVTRLVEEGRLEFINGGWSMNDEAATHYSSIIDQMTLGLQFLKSTFGDCGRPRVAWHIDPFGHSREQALLFAQMGYDGFFFGRLDYQDKANREKTKQMEMLWRASDDISPPYADLFTGVLPNGYNPPDGFCWDQLCDDTPIIDDPSVEDYNADVIVQKFLKAATQQAQKYLSSHIVMTMGSDFQYENAIMWFKNMDRLIKNVNMQQINGSKVNVFYSTPSCYLQSLHRANLTWPMKMDDFFPYADGPHMFWTGYFTSRPAFKGYERLSNNFLQVCNQMEALS 387          

HSP 2 Score: 234.572 bits (597), Expect = 2.499e-64
Identity = 129/347 (37.18%), Postives = 193/347 (55.62%), Query Frame = 2
Query: 1907 ITQDMRYYFSYQGN---GQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNI------SKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQF-----GHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNS 2905
            + Q   +Y +  GN    Q SGAYIFRP  ++S+P+++  +  +++  LV EVHQ FS W   V RLY D   +E EWTVGP+PI D  GKE++   +T++ +D  F+TDSNGRQI+ R+ + R  +   QTEP+AGNYYPVNS +++     K +   + + TDR+ G  S ++G +E+MVHRR L DD  GVGEPL E G  G G++VRG+  +  D+ D      R  +L+ +  P VV S    I      +   ++SAL   LP   ++L+   H       D  ++R+E+ F           I +N   +F S+ ++   E  L AN     +KRL+W +
Sbjct:  434 LKQSFYWYNASVGNEESSQPSGAYIFRPNNSDSVPVSQHVRSYLVQNSLVQEVHQNFSSWCSQVVRLYRDQRYIELEWTVGPVPIGDEWGKEVISLIETNLKTDGVFYTDSNGRQILKRRRDSRETWKLNQTEPIAGNYYPVNSRIYI-----KGKNTQVTVLTDRSQGGSSIRDGSLELMVHRRLLRDDYRGVGEPLLENGLLGEGIVVRGRHLLLLDHADEAADTHRTLALQQYMSPQVVLSSGDGIPYSQSGTPKRKFSALNGELPQNGHLLTFAMH-----AADKILLRLEHPFQSQESKNNSQPITINLNTLFSSVSLSNFEETTLGANMEKSRLKRLQWRT 770          
BLAST of Alpha-mannosidase vs. Ensembl Xenopus
Match: tnnc1 (troponin C1, slow skeletal and cardiac type [Source:Xenbase;Acc:XB-GENE-480515])

HSP 1 Score: 419.468 bits (1077), Expect = 3.947e-132
Identity = 199/366 (54.37%), Postives = 256/366 (69.95%), Query Frame = 2
Query:  134 SCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLS 1222
            SC       LNVH+I HTH+DVGWLKTVDQYYYG  ++IQ AGVQYIL++V+S L  +P+++F YVE A+F+RWW+QQD  VR  V  LV EGRL+F+ GGW MNDEA THY SIIDQM+LGL FL  TFG+CGRP V+W IDPFGHS EQA +FA MG+DG FF RLDY+DK  R  TK ME + + S   +  +  LFT VL + Y  P GFC+D  C D PI+DDP++ DYN    V  F     +Q++ Y ++H+++ MG DFQ++NA   F N+D+LI +VN  +     +NVFYSTP+CY  ++++      +K DDFFPYA GP+ +WTGYFTSR A KG+ + SNN  QVC Q+  LS
Sbjct:   22 SCPQAPDGFLNVHLIPHTHNDVGWLKTVDQYYYGAHNDIQHAGVQYILDSVVSQLLHDPSKRFIYVESAFFWRWWKQQDELVRRDVTRLVEEGRLEFINGGWSMNDEAATHYSSIIDQMTLGLQFLKSTFGDCGRPRVAWHIDPFGHSREQALLFAQMGYDGFFFGRLDYQDKANREKTKQMEMLWRASDDISPPYADLFTGVLPNGYNPPDGFCWDQLCDDTPIIDDPSVEDYNADVIVQKFLKAATQQAQKYLSSHIVMTMGSDFQYENAIMWFKNMDRLIKNVNMQQINGSKVNVFYSTPSCYLQSLHRANLTWPMKMDDFFPYADGPHMFWTGYFTSRPAFKGYERLSNNFLQVCNQMEALS 387          

HSP 2 Score: 219.164 bits (557), Expect = 3.669e-59
Identity = 117/298 (39.26%), Postives = 173/298 (58.05%), Query Frame = 2
Query: 1907 ITQDMRYYFSYQGN---GQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNI------SKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVF 2773
            + Q   +Y +  GN    Q SGAYIFRP  ++S+P+++  +  +++  LV EVHQ FS W   V RLY D   +E EWTVGP+PI D  GKE++   +T++ +D  F+TDSNGRQI+ R+ + R  +   QTEP+AGNYYPVNS +++     K +   + + TDR+ G  S ++G +E+MVHRR L DD  GVGEPL E G  G G++VRG+  +  D+ D      R  +L+ +  P VV S    I      +   ++SAL   LP   ++L+   H       D  ++R+E+ F
Sbjct:  430 LKQSFYWYNASVGNEESSQPSGAYIFRPNNSDSVPVSQHVRSYLVQNSLVQEVHQNFSSWCSQVVRLYRDQRYIELEWTVGPVPIGDEWGKEVISLIETNLKTDGVFYTDSNGRQILKRRRDSRETWKLNQTEPIAGNYYPVNSRIYI-----KGKNTQVTVLTDRSQGGSSIRDGSLELMVHRRLLRDDYRGVGEPLLENGLLGEGIVVRGRHLLLLDHADEAADTHRTLALQQYMSPQVVLSSGDGIPYSQSGTPKRKFSALNGELPQNGHLLTFAMH-----AADKILLRLEHPF 717          
BLAST of Alpha-mannosidase vs. Ensembl Xenopus
Match: tnnc1 (troponin C1, slow skeletal and cardiac type [Source:Xenbase;Acc:XB-GENE-480515])

HSP 1 Score: 420.239 bits (1079), Expect = 5.166e-132
Identity = 199/366 (54.37%), Postives = 256/366 (69.95%), Query Frame = 2
Query:  134 SCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLS 1222
            SC       LNVH+I HTH+DVGWLKTVDQYYYG  ++IQ AGVQYIL++V+S L  +P+++F YVE A+F+RWW+QQD  VR  V  LV EGRL+F+ GGW MNDEA THY SIIDQM+LGL FL  TFG+CGRP V+W IDPFGHS EQA +FA MG+DG FF RLDY+DK  R  TK ME + + S   +  +  LFT VL + Y  P GFC+D  C D PI+DDP++ DYN    V  F     +Q++ Y ++H+++ MG DFQ++NA   F N+D+LI +VN  +     +NVFYSTP+CY  ++++      +K DDFFPYA GP+ +WTGYFTSR A KG+ + SNN  QVC Q+  LS
Sbjct:   22 SCPQAPDGFLNVHLIPHTHNDVGWLKTVDQYYYGAHNDIQHAGVQYILDSVVSQLLHDPSKRFIYVESAFFWRWWKQQDELVRRDVTRLVEEGRLEFINGGWSMNDEAATHYSSIIDQMTLGLQFLKSTFGDCGRPRVAWHIDPFGHSREQALLFAQMGYDGFFFGRLDYQDKANREKTKQMEMLWRASDDISPPYADLFTGVLPNGYNPPDGFCWDQLCDDTPIIDDPSVEDYNADVIVQKFLKAATQQAQKYLSSHIVMTMGSDFQYENAIMWFKNMDRLIKNVNMQQINGSKVNVFYSTPSCYLQSLHRANLTWPMKMDDFFPYADGPHMFWTGYFTSRPAFKGYERLSNNFLQVCNQMEALS 387          

HSP 2 Score: 235.728 bits (600), Expect = 1.286e-64
Identity = 136/375 (36.27%), Postives = 209/375 (55.73%), Query Frame = 2
Query: 1829 NKYLKLTYD--NGFXXXXXXXXXXXXXXITQDMRYYFSYQGN---GQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNI------SKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQF-----GHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNS 2905
            N+Y ++ +D   G +  + NL+  +S+ + Q   +Y +  GN    Q SGAYIFRP  ++S+P+++  +  +++  LV EVHQ FS W   V RLY D   +E EWTVGP+PI D  GKE++   +T++ +D  F+TDSNGRQI+ R+ + R  +   QTEP+AGNYYPVNS +++     K +   + + TDR+ G  S ++G +E+MVHRR L DD  GVGEPL E G  G G++VRG+  +  D+ D      R  +L+ +  P VV S    I      +   ++SAL   LP   ++L+   H       D  ++R+E+ F           I +N   +F S+ ++   E  L AN     +KRL+W +
Sbjct:  429 NRYYRVDFDPETGLISGIHNLEKKISLPLKQSFYWYNASVGNEESSQPSGAYIFRPNNSDSVPVSQHVRSYLVQNSLVQEVHQNFSSWCSQVVRLYRDQRYIELEWTVGPVPIGDEWGKEVISLIETNLKTDGVFYTDSNGRQILKRRRDSRETWKLNQTEPIAGNYYPVNSRIYI-----KGKNTQVTVLTDRSQGGSSIRDGSLELMVHRRLLRDDYRGVGEPLLENGLLGEGIVVRGRHLLLLDHADEAADTHRTLALQQYMSPQVVLSSGDGIPYSQSGTPKRKFSALNGELPQNGHLLTFAMH-----AADKILLRLEHPFQSQESKNNSQPITINLNTLFSSVSLSNFEETTLGANMEKSRLKRLQWRT 793          
BLAST of Alpha-mannosidase vs. Ensembl Xenopus
Match: tnnc1 (troponin C1, slow skeletal and cardiac type [Source:Xenbase;Acc:XB-GENE-480515])

HSP 1 Score: 426.017 bits (1094), Expect = 5.632e-132
Identity = 201/370 (54.32%), Postives = 258/370 (69.73%), Query Frame = 2
Query:  122 CGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLS 1222
            CG  SC       LNVH+I HTH+DVGWLKTVDQYYYG  ++IQ AGVQYIL++V+S L  +P+++F YVE A+F+RWW+QQD  VR  V  LV EGRL+F+ GGW MNDEA THY SIIDQM+LGL FL  TFG+CGRP V+W IDPFGHS EQA +FA MG+DG FF RLDY+DK  R  TK ME + + S   +  +  LFT VL + Y  P GFC+D  C D PI+DDP++ DYN    V  F     +Q++ Y ++H+++ MG DFQ++NA   F N+D+LI +VN  +     +NVFYSTP+CY  ++++      +K DDFFPYA GP+ +WTGYFTSR A KG+ + SNN  QVC Q+  LS
Sbjct:   26 CGEQSCPQAPDGFLNVHLIPHTHNDVGWLKTVDQYYYGAHNDIQHAGVQYILDSVVSQLLHDPSKRFIYVESAFFWRWWKQQDELVRRDVTRLVEEGRLEFINGGWSMNDEAATHYSSIIDQMTLGLQFLKSTFGDCGRPRVAWHIDPFGHSREQALLFAQMGYDGFFFGRLDYQDKANREKTKQMEMLWRASDDISPPYADLFTGVLPNGYNPPDGFCWDQLCDDTPIIDDPSVEDYNADVIVQKFLKAATQQAQKYLSSHIVMTMGSDFQYENAIMWFKNMDRLIKNVNMQQINGSKVNVFYSTPSCYLQSLHRANLTWPMKMDDFFPYADGPHMFWTGYFTSRPAFKGYERLSNNFLQVCNQMEALS 395          

HSP 2 Score: 241.506 bits (615), Expect = 1.439e-65
Identity = 137/378 (36.24%), Postives = 205/378 (54.23%), Query Frame = 2
Query: 1907 ITQDMRYYFSYQGN---GQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNI------SKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQF-----GHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQMIV-----TLFPGQIRTF 2983
            + Q   +Y +  GN    Q SGAYIFRP  ++S+P+++  +  +++  LV EVHQ FS W   V RLY D   +E EWTVGP+PI D  GKE++   +T++ +D  F+TDSNGRQI+ R+ + R  +   QTEP+AGNYYPVNS +++     K +   + + TDR+ G  S ++G +E+MVHRR L DD  GVGEPL E G  G G++VRG+  +  D+ D      R  +L+ +  P VV S    I      +   ++SAL   LP   ++L+   H       D  ++R+E+ F           I +N   +F S+ ++   E  L AN     +KRL+W +   +     +    +V     TL P +IRTF
Sbjct:  616 LKQSFYWYNASVGNEESSQPSGAYIFRPNNSDSVPVSQHVRSYLVQNSLVQEVHQNFSSWCSQVVRLYRDQRYIELEWTVGPVPIGDEWGKEVISLIETNLKTDGVFYTDSNGRQILKRRRDSRETWKLNQTEPIAGNYYPVNSRIYI-----KGKNTQVTVLTDRSQGGSSIRDGSLELMVHRRLLRDDYRGVGEPLLENGLLGEGIVVRGRHLLLLDHADEAADTHRTLALQQYMSPQVVLSSGDGIPYSQSGTPKRKFSALNGELPQNGHLLTFAMH-----AADKILLRLEHPFQSQESKNNSQPITINLNTLFSSVSLSNFEETTLGANMEKSRLKRLQWRTRTGSPLQMDSPRAPVVDPSNITLSPMEIRTF 983          
BLAST of Alpha-mannosidase vs. Ensembl Xenopus
Match: tnnc1 (troponin C1, slow skeletal and cardiac type [Source:Xenbase;Acc:XB-GENE-480515])

HSP 1 Score: 420.239 bits (1079), Expect = 6.696e-132
Identity = 199/366 (54.37%), Postives = 256/366 (69.95%), Query Frame = 2
Query:  134 SCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLS 1222
            SC       LNVH+I HTH+DVGWLKTVDQYYYG  ++IQ AGVQYIL++V+S L  +P+++F YVE A+F+RWW+QQD  VR  V  LV EGRL+F+ GGW MNDEA THY SIIDQM+LGL FL  TFG+CGRP V+W IDPFGHS EQA +FA MG+DG FF RLDY+DK  R  TK ME + + S   +  +  LFT VL + Y  P GFC+D  C D PI+DDP++ DYN    V  F     +Q++ Y ++H+++ MG DFQ++NA   F N+D+LI +VN  +     +NVFYSTP+CY  ++++      +K DDFFPYA GP+ +WTGYFTSR A KG+ + SNN  QVC Q+  LS
Sbjct:   22 SCPQAPDGFLNVHLIPHTHNDVGWLKTVDQYYYGAHNDIQHAGVQYILDSVVSQLLHDPSKRFIYVESAFFWRWWKQQDELVRRDVTRLVEEGRLEFINGGWSMNDEAATHYSSIIDQMTLGLQFLKSTFGDCGRPRVAWHIDPFGHSREQALLFAQMGYDGFFFGRLDYQDKANREKTKQMEMLWRASDDISPPYADLFTGVLPNGYNPPDGFCWDQLCDDTPIIDDPSVEDYNADVIVQKFLKAATQQAQKYLSSHIVMTMGSDFQYENAIMWFKNMDRLIKNVNMQQINGSKVNVFYSTPSCYLQSLHRANLTWPMKMDDFFPYADGPHMFWTGYFTSRPAFKGYERLSNNFLQVCNQMEALS 387          

HSP 2 Score: 227.639 bits (579), Expect = 8.413e-62
Identity = 129/347 (37.18%), Postives = 189/347 (54.47%), Query Frame = 2
Query: 1907 ITQDMRYYFSYQGN---GQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNI------SKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQF-----GHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNS 2905
            + Q   +Y +  GN    Q SGAYIFRP  ++S+P+++          LV EVHQ FS W   V RLY D   +E EWTVGP+PI D  GKE++   +T++ +D  F+TDSNGRQI+ R+ + R  +   QTEP+AGNYYPVNS +++     K +   + + TDR+ G  S ++G +E+MVHRR L DD  GVGEPL E G  G G++VRG+  +  D+ D      R  +L+ +  P VV S    I      +   ++SAL   LP   ++L+   H       D  ++R+E+ F           I +N   +F S+ ++   E  L AN     +KRL+W +
Sbjct:  469 LKQSFYWYNASVGNEESSQPSGAYIFRPNNSDSVPVSQ-------HNSLVQEVHQNFSSWCSQVVRLYRDQRYIELEWTVGPVPIGDEWGKEVISLIETNLKTDGVFYTDSNGRQILKRRRDSRETWKLNQTEPIAGNYYPVNSRIYI-----KGKNTQVTVLTDRSQGGSSIRDGSLELMVHRRLLRDDYRGVGEPLLENGLLGEGIVVRGRHLLLLDHADEAADTHRTLALQQYMSPQVVLSSGDGIPYSQSGTPKRKFSALNGELPQNGHLLTFAMH-----AADKILLRLEHPFQSQESKNNSQPITINLNTLFSSVSLSNFEETTLGANMEKSRLKRLQWRT 798          
BLAST of Alpha-mannosidase vs. Ensembl Mouse
Match: Man2b1 (mannosidase 2, alpha B1 [Source:MGI Symbol;Acc:MGI:107286])

HSP 1 Score: 679.093 bits (1751), Expect = 0.000e+0
Identity = 400/999 (40.04%), Postives = 577/999 (57.76%), Query Frame = 2
Query:   74 LIINILFFGIYSSP--TTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD---INVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL--SQQNRTDLNK-KIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPV---NVLHGDEY-KISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDK--IVIGNKYLKLTYDN--GFXXXXXXXXXXXXXXITQDMRYYFSYQGN---GQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFS------KNTNISKFDQYSALLDNLPSGVNILSLENHFN--LNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKW--NSTNDNYQNFFTSNQMIVTLFPGQIRTF 2983
            L I+ LF+ + ++P     GY +C P KP +LNVH++ HTHDDVGWLKTVDQYYYG   ++Q A VQYIL++V+S+L E P R+F YVE+A+F RWW+QQ S  ++ V+ LV +GRL+F+ GGW MNDEA THY +I+DQM+LGL FL  TFG  G P V+W IDPFGHS EQA++FA MGFDG F  R+DY+DK  R     ME + + S         LFT VL ++Y  P   C+D  C+D P++D+P   ++N +  V+ F      Q   Y+TNH ++ MG DF ++NAN  F N+DKLI  VN  + +   ++V YSTP CY   +NK      +K DDFFPYA GP+ +WTGYF+SR ALK + + S N  QVC QL  L   + N           +   M V QHHDAVSGT +Q+V  DYA++L+ G   CE +++++L++L S    N+ F  C  LNIS C +S     ++   V +YNPLG    +  R+PV   N +  D + K   SN  +VPS                      +EL F + +PALG+++ ++ +    N    +   +    K    +VI NKY++ T+D+  G L+ + NL+ N+S+ ++Q   +Y +  G+    Q SGAYIFRP   + +P+++  +++++K  LV EVHQ FS W   V RLY     LE EWTVGPIP+ D  GKE++ ++ T + +   FFTDSNGR+I+ R+ + R  +   QTEPVAGNYYPVN+ +++      + +  L + TDR+ G  S ++G +E+MVHRR L DD+ GV EPL ET     G  VRG+  +    + +  ++ RL + +    P VV S       ++  +   Q+S L   LP  V++L+L       L   +++Q    E+        + LN Q +F++  I  + E  L+ANQ L    RLKW  N+   +Y      +   VTL P +IRTF
Sbjct:   32 LPISFLFWLLLAAPGARAAGYKTCPPTKPGMLNVHLLPHTHDDVGWLKTVDQYYYGILSDVQHASVQYILDSVVSSLLEKPTRRFIYVEMAFFSRWWKQQTSATQDAVRNLVRQGRLEFVNGGWVMNDEAATHYGAIVDQMTLGLRFLQDTFGSDGLPRVAWHIDPFGHSREQASLFAQMGFDGFFLGRIDYQDKLNRKKKLRMEELWRASDSLEPPAADLFTGVLPNNYNPPKYLCWDVLCTDPPVVDNPRSPEFNAKTLVNYFLKLASSQKGFYRTNHTVMTMGSDFHYENANMWFKNMDKLIRLVNAQQVNGSLVHVLYSTPTCYLWELNKANLTWTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVGPEANVGPYGSGDSAPLQEAMAVLQHHDAVSGTARQNVVNDYARQLAAGWGPCEVLVSNALARL-SHYKQNFSF--CRELNISICPVSQT---SERFQVTLYNPLGRKVDQMVRLPVYEGNFIVKDPHDKNISSNVVMVPSYY---------------SETYQWELLFPASVPALGFSTYSVAKMSDLNHQAHNLLSRPRKHKSHHVLVIENKYMRATFDSGTGLLMKIENLEQNLSLPVSQGFFWYNASVGDEESSQASGAYIFRPNVGKPIPVSRWAQISLVKTALVQEVHQNFSAWCSQVIRLYKGQRHLELEWTVGPIPVRDDWGKEVISRFDTPMKTKGQFFTDSNGREILKRRDDYRPTWTLNQTEPVAGNYYPVNTRIYIT-----DGQMQLTVLTDRSQGGSSLQDGSLELMVHRRLLVDDDRGVSEPLLET---DTGDKVRGRHLVLLSSVSDAAARHRLLAEQEVLAPQVVLSLGGSSPYHSRATPKTQFSGLRQELPPQVHLLTLARWGPKMLLLRLEHQFALKEDSDRNLSSPVTLNVQNLFQTFTINYLQETTLAANQPLSRASRLKWMTNTGPTSYPEPSKLDPTSVTLKPMEIRTF 1001          
BLAST of Alpha-mannosidase vs. Ensembl Mouse
Match: Man2a2 (mannosidase 2, alpha 2 [Source:MGI Symbol;Acc:MGI:2150656])

HSP 1 Score: 265.774 bits (678), Expect = 2.518e-73
Identity = 236/855 (27.60%), Postives = 392/855 (45.85%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQK---GSFLPTKIHNYLFTNVLYD--SYCTP-PGFC--FDDKCSDDPIMDDP------TLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQF---QNANHNFVNLDKLI--------FHVNRLRKDINVFYSTPACYT---LAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLH--VLSQQNRTDLNKK-------IISMAMK-MGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLI--SKETVNYD----FVLCNLLNISFCAISDNISYTKLLT----VLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQL-VPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXIN-------------------SKDKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYYFSY--QGNGQKSGAYIFRPTTNESMPLT--KAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNI----LETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNE 2497
            L V ++ H+H+D GW+KT D+YY            Q+ILN+++S L E+P R+F + E+++F +WW    +  R  V+ LV  G+L+   GGW M DEA +HY +++DQ+  G  +L +  G    P   W +DPFGHS     +        +   R+ Y  K+   AT ++EF+ +    S   T I  ++     YD    C P P  C  FD K      ++ P       + + NV  R     D   K+S+ +++N LLVP+G DF++   Q  +  F N  +L         FHV      ++ ++   A Y    +          + + DFF YA   + YWTGY+TSR   K   +      +  + L+   L+   R+ L  +       +++ A + +G+ QHHDA++GT K+ V  DY  RL   L   + VI ++   L+   +ET ++D    F+  +   +S  A+ +  +  +L +    V+++NPL   R+    + VN       ++    G  +  Q+ V  ++ T  +P+        Y+++    LP LG   L +          +SS    +N                         I N+Y+++ + +G    L +++        Q    +  Y  + +  KSGAY+F P + E+ P    K P L + +G   +EV  V+ E    V RLYN   +    L+  + V    I D   KE+ L+  TDIDS   FFTD NG QI  RQ  K+         P+  N+YP+    ++     ++ ++ L +HT +A GV S  NG +E+++ RR + DDN G+G+ L +
Sbjct:  166 LQVFVVPHSHNDPGWIKTFDKYY--------TEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNISAQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALVDQLIEGHQWLERNLGAT--PRSGWAVDPFGHSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQMWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVADRAALLLDQYRKKSRLFRSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFLNSKPEFHVQAQFGTLSEYFD--ALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEILYSLALAHARRSGLAGQYPLSDFALLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVSLKQVIINAAHYLVLGDQETYSFDPGTPFLQMDDSRVSHDALPER-TVIRLDSSPRFVVVFNPLEQERLSVVSLLVN---SPRVRVLSEEGQPLSVQISVHWSSATDMVPD-------VYQVSVPVRLPGLGLGVLQLQPDLDGPYTLQSSVRVYLNGVKLSVSRQSAFPVRVVDSGASDFAISNRYMQVWF-SGLTGLLKSIRRVDEEQEQQMELEFLVYGTRTSKDKSGAYLFLPDS-EAKPYVPKKPPVLRVTEGPFFSEV-AVYYEHFHQVIRLYNLPGVEGLSLDMSFQVD---IRDYVNKELALRIHTDIDSQGTFFTDLNGFQIQPRQYLKKL--------PLQANFYPMPVMAYI-----QDSQRRLTLHTAQALGVSSLGNGQLEVILDRRLMQDDNRGLGQGLKD 978          
BLAST of Alpha-mannosidase vs. Ensembl Mouse
Match: Man2a1 (mannosidase 2, alpha 1 [Source:MGI Symbol;Acc:MGI:104669])

HSP 1 Score: 251.521 bits (641), Expect = 1.236e-68
Identity = 231/849 (27.21%), Postives = 370/849 (43.58%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQK-----GSFLPTKIHNYLFTNVLYDSYCTP-PGFC--FDDKCSDDPIMDDP------TLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANH---NFVNLDKLIFHVN-RLRKDINVFYSTPACYTLAXXXXXXXXXXXXD--------DFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLH--VLSQQNRTDLNK--------KIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYD------FVLCNLLNISFCAISDNI----SYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXX---------------XXXXXINSKDKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNGQKSGAYIFRPTTNESMPLT--KAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIP-INDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGN 2515
            L V ++ H+H+D GWLKT + Y+   RD       QYI N ++  L E+ +RKF + EI+Y  +WW   D   +  VK L+  G+L+ + GGW M DEAT HY ++IDQ+  G  +L K  G   +P   W IDPFGHS   A +    GF  +   R+ Y  K+     K +EF  +     GS      H   F +      C P P  C  FD K         P       +   NVQ R     D   K+SK ++T  LL P+G DF+F           N ++L  ++N +    + + + T + Y  A+ K     K  +         DFF YA   + YW+GYFTSR   K   +   +  +  + L+   L Q  +  +NK         +      +G+ QHHDA++GT K  V  DY  RL   L+  E +I  S   LI K+   Y       F+  +    S  ++   I    S  +   +++YNP    R     I VN       K+   +G  V  Q+  + N  + +      S A YE++F + +P LG     I+ S+ S+S                        +++ D I I N +L + +D   L+     + +   +  +    ++       KSGAY+F P   +  P    + P + + +G + ++V   F E      RLYN   I      V  I  I +   +EIV++  + I++ N ++TD NG QI  R+   +         P+  N YP+ +  ++ +  ++     L + + ++ G  S  +G IE+ + RR + DDN G+G+ +++     N
Sbjct:  165 LQVFVVPHSHNDPGWLKTFNDYF---RDK-----TQYIFNNMVLKLKEDSSRKFMWSEISYLAKWWDIIDIPKKEAVKSLLQNGQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLEKNLGV--KPRSGWAIDPFGHSPTMAYLLKRAGFSHMLIQRVHYAIKKHFSLHKTLEFFWRQNWDLGSATDILCHMMPFYSYDIPHTCGPDPKICCQFDFKRLPGGRYGCPWGVPPEAISPGNVQSRAQMLLDQYRKKSKLFRTKVLLAPLGDDFRFSEYTEWDLQCRNYEQLFSYMNSQPHLKVKIQFGTLSDYFDALEKAVAAEKKSSQSVFPALSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESRIRAAEILYQLALKQAQKYKINKFLSSPHYTTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFQSLNSLEKIIGDSAFLLILKDKKLYQSDPSKAFLEMDTKQSSQDSLPQKIIIQLSAQEPRYLVVYNPFEQERHSVVSIRVN---SATVKVLSDSGKPVEVQVSAVWNDMRTI------SQAAYEVSFLAHIPPLGLKVFKILESQSSSSHLADYVLYNNDGLAENGIFHVKNMVDAGDAITIENPFLAIWFDRSGLMEKVRRKEDSRQHELKVQFLWYGTTNKRDKSGAYLFLPD-GQGQPYVSLRPPFVRVTRGRIYSDV-TCFLEHVTHKVRLYNIQGIEGQSMEVSNIVNIRNVHNREIVMRISSKINNQNRYYTDLNGYQIQPRRTMSKL--------PLQANVYPMCTMAYIQDAEHR-----LTLLSAQSLGASSMASGQIEVFMDRRLMQDDNRGLGQGVHDNKITAN 979          
BLAST of Alpha-mannosidase vs. Ensembl Mouse
Match: Man2b2 (mannosidase 2, alpha B2 [Source:MGI Symbol;Acc:MGI:1195262])

HSP 1 Score: 242.662 bits (618), Expect = 4.679e-66
Identity = 263/1054 (24.95%), Postives = 461/1054 (43.74%), Query Frame = 2
Query:  134 SCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWW-----QQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPT-KIHNYLFTNVL-YDSYCTPPGFCFDDKCS---------DDPIMDD--PTLHDYNVQKRVDDFADYV---IKQSKA-YQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD--INVFYSTPACYTLAXXXXXXX-XXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL-------SQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINS-SLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINS---------------KDKIVIGNKYLKLTYDN--GFXXXXXXXXXXXXXXITQDMRYYFSYQGN-----GQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGM-------IVTRLYNDS-------NILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSK--NTNISKFDQYSALLDNLPSGVN--ILSLE---------NHF-NLNN--------EIDYQIIRVENVFYQ-----FGHSIKLNFQKMFRSI-KITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQM-----IVTLFPGQIRTFKI 2989
            +  P  P  +   ++ H+H DVGW+ TV +    Y  N+          TV++ L     R+F  VE  +F  WW     +QQ   VR     L++EGRL+F+LGG  M+DEA TH    I Q++ G  FL +TFG   RP  SW +DPFG S     +FA  GF+     R+DY  K+     + ++F+  GS  P+      +FT+V+ + SYCTP    F ++            +P  D   P + +      +  +A+ +   +KQ  A ++T H+L P GCD QF NA+  F N+D L+ ++N+      I+V Y+T   Y  A++          + DF PY+S P   WTG++TSRS LKG  + ++ +    + +             + T   +++  +   +   QHHDA++GTE   V   Y + L  G+     ++ S +L       T     ++   +       +  + Y    +  +YNPL      W    +  L      ++  N S+      P++   ++  + P    + Y+L   + +P L Y    ++ ++   + T+       N+               K  + + N    L +D     L S+ + QSN +V +TQ+   +  YQ N     G  S  Y+F P  N + P  +A  + ++ G LVT++ Q F  +         I TRL + S         +E ++ VGP+ +N    +E +L+  +D++S    ++D+NG Q+      +R  Y   ++ P+  NYYP+    F+     ++ K  LV+  +R  GV S  NG +E+M+HRR    +N       N T  D +  IV    W+       + +      + + + PVV+  +  +        ++     LP  ++  ILS+           H  NL           +   ++R+ +++             ++ + + R +  +  V E +L+    ++ ++R  W++  D+ +   TS        I+T++P +IRTF I
Sbjct:   20 AAQPAGP--IRAFVVPHSHMDVGWVFTVQESMRAYAANV--------YTTVVAELVRGGQRRFIAVEQEFFRLWWDGVASEQQKQQVRQ----LLHEGRLEFVLGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGI--RPQFSWHVDPFGASATTPTLFALAGFNAHLISRIDYDLKDAMQEAQMLQFVWHGS--PSLSGQQEIFTHVMDHYSYCTPSHIPFSNRSGFYWNGVAVFPEPPPDGVYPNMSEPVTGANIHLYAEALVANVKQRAAWFRTPHVLWPWGCDKQFFNASVQFDNMDPLLDYINQRTAQFGISVQYATLNDYFQALHATNMTWGIRDHQDFLPYSSEPLQAWTGFYTSRSTLKGLARQASALLYAGESMFTRYMWPDPSGTLDPTWALQQLQQLRWAVSEVQHHDAITGTESPKVKNMYTEHLRMGMLGVRKLMVSIALGGPPGSGTGAPKDIMGPQVTPVLSVDTRPVGY----SASVYNPLA-----WKITTIITL-----TVAFPNVSVTDELGHPVSTQIQNSTKDP----SAYDLLILTTIPGLNYRHYQVMHARGDQAGTRELVAPRANTLKFSLKLRNQPSQEGKRLVPVMNDCYILLFDQDTNMLHSIQDRQSNRTVRMTQE---FLEYQANWDVKQGPISDNYLFAP-NNTAEPSWEAVGMEMVAGTLVTDIRQYFYRYITDQEYIYSIHTRLAHPSLAGELLCQRIEQQYRVGPLDLN----REAILRTSSDLNSQQVLYSDNNGYQM------QRRPYKAFKSNPIPRNYYPMVQSAFI-----EDDKSRLVLLAERPHGVSSQGNGQVEVMLHRRLW--NNLAWDLKYNLTLNDTS--IVHPVLWLMLGPKSTMTALHPRSGVALQHGPVVLLKELADEETPVHGPHNPWPVTLPPNLHLQILSVPGWTYSRSHAQHLRNLQRGHPEKPQANLQRVLLRLRHLYEAGEDPVLSRPATVDLKVVLRGLGSVVAVEERSLTGTWDVQMLQRWHWSTKTDHLKGHPTSPPRPPGGSIITVYPKEIRTFFI 1014          
BLAST of Alpha-mannosidase vs. Ensembl Mouse
Match: Man2a2 (mannosidase 2, alpha 2 [Source:MGI Symbol;Acc:MGI:2150656])

HSP 1 Score: 163.31 bits (412), Expect = 1.298e-41
Identity = 110/360 (30.56%), Postives = 172/360 (47.78%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQK---GSFLPTKIHNYLFTNVLYD--SYCTP-PGFC--FDDKCSDDPIMDDP------TLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQF---QNANHNFVNLDKLI--------FHVNRLRKDINVFYSTPACYT-LAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALK 1162
            L V ++ H+H+D GW+KT D+YY            Q+ILN+++S L E+P R+F + E+++F +WW    +  R  V+ LV  G+L+   GGW M DEA +HY +++DQ+  G  +L +  G    P   W +DPFGHS     +        +   R+ Y  K+   AT ++EF+ +    S   T I  ++     YD    C P P  C  FD K      ++ P       + + NV  R     D   K+S+ +++N LLVP+G DF++   Q  +  F N  +L         FHV      ++ ++      T +          + + DFF YA   + YWTGY+TSR   K
Sbjct:  166 LQVFVVPHSHNDPGWIKTFDKYYT--------EQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNISAQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALVDQLIEGHQWLERNLGAT--PRSGWAVDPFGHSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQMWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVADRAALLLDQYRKKSRLFRSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFLNSKPEFHVQAQFGTLSEYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYK 515          
BLAST of Alpha-mannosidase vs. UniProt/SwissProt
Match: sp|Q29451|MA2B1_BOVIN (Lysosomal alpha-mannosidase OS=Bos taurus OX=9913 GN=MAN2B1 PE=1 SV=4)

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 412/1000 (41.20%), Postives = 579/1000 (57.90%), Query Frame = 2
Query:   80 INILFFGIYSSPTT--CGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD----INVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLS----------QQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWH-RIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYD--NGFXXXXXXXXXXXXXXITQDMRYYFSYQGN---GQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNI------SKFDQYSALLDNLPSGVNILSLE--NHFNLNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQM--IVTLFPGQIRTF 2983
            ++ LF    ++P     GY +C   KP++LNVH++ HTHDDVGWLKTVDQY+YG  +NIQ AGVQYIL++VIS+L  NP R+F YVEIA+F RWW+QQ +  +  V+ LV +GRL+F  GGW MNDEATTHY +IIDQM+LGL FL +TFG  GRP V+W IDPFGHS EQA++FA MGFDG FF RLDY+DK+ R  T  ME + + S         LFT+VL + Y  P G C+D  C+D P+++D    +YN ++ V  F      Q K Y+T H ++ MG DFQ++NAN  F NLDKLI  VN  ++     +NV YSTPACY   +NK      +K DDFFPYA GP  +WTGYF+SR ALK + + S N  QVC QL  L+            +   LN+        M V QHHDAVSGT +QHVA DYA++LS+G   CE +++++L+ L     +  DF  C  LNIS C ++      +   V++YNPLG  +++W  R+PV+      Y +    G +VPS +V I +                EL F +++PA+G++  ++ +                 S+D +VI N+YL+  +D   G L+ L NL+ N+ + + Q   +Y +  GN    Q SGAYIFRP  N+ + ++   +  ++K  LV EVHQ FS W   V RLY     LE EWTVGPIP+ D  GKE++ ++ T + +   F+TDSNGR+I+ R+ N R  +   QTEPVAGNYYPVNS +++ + N +     L + TDR+ G  S ++G +E+MVHRR L DD  GVGEPLN+   +G+GL VRG+  +  D  +   ++ RL++      P VV ++          +   Q+S L   LP  V +L+L       L   +++Q    E+        + L+   +F +  IT + E  L+ANQ L    RL+W +      +   S  +   +TL P +IRTF
Sbjct:   35 LSSLFVLFLAAPCAWAAGYKTCPKVKPDMLNVHLVPHTHDDVGWLKTVDQYFYGIYNNIQPAGVQYILDSVISSLLANPTRRFIYVEIAFFSRWWRQQTNATQKIVRELVRQGRLEFANGGWVMNDEATTHYGAIIDQMTLGLRFLEETFGSDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKKVRKKTLQMEQVWRASTSLKPPTADLFTSVLPNMYNPPEGLCWDMLCADKPVVEDTRSPEYNAKELVRYFLKLATDQGKLYRTKHTVMTMGSDFQYENANTWFKNLDKLIQLVNAQQRANGIRVNVLYSTPACYLWELNKANLSWSVKKDDFFPYADGPYMFWTGYFSSRPALKRYERLSYNFLQVCNQLEALAGPAANVGPYGSGDSAPLNE-------AMAVLQHHDAVSGTSRQHVANDYARQLSEGWRPCEVLMSNALAHL---SGLKEDFAFCRKLNISICPLTQT---AERFQVIVYNPLG-RKVDWMVRLPVS---KHVYLVKDPGGKIVPSDVVTIPSSDSQ------------ELLFSALVPAVGFSIYSVSQMPNQRPQKSW-------SRD-LVIQNEYLRARFDPNTGLLMELENLEQNLLLPVRQAFYWYNASTGNNLSSQASGAYIFRPNQNKPLFVSHWAQTHLVKASLVQEVHQNFSAWCSQVVRLYPRQRHLELEWTVGPIPVGDGWGKEVISRFDTALATRGLFYTDSNGREILERRRNYRPTWKLNQTEPVAGNYYPVNSRIYITDGNMQ-----LTVLTDRSQGGSSLRDGSLELMVHRRLLKDDARGVGEPLNK---EGSGLWVRGRHLVLLDKKETAAARHRLQAEMEVLAPQVVLAQGGGARYRLEKAPRTQFSGLRRELPPSVRLLTLARWGPETLLLRLEHQFAVGEDSGRNLSSPVTLDLTNLFSAFTITNLRETTLAANQLLAYASRLQWTTDTGPTPHPSPSRPVSATITLQPMEIRTF 989          
BLAST of Alpha-mannosidase vs. UniProt/SwissProt
Match: sp|Q60HE9|MA2B1_MACFA (Lysosomal alpha-mannosidase OS=Macaca fascicularis OX=9541 GN=MAN2B1 PE=2 SV=1)

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 400/985 (40.61%), Postives = 571/985 (57.97%), Query Frame = 2
Query:  125 GYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL----------SQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWH-RIPVNVLHGDEYKISHSNGSLVPSQLV--PITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINS-KDKIVIGNKYLKLTY--DNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNG---QKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSK------NTNISKFDQYSALLDNLPSGVNILSLENHFN--LNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKW--NSTNDNYQNFFTSNQMIVTLFPGQIRTF 2983
            GY +C   +PN+LNVH++ HTHDDVGWLKTVDQY+YG +++IQ AGVQYIL++VISAL  +P R+F YVEIA+F RWW QQ + +R  V+ LV +GRL+F  GGW MNDEA THY +I+DQM+LGL FL  TFG  GRP V+W IDPFGHS EQA++FA MGFDG FF RLDY+DK  R+    ME + + S         LFT VL + Y  P   C+D  C D P+++DP   +YN ++ VD F +    Q + Y+TNH+++ MG DFQ++NAN  F NLDKLI  VN  +     ++V YSTPACY   +NK      +K+DDFFPYA GP+ +WTGYF+SR ALK + + S N  QVC QL  L             +   LNK        M V QHHDAVSGT +QHVA DYA++L+ G   CE +++++L++L            C  LNIS C +S   +      V++YNPLG  ++ W  R+PV+      + +   NG  VPS +V  P ++   H P          EL F + LPALG+++ ++ +  +     ++       S    + I N++++ T+  D G L+ + N+   + + + Q   +Y +  G+    Q SGAYIFRP   + +P+++  ++ ++K  LV EVHQ FS W   V RLY     LE EW+VGPIP+ D+ GKE++ ++ T +++   F+TDSNGR+I+ R+ + R  +   QTEPVAGNYYPVN+ +++      + K  L + TDR+ G  S ++G +E+MVHRR L DD  GV EPL E   +G+G  VRG+  +  D      +  RL + +    P VV +       N       Q+S L   LP  V++L+L +     L   +++Q    E+        + LN + +F +  IT + E  L ANQ  +   RLKW  N+    +Q  +  +   +TL P +IRTF
Sbjct:   52 GYETCPTVQPNILNVHLVPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRFIYVEIAFFSRWWHQQTNAMREVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLEDTFGSDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKRVRMQKLEMEQVWRASASLKPPTADLFTGVLPNGYNPPMNLCWDVLCVDQPVVEDPRSPEYNAKELVDYFLNVATAQGRHYRTNHIVMTMGSDFQYENANMWFKNLDKLIRLVNAQQAKGSSVHVLYSTPACYLWELNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVGLAANVGPYGSGDSAPLNK-------AMAVLQHHDAVSGTSRQHVADDYARQLAAGWVSCEVLLSNALARL---RGFKDHLTFCRQLNISICPLSQTAAR---FQVIVYNPLG-RKVNWMVRLPVS---EGVFVVKDPNGRTVPSDVVIYPSSDSQAHPP----------ELLFSASLPALGFSTYSVAQVPRWKPQARAPQPIPRRSWSPALTIENEHIRATFDPDTGLLMEIMNMNQRLLLPVRQTFFWYNASIGDNESDQASGAYIFRPNQQKPLPVSRWAQIRLVKTPLVQEVHQNFSAWCSQVVRLYPGRRHLELEWSVGPIPVGDTWGKEVISRFDTPLETKGRFYTDSNGREILERRRDYRPTWKLNQTEPVAGNYYPVNTRIYIT-----DGKMQLTVLTDRSQGGSSLRDGSLELMVHRRLLKDDERGVSEPLME---NGSGAWVRGRHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGLRRELPPSVHLLTLASWGPEMLLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLVANQLREAASRLKWTTNTGPTPHQTPYQLDPANITLEPMEIRTF 1001          
BLAST of Alpha-mannosidase vs. UniProt/SwissProt
Match: sp|Q8VHC8|MA2B1_CAVPO (Lysosomal alpha-mannosidase OS=Cavia porcellus OX=10141 GN=MAN2B1 PE=1 SV=1)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 409/990 (41.31%), Postives = 564/990 (56.97%), Query Frame = 2
Query:  119 TCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD---INVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHV----------LSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLI-SKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLG--VTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXIN-SKDKIVIGNKYLKLTY--DNGFXXXXXXXXXXXXXXITQDMRYYFSYQGN---GQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNIS---------KFDQYSALLDNLPSGVNILSLENHF--NLNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTS--NQMIVTLFPGQIRTF 2983
              GY +C   +P +LNVH+++HTHDDVGWLKTVDQYY+G  +++Q AGVQYIL++VISAL   P R+F YVE+A+F RWW QQ +  +  V+ LV +GRL+F  GGW MNDEA THY +I+DQM+LGL FL  TFG  GRP V+W IDPFGHS EQA++FA MGFDG+FF R+DY+DK  R   + ME + + S         LFT VL ++Y  P G C+D  C+D P++DDP   +YN +K V  F      Q + Y+TNH ++ MG DFQ++NAN  F NLDKLI  VN  + +   ++V YSTPACY   +NK      +K DDFFPYA GP+ +WTGYF+SR ALK + + S N  QVC QL                + + LN+        M V QHHDAVSGT KQHVA DYA++L+ G   CE +++++L+KL  SKET    F+ C  LNIS C  S     ++   VL+YNPLG  V RM   R+PV       + I     + VPS +V +T            S  N EL F +++PALG++  ++ R    N  T+S   +    S   + I N+YL+ ++  D G L  +  L   +++ + Q   +Y +  G+    Q SGAYIFRP+     P++   +  ++K  LV EVHQ F+ W   V RLY+    LE EWTVGPIP+ D  GKEI+ ++ T +++   FFTDSNGR+++ R+ + R  +   QTEPVAGNYYPVNS +++      + K  L + TDR+ G  S  +G +E+MVHRR L DD  GVGE L E G+ G    VRG+  +  D      ++ RL + K    P +V +     S            Q+S L   LP  V +L+L       L   +++Q    E+        + L+ Q +F +  IT + E  L+ANQ      RLKW +  D          +   +TL P +IRTF
Sbjct:   47 AAGYETCPMVQPGMLNVHLVAHTHDDVGWLKTVDQYYWGIHNDLQQAGVQYILDSVISALLAEPTRRFVYVEMAFFSRWWHQQTNETQEVVRRLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLEDTFGSDGRPRVAWHIDPFGHSREQASLFAQMGFDGVFFGRIDYQDKLVRKKRREMELVWRASASLKAPAADLFTGVLPNNYGPPEGLCWDVLCADPPVVDDPRSPEYNAKKLVSYFLQLATAQGRYYRTNHTVMTMGSDFQYENANTWFKNLDKLIQLVNMQQANGSRVHVLYSTPACYLWELNKANLTWPVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQVCNQLEAQVGPAANVGPYGHGDSSPLNQ-------AMAVLQHHDAVSGTSKQHVADDYARQLAAGWGPCEVLLSNALAKLSGSKET----FLFCRDLNISICPFSQT---SERFQVLVYNPLGRKVDRMV--RLPVR---KGLFLIKDPGNNTVPSTVVELT------------SSGNPELLFPALVPALGFSVYSVTRVSDQNPQTRSQHSRPQKYSSPVLSIKNEYLRASFHPDTGLLSMIEVLDRKLTLPVNQAFFWYNASVGDKRSSQASGAYIFRPSQQWPFPVSHLARTRLVKTALVQEVHQNFTAWCSQVVRLYSGQRHLELEWTVGPIPVGDKWGKEIISRFDTPLETGGVFFTDSNGREVLERRRDYRPSWKLNQTEPVAGNYYPVNSRIYIT-----DGKMQLTVLTDRSQGGSSMSDGSLELMVHRRLLKDDGRGVGEALQEPGSGG---WVRGRHLLLLDTAREAAAEHRLLAEKELLAPQLVLAPGQGPSYHHDHHEAVPRKQFSGLRRQLPPSVRLLTLARWGPDTLLLRLEHQFALGEDSSRNLSLPVTLDLQDLFSTFTITRLQETTLAANQLRASASRLKWTTEIDPISRPAVPRLDPSSITLQPMEIRTF 997          
BLAST of Alpha-mannosidase vs. UniProt/SwissProt
Match: sp|O00754|MA2B1_HUMAN (Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1 PE=1 SV=3)

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 398/985 (40.41%), Postives = 572/985 (58.07%), Query Frame = 2
Query:  125 GYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL----------SQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWH-RIPVNVLHGDEYKISHSNGSLVPSQLV--PITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINS-KDKIVIGNKYLKLTY--DNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNG---QKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSK------NTNISKFDQYSALLDNLPSGVNILSLENHFN--LNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKW--NSTNDNYQNFFTSNQMIVTLFPGQIRTF 2983
            GY +C   +PN+LNVH++ HTHDDVGWLKTVDQY+YG +++IQ AGVQYIL++VISAL  +P R+F YVEIA+F RWW QQ +  +  V+ LV +GRL+F  GGW MNDEA THY +I+DQM+LGL FL  TFG  GRP V+W IDPFGHS EQA++FA MGFDG FF RLDY+DK  R+    ME + + S         LFT VL + Y  P   C+D  C D P+++DP   +YN ++ VD F +    Q + Y+TNH ++ MG DFQ++NAN  F NLDKLI  VN  +     ++V YSTPACY   +NK      +K+DDFFPYA GP+ +WTGYF+SR ALK + + S N  QVC QL  L             +   LN+        M V QHHDAVSGT +QHVA DYA++L+ G   CE +++++L++L         F  C  LNIS C +S   +      V++YNPLG  ++ W  R+PV+      + +   NG  VPS +V  P ++   H P          EL F + LPALG+++ ++ +  +     ++       S    + I N++++ T+  D G L+ + N+   + + + Q   +Y +  G+    Q SGAYIFRP   + +P+++  ++ ++K  LV EVHQ FS W   V RLY     LE EW+VGPIP+ D+ GKE++ ++ T +++   F+TDSNGR+I+ R+ + R  +   QTEPVAGNYYPVN+ +++ + N +     L + TDR+ G  S ++G +E+MVHRR L DD  GV EPL E   +G+G  VRG+  +  D      +  RL + +    P VV +       N       Q+S L  +LP  V++L+L +     +   +++Q    E+        + LN + +F +  IT + E  L ANQ  +   RLKW  N+    +Q  +  +   +TL P +IRTF
Sbjct:   51 GYETCPTVQPNMLNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRFIYVEIAFFSRWWHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLEDTFGNDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVWRASTSLKPPTADLFTGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVATAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVNAQQAKGSSVHVLYSTPACYLWELNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVGLAANVGPYGSGDSAPLNE-------AMAVLQHHDAVSGTSRQHVANDYARQLAAGWGPCEVLLSNALARL---RGFKDHFTFCQQLNISICPLSQTAAR---FQVIVYNPLG-RKVNWMVRLPVS---EGVFVVKDPNGRTVPSDVVIFPSSDSQAHPP----------ELLFSASLPALGFSTYSVAQVPRWKPQARAPQPIPRRSWSPALTIENEHIRATFDPDTGLLMEIMNMNQQLLLPVRQTFFWYNASIGDNESDQASGAYIFRPNQQKPLPVSRWAQIHLVKTPLVQEVHQNFSAWCSQVVRLYPGQRHLELEWSVGPIPVGDTWGKEVISRFDTPLETKGRFYTDSNGREILERRRDYRPTWKLNQTEPVAGNYYPVNTRIYITDGNMQ-----LTVLTDRSQGGSSLRDGSLELMVHRRLLKDDGRGVSEPLME---NGSGAWVRGRHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGLRRDLPPSVHLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLVANQLREAASRLKWTTNTGPTPHQTPYQLDPANITLEPMEIRTF 1000          
BLAST of Alpha-mannosidase vs. UniProt/SwissProt
Match: sp|O09159|MA2B1_MOUSE (Lysosomal alpha-mannosidase OS=Mus musculus OX=10090 GN=Man2b1 PE=1 SV=4)

HSP 1 Score: 679.093 bits (1751), Expect = 0.000e+0
Identity = 400/999 (40.04%), Postives = 577/999 (57.76%), Query Frame = 2
Query:   74 LIINILFFGIYSSP--TTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD---INVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL--SQQNRTDLNK-KIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPV---NVLHGDEY-KISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDK--IVIGNKYLKLTYDN--GFXXXXXXXXXXXXXXITQDMRYYFSYQGN---GQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFS------KNTNISKFDQYSALLDNLPSGVNILSLENHFN--LNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKW--NSTNDNYQNFFTSNQMIVTLFPGQIRTF 2983
            L I+ LF+ + ++P     GY +C P KP +LNVH++ HTHDDVGWLKTVDQYYYG   ++Q A VQYIL++V+S+L E P R+F YVE+A+F RWW+QQ S  ++ V+ LV +GRL+F+ GGW MNDEA THY +I+DQM+LGL FL  TFG  G P V+W IDPFGHS EQA++FA MGFDG F  R+DY+DK  R     ME + + S         LFT VL ++Y  P   C+D  C+D P++D+P   ++N +  V+ F      Q   Y+TNH ++ MG DF ++NAN  F N+DKLI  VN  + +   ++V YSTP CY   +NK      +K DDFFPYA GP+ +WTGYF+SR ALK + + S N  QVC QL  L   + N           +   M V QHHDAVSGT +Q+V  DYA++L+ G   CE +++++L++L S    N+ F  C  LNIS C +S     ++   V +YNPLG    +  R+PV   N +  D + K   SN  +VPS                      +EL F + +PALG+++ ++ +    N    +   +    K    +VI NKY++ T+D+  G L+ + NL+ N+S+ ++Q   +Y +  G+    Q SGAYIFRP   + +P+++  +++++K  LV EVHQ FS W   V RLY     LE EWTVGPIP+ D  GKE++ ++ T + +   FFTDSNGR+I+ R+ + R  +   QTEPVAGNYYPVN+ +++      + +  L + TDR+ G  S ++G +E+MVHRR L DD+ GV EPL ET     G  VRG+  +    + +  ++ RL + +    P VV S       ++  +   Q+S L   LP  V++L+L       L   +++Q    E+        + LN Q +F++  I  + E  L+ANQ L    RLKW  N+   +Y      +   VTL P +IRTF
Sbjct:   32 LPISFLFWLLLAAPGARAAGYKTCPPTKPGMLNVHLLPHTHDDVGWLKTVDQYYYGILSDVQHASVQYILDSVVSSLLEKPTRRFIYVEMAFFSRWWKQQTSATQDAVRNLVRQGRLEFVNGGWVMNDEAATHYGAIVDQMTLGLRFLQDTFGSDGLPRVAWHIDPFGHSREQASLFAQMGFDGFFLGRIDYQDKLNRKKKLRMEELWRASDSLEPPAADLFTGVLPNNYNPPKYLCWDVLCTDPPVVDNPRSPEFNAKTLVNYFLKLASSQKGFYRTNHTVMTMGSDFHYENANMWFKNMDKLIRLVNAQQVNGSLVHVLYSTPTCYLWELNKANLTWTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVGPEANVGPYGSGDSAPLQEAMAVLQHHDAVSGTARQNVVNDYARQLAAGWGPCEVLVSNALARL-SHYKQNFSF--CRELNISICPVSQT---SERFQVTLYNPLGRKVDQMVRLPVYEGNFIVKDPHDKNISSNVVMVPSYY---------------SETYQWELLFPASVPALGFSTYSVAKMSDLNHQAHNLLSRPRKHKSHHVLVIENKYMRATFDSGTGLLMKIENLEQNLSLPVSQGFFWYNASVGDEESSQASGAYIFRPNVGKPIPVSRWAQISLVKTALVQEVHQNFSAWCSQVIRLYKGQRHLELEWTVGPIPVRDDWGKEVISRFDTPMKTKGQFFTDSNGREILKRRDDYRPTWTLNQTEPVAGNYYPVNTRIYIT-----DGQMQLTVLTDRSQGGSSLQDGSLELMVHRRLLVDDDRGVSEPLLET---DTGDKVRGRHLVLLSSVSDAAARHRLLAEQEVLAPQVVLSLGGSSPYHSRATPKTQFSGLRQELPPQVHLLTLARWGPKMLLLRLEHQFALKEDSDRNLSSPVTLNVQNLFQTFTINYLQETTLAANQPLSRASRLKWMTNTGPTSYPEPSKLDPTSVTLKPMEIRTF 1001          
BLAST of Alpha-mannosidase vs. TrEMBL
Match: A0A210QAB9 (Alpha-mannosidase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05957 PE=3 SV=1)

HSP 1 Score: 827.395 bits (2136), Expect = 0.000e+0
Identity = 462/1023 (45.16%), Postives = 642/1023 (62.76%), Query Frame = 2
Query:   50 MAFILVVSL--IINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR--KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNK-KIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKL----ISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDK----IVIGNKYLKLTYD--NGFXXXXXXXXXXXXXXITQDMRYYFSYQGNG-----QKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVF----SKNTNISKF--DQYSALLDNLPSGVNILSLENHFN---LNNEIDYQIIRVENVFYQFGHS-----IKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFT-----SNQMIVTLFPGQIRTFKIVSKS 3001
            MA + V  L  I+ + F     S  TCGY SCN  K  ++NVH++ HTHDDVGWLKTVDQY+YG + +IQ AGVQYIL+ VI  L ++PN++F YVE+A+F RWW+QQ  ++R+ VK LVN+G+L+F+LGGWCMNDEA+THY +IIDQ +LG +FL   FG+CGRP V+WQIDPFGHS EQA++FA MGFDGLFF RLDY+DK  R  +K ME + KGS    K  + LFT  L+  Y  P GFCFD  CSDDPIMDD  + DYNV ++V+ F +   + + AY T H+L+PMG DF +Q+AN  F NLDKLI HVN+      +NV YSTP+CY  ++NK G +   K DDFFPYA   +S+WTGYF+SR ALK +V+ +NN  QVCKQ+  ++    TD +  +I  +   MGVAQHHDAVSGTEKQ VA+DYAQRL+ G+++C+ V+N +  KL     S       F  CN LNIS C +++N    K  T+ +YNPLG     W RIPV    G  Y++   + S VPSQ++P+T  TK +PER + S+A  EL F++ +PALG++   I +S K+      +T K    K+K     V+ N+++ LT+D  NG L  + NL S++ + + Q    Y  + GN      Q SGAY+FRP + ++    +  K  + +G +V EVHQ FS W   V RLY      E EWTVGPIPI D  GKE+   + + +D+   F+TD+NGR+I+ RQ N+R  +   QTEP+AGN+YPVNS ++   + ++     L + TDR+ G  S  +G I++MVHRR L+DD  GVGEPLNETG D  GL+VRGK ++     +   +  R  +L+++  P + F     K TN +K+   Q+S +   LP+ V++L+LE       + +     IIR+E++F    HS       +N Q +F +  +  V EL L AN  L D+ RL+WN+T+ N  +        ++ ++V L P QIRT+++  KS
Sbjct:    1 MARLSVYPLFGILVVFFLQAVDSAATCGYESCNAVKEGMINVHLVPHTHDDVGWLKTVDQYFYGDKSDIQRAGVQYILDAVIPELIKDPNKRFIYVEMAFFARWWRQQGDSMRHTVKRLVNQGQLEFILGGWCMNDEASTHYNAIIDQHTLGFEFLRHNFGDCGRPRVAWQIDPFGHSREQASLFAQMGFDGLFFGRLDYQDKFVRAISKTMEMVWKGSPSNLKKTSDLFTGALFRGYGPPKGFCFDLLCSDDPIMDDDRMQDYNVPQKVEMFVNASKEWALAYATKHVLMPMGSDFNYQSANAWFKNLDKLIKHVNKQSNTSKVNVLYSTPSCYLSSLNKAGIRWPTKEDDFFPYAHRAHSFWTGYFSSRPALKEYVRRTNNFLQVCKQMDAIAMLRDTDNSTYEIQILKEAMGVAQHHDAVSGTEKQPVAYDYAQRLARGVAECQKVVNDAFGKLSPFNTSVSPPGQQF--CNSLNISVCGLTENY---KQFTLTVYNPLGQAVTSWVRIPVV---GKAYEVKGHDDSSVPSQVIPLTKDTKRIPER-QGSIAQNELVFKTSVPALGFSVYFIKKSNKARVKFAQTTSKKRLIKNKEGTDTVLKNEHVSLTFDGTNGRLKRMRNLNSDIEIGLQQGFYCYQGHTGNNTEDIFQASGAYVFRPNSTKAFKSKQFEKSYVREGRVVQEVHQTFSPWVTQVIRLYEGEMHAEFEWTVGPIPIADGVGKEVASAFLSTLDTKGSFYTDANGREILKRQRNERATWLLKQTEPIAGNFYPVNSRIY---VKDEALGIQLTVLTDRSQGGSSIIDGGIQLMVHRRLLYDDGLGVGEPLNETGLDHKGLVVRGKHYVFLGGFEESAAFHRKMALRLYMAPSLSFIPYVMKYTNWTKYFQTQWSGINYTLPANVHLLTLEQWGGPGAVPSSSQPYIIRLEHIFENGEHSQLSKDATVNLQGLFVTFTVDSVTELTLGANMALSDLHRLQWNTTDVNMNDAPVLPTDQTDSLVVKLTPMQIRTYQVQIKS 1011          
BLAST of Alpha-mannosidase vs. TrEMBL
Match: A0A1S3IXF1 (Alpha-mannosidase OS=Lingula unguis OX=7574 GN=LOC106168249 PE=3 SV=1)

HSP 1 Score: 821.231 bits (2120), Expect = 0.000e+0
Identity = 448/994 (45.07%), Postives = 623/994 (62.68%), Query Frame = 2
Query:  119 TCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLY-DSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD---INVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNK-KIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFV--LCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINS-KDKIVIGNKYLKLTYDN--GFXXXXXXXXXXXXXXITQDMRYYFSYQGNGQK-----SGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSK-----NTNISKFD-QYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHSIKL------NFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQMIVT---------LFPGQIRTFKIV 2992
            TCGY SCN GK  ++NVH++ HTHDDVGWLKTVDQY+YG  + IQ AGVQYIL++V+ AL ++PN++F YVEIA+FYRWW +QD   R+ VK LVN+GRL+F+LGGWCMNDEA+THY +IIDQ + G  FL   FG+CGRP V+WQIDPFGHS E A++FA MGFDGL+F RLDY+D+  R   K ME + +GS         LFT  L   +Y  P GFC+D  C+D+P+ DD  LHDYNV   V  F     +Q+K YQTNHL+  MG DFQF++A+  + NLDKLI +VN  + +   +N  YSTP+CYT A N        K DDFFPYA   + +WTGYFTSR+ALKG+V+++NN  Q  KQL +LS+ +  D ++ K+ ++   MGVAQHHDAVSGTEKQHVA+DYA RLS+G+S C+ V+N +  KL+ K       V   C L NIS C +++ +   K  TV +YNP+G     W R+PV    G  Y +   +G  VP+Q+VP++  TK +PER  +S ANYEL F    P LG+A+  +  +     F +  T +  N     + + N+++ L +D   G L  ++NL   +++ +  + +YY S+ GN  K     SGAYIFRP   ++ PL        ++G LV EVHQ FS W  +VTRLY  +  +E EWTVGPIPI+D++GKE++  + TD+ ++  F+TDSNGR+I+ R+ N R  +   QTEPV+GNYYP+NS ++   + ++ +   L +  DR+ G  S ++G +EIMVHRR L DD+ GVGEPLNETG+DG GLIVRGK ++  D I +     R  + ++F  P+  FS         I +++  +S L   LP  V++L+LE            ++R+E+ FY+ G    L      + + +F    ++  +ELNL ANQ L D+KRLKW      Y+   ++ + +VT         L P QIRTF++ 
Sbjct:   62 TCGYKSCNLGKDGMINVHLVPHTHDDVGWLKTVDQYFYGANNTIQHAGVQYILDSVVEALGKDPNKRFIYVEIAFFYRWWNEQDDPTRHFVKGLVNQGRLEFILGGWCMNDEASTHYNAIIDQHTEGFRFLETVFGDCGRPRVAWQIDPFGHSREMASLFAQMGFDGLYFARLDYQDRAVREKDKRMEMVWRGSPQNLGTVADLFTGALARGNYGPPGGFCWDVHCNDNPVQDDKRLHDYNVDDLVKKFLATTQEQAKQYQTNHLMWTMGSDFQFESAHQWYKNLDKLITYVNAQQANGSKVNALYSTPSCYTYAKNLANVTWTTKEDDFFPYAHVDHGFWTGYFTSRAALKGYVRWTNNFLQGVKQLDILSKLDTMDNSEIKLRTLRQAMGVAQHHDAVSGTEKQHVAYDYAMRLSEGISMCQEVVNDAYKKLLPKNNSATPPVQMFCTLTNISMCNVTELL---KRFTVTVYNPIGRPVTTWLRLPV---QGSAYTVIGPDGKNVPAQIVPVSKRTKSIPER--KSPANYELVFHVSPPPLGFATYFVSYNSALEVFKQQQTQEKENVFYQDMDLRNEHISLIFDQTTGLLKQMTNLDKQITIPLQHEFKYYQSFAGNNSKGIYEASGAYIFRPNGTDAYPLKTNMVTKFMQGILVKEVHQTFSSWTTLVTRLYQGARHVEMEWTVGPIPIDDNQGKEVISHFATDLKTNGIFYTDSNGREILQRKRNFRPTWKLNQTEPVSGNYYPINSRIY---IRDETKNVQLTVLNDRSQGGSSIQDGCLEIMVHRRNLHDDSLGVGEPLNETGSDGKGLIVRGKHYLVLDDIKSSGRVHRDLAEQLFMAPLPSFSDLKMDFQQWIKQYNTMWSGLKQKLPDNVHLLTLEQWSGTT-----VLLRLEH-FYEKGEDDVLSKPAVVSLKGLFTPFDVSSAVELNLGANQKLADMKRLKW-----MYKTQLSTPEHVVTPIGDDLTVQLQPMQIRTFQVT 1033          
BLAST of Alpha-mannosidase vs. TrEMBL
Match: R7T6U8 (Alpha-mannosidase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_151096 PE=3 SV=1)

HSP 1 Score: 801.586 bits (2069), Expect = 0.000e+0
Identity = 437/1000 (43.70%), Postives = 627/1000 (62.70%), Query Frame = 2
Query:   98 GIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD----INVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFV--LCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKE-SLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYDN--GFXXXXXXXXXXXXXXITQDMRYYFSYQGNG-----QKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNT------NISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHS------IKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWN-----STNDNYQNFFT-----SNQMIVTLFPGQIRTFKI 2989
             I     +CGY +C+ G P+++NVH++ HTHDDVGWLKTVDQY+YG ++NIQ AGVQYIL++V+ AL  +P  +F YVEIA+F RWW++   + R+ VK LVNEGRL+F+LGGWCMNDEA+THY +IIDQ +LG DFL +TFGEC RP + WQIDPFGHS EQA++FA  GFDGLFF RLDY+DK++R+  K ME +   S         LFT V Y+ Y  P GFCFD  C+D+PIMDD  L DYNV  RV DF   V  Q+K Y TNH+++ MG DFQF+NA+ NF NLDKLI +VN  ++     IN+ YSTP+CY  A+NK  +   +K DDFFPYA+  +S+WTGYFTSR ALKG+V+ +NN+ QVCKQL++L++  ++   +    +   MGVAQHHDAVSGTEKQ VAFDYA+RL+ G++ C+ VI  +  +L+   + +   V   C L N+S C+  ++++     TV+ YNP+G +     R+PVN   G  + +S + G+ +PSQ+V +T  T+ +PE  K  S  + +L FQ  LPALG+A+  + + K   + T  +      +     I N++  LT+D   G L S++N++ ++++ +TQ + +Y  ++GN      + SGAY+FR   +E+  ++    +  +KG +V E+ Q F  W   V RLY     +E E+T+GPIPI+D  GKE++ ++ ++I S+  F+TDSNGR+++ R  + R  +N  QTEPVAGNYYPVNS +++ +   K     L I TDR+ G  S  +G IE+M+HRR L DD FG GE LNETG  G GL+VRGK  +  D + +   + R  + ++F  P V +++N+      N      ++A++  LP  V++L+LE       E    ++R+E+ FY+ G          LN   +F+ + +  V E  L A++ L +V+RL+WN      TN    +F T          V L P QIRTF I
Sbjct:   77 AIEDESGSCGYQACDLGHPDLVNVHLVPHTHDDVGWLKTVDQYFYGSKNNIQHAGVQYILDSVLEALLSDPKHRFIYVEIAFFARWWRELHDSSRHVVKKLVNEGRLEFILGGWCMNDEASTHYNAIIDQHTLGFDFLRETFGECARPKIGWQIDPFGHSREQASLFAQFGFDGLFFGRLDYQDKDKRLNDKTMEMMWAASDSLGVNQAGLFTGVNYNGYGPPDGFCFDRGCADEPIMDDDRLEDYNVLPRVVDFIKAVHDQTKHYTTNHIMMTMGSDFQFENAHQNFKNLDKLIKYVNDQQRQSDSKINLIYSTPSCYLYALNKANQTYSVKKDDFFPYANEAHSFWTGYFTSRPALKGYVRNTNNLLQVCKQLNILAR--KSSFVQPDQRLLEAMGVAQHHDAVSGTEKQAVAFDYAKRLARGVAACQIVIQEAYDQLLPINSGDKAPVQEFCPLANVSSCSALEDVNS---FTVVAYNPVGRSGNYNFRVPVN---GSAFIVSDAAGNTIPSQVVNVTAATEAIPEYQKNTSTISADLVFQGKLPALGFATFFVQKKKGKEAPTPQAKWTAPTT--DFSIQNEFTSLTFDGATGLLKSMTNMEKSLTIPLTQTILFYKGFKGNNSEPQFRASGAYVFRSNGSEAELISDKATINFVKGGVVQEIQQSFGGWASQVIRLYAGKREVEIEFTIGPIPIDDGIGKEVISRFTSNIASEGVFYTDSNGREMLKRVRDYRPTWNLNQTEPVAGNYYPVNSRIYIKD--EKSSNVQLTILTDRSQGGSSLVDGEIELMLHRRLLVDDAFGAGEALNETGVGGQGLVVRGKHVLILDSVVDSPRRHRDLAERLFMSPQVTYAENSLAPNDYNKKYKTMWTAMVSELPDNVHLLTLEQR-----EGTQYLLRLEH-FYEEGEDEQLSKPATLNIADLFKGMTVLSVDEYALGADRLLAEVQRLEWNIEGVGRTNGRMVDFVTPVLEGPGLFQVELKPMQIRTFVI 1058          
BLAST of Alpha-mannosidase vs. TrEMBL
Match: V9KD73 (Alpha-mannosidase (Fragment) OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 438/1011 (43.32%), Postives = 626/1011 (61.92%), Query Frame = 2
Query:   62 LVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSF-LPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTD---LNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYD--NGFXXXXXXXXXXXXXXITQDMRYYFSYQGN---GQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNIS-------KFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQ--IIRVENVFYQFGHS------IKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDN---YQNFFTSNQMI--VTLFPGQIRTFKIVSK 2998
            L + L ++     + S   TCGY SC   +P +LNVH++ HTHDDVGWLKTVDQY+YG R+ +Q AGVQYIL++VIS L  +P+++F YVE A+ YRWW+QQ+   +  V+ LV++GRL+F+ GGWCMNDE +THY ++IDQMSLG  FLN+TFGECGRP V+W IDPFGHS EQA++FA MGFDG FF RLDY+DK  R   ++ME + + S  LP  + + LFT VL + Y  P GFC+D  C+D+PI DD  L +YNV   V+ F     +Q+K+Y+TNH+++ MG DFQF+NA+  + N+DKLI +VN  +    DINVFYSTP+CY + +NK      +K DDFFPYA GP+ +WTGYFTSR A K + + SNN  Q+C QL VL+  +            ++   + VAQHHDAVSGTEKQ+V +DYA+RL+ G   C+ ++ ++LS L   +    +F  CN LNIS C  ++++S     TV +YNPLG       R+PVN   G  Y +S + G  VP+Q+V ++  T+ +  R     A  EL F++ +PA+G+ + T+ R + S      S      S     I NK++++ +D   G +  + NL+ N+S+ +T +  +Y   +G+   GQ SGAYIFRP   +  P+     +  ++  +  E+HQ FS W   V RL+ +  ++E EWTVGPIP+ DS+GKEI+ ++ T + +D  F+TDSNGR+I+ R+ + R  ++F QTEPVAGNYYPVN+ +F+     ++ K  L + TDR+ G  S ++G +E+MVHRR +FDD  GVGE LNE G DG GL+VRGK  +  D         RL + + +  P+VV +  T  +       +  ++SAL   LPS V++L+L        + D Q  IIR+E+ F Q G S      + ++ Q +    +ITEV E+ L ANQ L+D+ RL W S  D     +     + M+  VTL P +IRTF+   K
Sbjct:    1 LCLRLCLSGCLLALGSRAATCGYQSCPVTRPGMLNVHLVPHTHDDVGWLKTVDQYFYGARNAVQHAGVQYILDSVISQLRSDPSKRFIYVETAFLYRWWKQQNPETQEVVRELVSQGRLEFINGGWCMNDEGSTHYNAMIDQMSLGFQFLNETFGECGRPRVAWHIDPFGHSREQASLFAQMGFDGYFFGRLDYQDKYVREKQRDMEQVWRASADLPKPLAD-LFTGVLPNGYNPPRGFCWDMTCTDEPIKDDKDLEEYNVDTIVEYFISTARQQAKSYRTNHIIMTMGSDFQFENAHMWYSNMDKLIKYVNTKQTSGSDINVFYSTPSCYLMELNKANLTWSVKFDDFFPYADGPHEFWTGYFTSRPAFKLYERLSNNFLQICNQLEVLTGSDAHSGPYGAGDSATLKRAVAVAQHHDAVSGTEKQNVVYDYAKRLAGGWDKCQVLVANALSILTGTKQ---NFAFCNNLNISVCPQTESLS---AFTVTVYNPLGRPVSSVVRLPVN---GSVYSVSDARGQTVPNQVVAVSAVTRRV--RNGRGYAVNELVFEASVPAVGFTTFTVSRQQPSTGAPGPSDQTP--SDQTPSIQNKHIRVRFDPVTGLISGIDNLEKNLSLPVTHNFYWYTGSKGDYRSGQTSGAYIFRPVEGKPYPMAANASIYKVQTAMFEEIHQNFSSWCSQVVRLHRNQRMVELEWTVGPIPLADSRGKEIISRFDTPLKTDGLFYTDSNGREILQRRRDYRPTWHFNQTEPVAGNYYPVNTRIFI-----RDGKFQLSVLTDRSQGGSSIEDGSLELMVHRRLIFDDGRGVGEALNEPGEDGKGLVVRGKHLLFLDTPSASGQLHRLAAEQQYMAPLVVVAGGTGAAYRTSSRMQTTEFSALRTELPSSVHLLTLA-------QWDPQTVIIRLEHQF-QRGESEELSKPVSVDLQNLLSGFEITEVEEMTLGANQRLRDMSRLTWRSGRDPSPLSREPGKPSGMLRSVTLNPMEIRTFRAQVK 984          
BLAST of Alpha-mannosidase vs. TrEMBL
Match: A0A498NPX4 (Alpha-mannosidase OS=Labeo rohita OX=84645 GN=ROHU_015147 PE=3 SV=1)

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 442/999 (44.24%), Postives = 613/999 (61.36%), Query Frame = 2
Query:   62 LVVSLIINILFFGIYSSPT----TCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTD---LNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYDN--GFXXXXXXXXXXXXXXITQDMRYYFSYQGN---GQKSGAYIFRPTTNESMPLTKAPKLTIIK-GDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFD-QYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQ-----FGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQMI---VTLFPGQIRTF 2983
            L +S +  + F  ++S PT     CGY SC    P++LNVH++ HTHDDVGWLKTVDQY+YG R+NIQ AGVQYIL++VI  L ++P R+F YVE A+FYRWW+QQ  + +  V  LVNEGRL+F+ GGWCM+DEATTHY ++IDQM+LGL FLN TFGECGRP V+W IDPFGH+ E A+IFA MG+DG FF RLDY+DK +R+ TK ME + + S   T     LFT VL + Y  P GFC+D  C D PI DDP L DYNV + V  F +   KQ+  Y+TNH+++ MG DFQ++NAN  + N+DKLI +VN L+     +NV YSTP+CY   +N       +K DDFFPYA   + +WTGYFTSR ALK + + SN+  Q C QL VL     T          +M   MGVAQHHDAVSGTEKQHVA+DYA+RL+ G + CE ++ +SL+ L   E      V C  LNIS C ++++   +   ++ +YNPLG T     R+PVN   G  Y ++ S G  V SQ+VP++  TK +  R     A  EL FQ   P LGY++  II   K      S+      S     I NK+LK+T+D+  G L SL+NL++N ++ +TQ+  +Y +  GN    Q SGAYIFRP +++ + + K  ++ I+   + V EV Q FS W   V RLY     LE EWTVGP+P+ D  GKE++ + +TDI S +CF+TDSNGR+++ R+ + R  ++  QTEPVAGNYYP+NS  ++   ++K +   L + TDR+ G  S  NG +EIM+HRR L DD  GVGEPL+E G   +GL+VRG   +     D      R  +  +  +P++ F   T  +    Q+S L  +LP  V++L+L        + D  ++R+E+ +       +   + +N QK+F ++K+    E++L ANQ+ +D+ RL+WN    +     ++       VTL P +IRTF
Sbjct:    4 LCISFLFQLFFCLVFSLPTGRNSICGYKSCPATNPSMLNVHLVPHTHDDVGWLKTVDQYFYGDRNNIQHAGVQYILDSVIDQLQKDPARRFIYVETAFFYRWWKQQSQSTQRIVTQLVNEGRLEFINGGWCMSDEATTHYSAVIDQMTLGLRFLNDTFGECGRPRVAWHIDPFGHAREHASIFAQMGYDGFFFGRLDYQDKARRMKTKEMEMLWRASESLTPPVADLFTGVLPNGYNPPEGFCWDQSCDDAPIRDDPDLEDYNVDEIVQLFVNTSYKQAAFYKTNHIIMTMGSDFQYENANLWYKNMDKLIKYVNALQAKGSKVNVLYSTPSCYLQELNLANFTWPLKTDDFFPYADAAHDFWTGYFTSRPALKLYERLSNSRLQTCNQLEVLGGSKSTSGPFGEGDSDTMKRAMGVAQHHDAVSGTEKQHVAYDYARRLATGWAHCEILVRNSLAVLSGSEAPR---VFCENLNISVCPLTES---SHKFSMNVYNPLGRTVSWPVRLPVN---GSAYNVTDSTGKTVESQVVPLSKSTKEV--RRNRGYAKGELVFQVEAPPLGYSTY-IISMHKDEPQASSAKPTATRS-----IQNKFLKVTFDDTTGLLSSLTNLETNQTIRLTQNFYWYNASVGNTESPQTSGAYIFRPNSSDPLVINKTAEIQIVTLSNTVQEVTQWFSPWVSQVVRLYEGRKELELEWTVGPVPVADGLGKEVITRLETDIKSSDCFYTDSNGREVLERRKDYRPTWDLKQTEPVAGNYYPINSRAYIKASDDKHQ---LTVVTDRSQGASSLYNGSLEIMLHRRLLHDDFRGVGEPLSEPGEFSDGLVVRGHLLLTLTPPDTAADVHRPLAQGMVLQPLLSFQDGTPSANTKLQFSGLQADLPPAVHLLTLSQW-----DKDLVLVRLEHQYEAKESKTYSQPVTVNLQKLFSTLKVLGASEMSLGANQWKEDMNRLQWNPEKTSKPLPLSAKDPSPGEVTLNPMEIRTF 977          
BLAST of Alpha-mannosidase vs. Ensembl Cavefish
Match: man2b1 (mannosidase, alpha, class 2B, member 1 [Source:ZFIN;Acc:ZDB-GENE-050327-52])

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 406/970 (41.86%), Postives = 583/970 (60.10%), Query Frame = 2
Query:  131 NSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD---INVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL-SQQNRTDLNKKIISMAMK--MGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWH-RIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYD--NGFXXXXXXXXXXXXXXITQDMRYYFSYQGNG---QKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQ-----FGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQMI--VTLFPGQIRTF 2983
            +SC   KP++LNVH++ HTHDDVGWLKTVDQYYYG R+ IQ AGVQYIL++V+S L ++P R+F YVE A+F+RWW +Q +  RN V  LV EGRL+F+ GGWCM+DEA+THY ++IDQM+LGL                          + A+IFA MG+DG FF RLDY+DK +R+  K ME + + S         LFT VL + Y  P GFC+D  CSDDP+ DDP L DYNV   V+ F      Q+  Y+TNH+++ MG DFQ++NA   + N+DKLI +VN  +K+   +NV YSTP+CY   +N   +   IK DDFFPYA   + +WTGYFTSR ALK + + SN++ Q C QL VL   Q+R     K  S  M+  M VAQHHDAVSGTEKQHVA DYA+RL  G   C+ ++++SL+ L      N   V C  LNIS C +++    +K  ++ +YNPL    + W   +PVN   G  Y +  SNG  V SQ++P++  T++L  R     A  EL FQ   P LG+++ +II   ++ +  +      ++      + NKYLK T+D   G L  L+NL++  S+ ++Q+  +Y +  GN    Q SGAYIFRP ++    ++  P ++ ++  +V EV Q FS W   V RLY  S  LE EWT+GP+P++D  GKE++ +  + I S   F+TDSNGR+++ R+ + R  ++  QTEPVAGNYYP+NS  F+     K++   L + TDR+ GV S  NG +EIM+HRR L+DD  GVGEPL+E G  G+GL+VRG+  +     +      R  +  +  +P++ F   T  S   ++SAL  +LP  V++L+L        + D  ++R+E+ +       +   + +N QKMF ++K+    E++L ANQ+  ++ RL+WN+ ND +  +  SN     +TL P +IRTF
Sbjct:   10 DSCPATKPSMLNVHLVPHTHDDVGWLKTVDQYYYGGRNYIQHAGVQYILDSVVSELQKDPARRFIYVETAFFHRWWSEQSAKTRNIVTQLVQEGRLEFVNGGWCMSDEASTHYSAVIDQMTLGL--------------------------QHASIFAQMGYDGFFFGRLDYQDKGRRMKMKEMEMVWRASESLKPPTADLFTGVLPNGYNPPAGFCWDQSCSDDPVQDDPELEDYNVDDLVNKFISISKAQADVYKTNHIIMTMGSDFQYENAIPWYKNMDKLIHYVNARQKNGSAVNVLYSTPSCYLQELNLAKQIWPIKTDDFFPYADDAHDFWTGYFTSRPALKRYERLSNSLLQTCNQLEVLGGSQSRDGPFGKGDSETMRRAMAVAQHHDAVSGTEKQHVANDYAKRLGIGWDHCQVLVSNSLAALSGS---NVPRVFCENLNISVCPLTEG---SKRFSMNVYNPLA-RPISWSVHLPVN---GSSYSVQDSNGMAVNSQVIPVSKATQNL--RRGRGYAKNELVFQVQAPPLGFSTYSIILLGRAGAPDEPKRAAPVS------MQNKYLKATFDPTTGLLSGLTNLETQQSIQLSQNFYWYNASNGNDESRQTSGAYIFRPNSSTPYTISSKPVVSTLQNSVVQEVRQQFSPWVSQVVRLYEGSRDLELEWTIGPVPVDDGLGKEVITRLDSSISSAEYFYTDSNGREVLQRRKDYRPTWDLKQTEPVAGNYYPMNSRAFI-----KDKGSQLTVVTDRSQGVSSLNNGSLEIMLHRRLLYDDYRGVGEPLSEPGEFGDGLVVRGRLLLTLTPPETAADAHRPLAQGMVLQPLLSFQDGTP-SAIVEFSALQASLPPAVHLLTLSQW-----DKDSVLLRLEHQYESSESKTYSKPVTVNLQKMFSTLKVVGASEMSLGANQWKANMTRLQWNTGNDAHI-YTCSNPTPWEITLNPMEIRTF 923          
BLAST of Alpha-mannosidase vs. Ensembl Cavefish
Match: man2b1 (mannosidase, alpha, class 2B, member 1 [Source:ZFIN;Acc:ZDB-GENE-050327-52])

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 405/975 (41.54%), Postives = 584/975 (59.90%), Query Frame = 2
Query:  128 YNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQAN-IFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD---INVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL-SQQNRTDLNKKIISMAMK--MGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWH-RIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYD--NGFXXXXXXXXXXXXXXITQDMRYYFSYQGNG---QKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQ-----FGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTN-----DNYQNFFTSNQMIVTLFPGQIRTF 2983
            + SC   KP++LNVH++ HTHDDVGWLKTVDQYYYG R+ IQ AGVQYIL++V+S L ++P R+F YVE A+F+RWW +Q +  RN V  LV EGRL+F+ GGWCM+DEA+THY ++IDQM+LGL  L+              I P    + +++ IFA+MG+DG FF RLDY+DK +R+  K ME + + S         LFT VL + Y  P GFC+D  CSDDP+ DDP L DYNV   V+ F      Q+  Y+TNH+++ MG DFQ++NA   + N+DKLI +VN  +K+   +NV YSTP+CY   +N   +   IK DDFFPYA   + +WTGYFTSR ALK + + SN++ Q C QL VL   Q+R     K  S  M+  M VAQHHDAVSGTEKQHVA DYA+RL  G   C+ ++++SL+ L      N   V C  LNIS C +++    +K  ++ +YNPL    + W   +PVN   G  Y +  SNG  V SQ++P++  T++L  R     A  EL FQ   P LG+++ +II   ++ +  +      ++      + NKYLK T+D   G L  L+NL++  S+ ++Q+  +Y +  GN    Q SGAYIFRP ++    ++  P ++ ++  +V EV Q FS W   V RLY  S  LE EWT+GP+P++D  GKE++ +  + I S   F+TDSNGR+++ R+ + R  ++  QTEPVAGNYYP+NS  F+     K++   L + TDR+ GV S  NG +EIM+HRR L+DD  GVGEPL+E G  G+GL+VRG+  +     +      R  +  +  +P++ F   T       +SAL  +LP  V++L+L        + D  ++R+E+ +       +   + +N QKMF ++K+    E++L ANQ+  ++ RL+WN+          Q   T  +  +TL P +IRTF
Sbjct:   27 HTSCPATKPSMLNVHLVPHTHDDVGWLKTVDQYYYGGRNYIQHAGVQYILDSVVSELQKDPARRFIYVETAFFHRWWSEQSAKTRNIVTQLVQEGRLEFVNGGWCMSDEASTHYSAVIDQMTLGLPCLH--------------IRPGQKYLHRSDLIFANMGYDGFFFGRLDYQDKGRRMKMKEMEMVWRASESLKPPTADLFTGVLPNGYNPPAGFCWDQSCSDDPVQDDPELEDYNVDDLVNKFISISKAQADVYKTNHIIMTMGSDFQYENAIPWYKNMDKLIHYVNARQKNGSAVNVLYSTPSCYLQELNLAKQIWPIKTDDFFPYADDAHDFWTGYFTSRPALKRYERLSNSLLQTCNQLEVLGGSQSRDGPFGKGDSETMRRAMAVAQHHDAVSGTEKQHVANDYAKRLGIGWDHCQVLVSNSLAALSGS---NVPRVFCENLNISVCPLTEG---SKRFSMNVYNPLARP-ISWSVHLPVN---GSSYSVQDSNGMAVNSQVIPVSKATQNL--RRGRGYAKNELVFQVQAPPLGFSTYSIILLGRAGAPDEPKRAAPVS------MQNKYLKATFDPTTGLLSGLTNLETQQSIQLSQNFYWYNASNGNDESRQTSGAYIFRPNSSTPYTISSKPVVSTLQNSVVQEVRQQFSPWVSQVVRLYEGSRDLELEWTIGPVPVDDGLGKEVITRLDSSISSAEYFYTDSNGREVLQRRKDYRPTWDLKQTEPVAGNYYPMNSRAFI-----KDKGSQLTVVTDRSQGVSSLNNGSLEIMLHRRLLYDDYRGVGEPLSEPGEFGDGLVVRGRLLLTLTPPETAADAHRPLAQGMVLQPLLSFQDGT-----PSFSALQASLPPAVHLLTLSQW-----DKDSVLLRLEHQYESSESKTYSKPVTVNLQKMFSTLKVVGASEMSLGANQWKANMTRLQWNTGEILKPLQAEQGDPTPWE--ITLNPMEIRTF 952          
BLAST of Alpha-mannosidase vs. Ensembl Cavefish
Match: ENSAMXT00000050868.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001371.1:2842:11113:-1 gene:ENSAMXG00000029432.1 transcript:ENSAMXT00000050868.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 264.618 bits (675), Expect = 4.755e-81
Identity = 117/189 (61.90%), Postives = 150/189 (79.37%), Query Frame = 2
Query:  134 SCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGS 700
            SC   KP++LNVH++ HTHDDVGWLKTVDQYYYG R+ IQ AGVQYIL++V+S L ++P R+F YVE A+F+RWW +Q +  RN V  LV EGRL+F+ GGWCM+DEA+THY ++IDQM+LGL FLN TFGECGRP V+W IDPFGH+ E A+IFA MG++ + F RLDY+DK +R+  K ME + + S
Sbjct:   30 SCPATKPSMLNVHLVPHTHDDVGWLKTVDQYYYGGRNYIQHAGVQYILDSVVSELQKDPARRFIYVETAFFHRWWSEQSAKTRNIVTQLVQEGRLEFVNGGWCMSDEASTHYSAVIDQMTLGLRFLNDTFGECGRPRVAWHIDPFGHAREHASIFAQMGYEWVLFGRLDYQDKGRRMKMKEMEMVWRAS 218          
BLAST of Alpha-mannosidase vs. Ensembl Cavefish
Match: man2a2 (mannosidase alpha class 2A member 2 [Source:NCBI gene;Acc:103041860])

HSP 1 Score: 259.61 bits (662), Expect = 1.886e-71
Identity = 254/1024 (24.80%), Postives = 459/1024 (44.82%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLP---TKIHNYLFTNVLYD--SYCTP-PGFC--FDDKCSDDPIMDDP------TLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNA---NHNFVNLDKLIFHVNRLRKDINV----------FYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSR-----------SALKGF-VQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMK-MGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCN--LLNISFCAISDNISYTKLLT-------VLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYA---------------SLTIIRXXXXXXXXXXXXXXXINSK----DKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYY-FSYQGNGQKSGAYIFRPTTNESMPLTK--APKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNI--LETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGL-IVRGKQWIKFDYID----NIYSKMRLESLKIFNRPVV---VFSKNTNISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQMIVTLFPGQIRTFKI 2989
            L V ++ H+H+D GW+KT D+YY     N Q   +Q+I N ++  L E+P RKF   EI++F +WW   D+  +  ++ L+  G+L+ + GGW M DEA  HY ++IDQ+  G  +L +  G    P   W +DPFGHS     +        +   R+ Y  K+   +T+++EF+ + ++ P   T +  ++     YD    C P P  C  FD K      ++ P       + D NV +R +   D   K+SK +++  +L+P+G DF++  +   +  ++N  KL  ++N    +++V          F +      ++         + + DFF YA   + YW+GY+TSR           S L+G  + YS     V    H   +      +  +++ A + +G+ QHHDA++GT K+ V  DY  RL   L   + VI ++   LI K    Y F      L      A  D++    L+        ++++NP+   R+    + VN     + ++   +G  +P QL    +    +      S   Y+ +F + LPALG A               S T++R    +   +      + S+        I  + L L +     +  S  + +    +   ++++ +  + +  KSGAY+F P  N + P T+   P + +++G L  EV   +  +   V R++N   +  L  + T   + I D   KE+ ++  TDI S++ F+TD NG QI  R+        + Q  P+  N+YP+ +  ++     ++ +  L +HT +A GV S  +G +E+M+ RR + DDN G+G+ + +     N   ++  ++      +D    +  S +   +  I N  V+   V  K   +     ++ L + LP    +L+L +    N +     +    + ++ G    L  Q    +   T+  +L +SA     D++ L+  S    Y     SN  I++L P ++ T+K+
Sbjct:  166 LQVFVVPHSHNDPGWVKTFDKYY-----NDQ---MQHIFNNMVVKLAEDPRRKFILSEISFFVKWWDSADAHKQEAIRKLILGGQLEIVTGGWVMTDEANAHYFAMIDQLIEGHQWLERNLGVI--PRSGWAVDPFGHSATMPYLLKKANVTSMLIQRIHYSIKKHFSSTRSLEFMWRQAWDPESGTDLFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGSRVNCPWKVPPRAITDANVAERANVLLDQYRKKSKLFRSKVVLIPLGDDFRYDKSLEWDQQYINYQKLFDYMNS-HPEMHVQAQFGTLTDYFNAVYKANGVSQGARPPGYPVLSGDFFAYADREDHYWSGYYTSRPFYKNLDRILESHLRGAEILYS---LAVSHARHAGMEGRYPTSDYSLLTDARRNIGLFQHHDAIAGTAKEAVVTDYGTRLLRSLIGLKRVIINAAHFLIMKNKDVYRFYQTEPFLETDDRRATQDSLPQRTLIELDSSPRYLVLFNPVEQERLCVVTVLVN---SAKVRVLTEDGQTLPVQLSAQWSSAVQM------SGEVYQASFMARLPALGLAVFHLYDSVDSPMTLRSDTLLRLPGRSQTVRGVDPLPVRSQIADPQPFYIQTQSLTLAFSGTTGLLESIRRKDDPQEVRVQVQFFTYGTRPSKDKSGAYLFLPDGN-AKPYTQRDPPIVRVVEGPLFAEVVTYYQHFQQTV-RIHNVPGVDGLSLDITTL-VDIRDQTNKELSMRLHTDIQSEDTFYTDLNGFQIQPRR--------YFQKLPLQANFYPMPTMAYI-----QDSQYRLTLHTAQALGVTSLASGQLEVMLDRRLMQDDNRGLGQGVKDNKRTANRFRLLLERRTSSSRAVDSGPVSFPSLLSHMTSSILNHEVLALPVIPKKRGVPPLRTFAPLANALPCDFRLLNLRS--IQNQDAQSPSLYTALLLHRLGLDCGLEAQNPGFNCTTTQG-KLAVSALFRGLDLQLLQPMSLTLMYSGTPLSNSSIISLEPMELSTYKL 1147          
BLAST of Alpha-mannosidase vs. Ensembl Cavefish
Match: man2a2 (mannosidase alpha class 2A member 2 [Source:NCBI gene;Acc:103041860])

HSP 1 Score: 254.988 bits (650), Expect = 9.235e-70
Identity = 223/858 (25.99%), Postives = 394/858 (45.92%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLP---TKIHNYLFTNVLYD--SYCTP-PGFC--FDDKCSDDPIMDDP------TLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNA---NHNFVNLDKLIFHVNRLRKDINV----------FYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSR-----------SALKGF-VQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMK-MGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCN--LLNISFCAISDNISYTKLLT-------VLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYA---------------SLTIIRXXXXXXXXXXXXXXXINSK----DKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYY-FSYQGNGQKSGAYIFRPTTNESMPLTK--APKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNI--LETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGN 2515
            L V ++ H+H+D GW+KT D+YY     N Q   +Q+I N ++  L E+P RKF   EI++F +WW   D+  +  ++ L+  G+L+ + GGW M DEA  HY ++IDQ+  G  +L +  G    P   W +DPFGHS     +        +   R+ Y  K+   +T+++EF+ + ++ P   T +  ++     YD    C P P  C  FD K      ++ P       + D NV +R +   D   K+SK +++  +L+P+G DF++  +   +  ++N  KL  ++N    +++V          F +      ++         + + DFF YA   + YW+GY+TSR           S L+G  + YS     V    H   +      +  +++ A + +G+ QHHDA++GT K+ V  DY  RL   L   + VI ++   LI K    Y F      L      A  D++    L+        ++++NP+   R+    + VN     + ++   +G  +P QL    +    +      S   Y+ +F + LPALG A               S T++R    +   +      + S+        I  + L L +     +  S  + +    +   ++++ +  + +  KSGAY+F P  N + P T+   P + +++G L  EV   +  +   V R++N   +  L  + T   + I D   KE+ ++  TDI S++ F+TD NG QI  R+        + Q  P+  N+YP+ +  ++     ++ +  L +HT +A GV S  +G +E+M+ RR + DDN G+G+ + +     N
Sbjct:  166 LQVFVVPHSHNDPGWVKTFDKYY-----NDQ---MQHIFNNMVVKLAEDPRRKFILSEISFFVKWWDSADAHKQEAIRKLILGGQLEIVTGGWVMTDEANAHYFAMIDQLIEGHQWLERNLGVI--PRSGWAVDPFGHSATMPYLLKKANVTSMLIQRIHYSIKKHFSSTRSLEFMWRQAWDPESGTDLFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGSRVNCPWKVPPRAITDANVAERANVLLDQYRKKSKLFRSKVVLIPLGDDFRYDKSLEWDQQYINYQKLFDYMNS-HPEMHVQAQFGTLTDYFNAVYKANGVSQGARPPGYPVLSGDFFAYADREDHYWSGYYTSRPFYKNLDRILESHLRGAEILYS---LAVSHARHAGMEGRYPTSDYSLLTDARRNIGLFQHHDAIAGTAKEAVVTDYGTRLLRSLIGLKRVIINAAHFLIMKNKDVYRFYQTEPFLETDDRRATQDSLPQRTLIELDSSPRYLVLFNPVEQERLCVVTVLVN---SAKVRVLTEDGQTLPVQLSAQWSSAVQM------SGEVYQASFMARLPALGLAVFHLYDSVDSPMTLRSDTLLRLPGRSQTVRGVDPLPVRSQIADPQPFYIQTQSLTLAFSGTTGLLESIRRKDDPQEVRVQVQFFTYGTRPSKDKSGAYLFLPDGN-AKPYTQRDPPIVRVVEGPLFAEVVTYYQHFQQTV-RIHNVPGVDGLSLDITTL-VDIRDQTNKELSMRLHTDIQSEDTFYTDLNGFQIQPRR--------YFQKLPLQANFYPMPTMAYI-----QDSQYRLTLHTAQALGVTSLASGQLEVMLDRRLMQDDNRGLGQGVKDNKRTAN 984          
BLAST of Alpha-mannosidase vs. Ensembl Sea Lamprey
Match: man2b1 (mannosidase, alpha, class 2B, member 1 [Source:ZFIN;Acc:ZDB-GENE-050327-52])

HSP 1 Score: 784.637 bits (2025), Expect = 0.000e+0
Identity = 434/999 (43.44%), Postives = 615/999 (61.56%), Query Frame = 2
Query:  116 TTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL--SQQNRTDLNKKIISMAMK-MGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLV-----PITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXX----XXXXXXXINSKDKIVIGNKYLKLTYD--NGFXXXXXXXXXXXXXXITQDMRYYFSYQG---NGQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNI---SKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQ-----FGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNS------TND---NYQNFFTSNQMI-VTLFPGQIRTFKIVSK 2998
            + C  N C    P+++NVH + HTHDDVGWLKTVD+YYYG +++IQ AGVQYIL++VI AL +NP+R+F YVE+A+  RWW+QQ   +R RV+ L+++GRL+ + GGWCMNDEATTHY  IIDQM+LGL F++  FG C RP V+W IDPFGHS EQA++FA MGFDG FF RLDY+DKEQR+  K ME + + S         LFT VL++ Y  PPGFCFD  C D+PI DDP+L +YNV  R  DF   V KQ+K Y+TNH+++ MG DFQ++NAN  F NLDKLI +VN+L+     +N+ YSTP CY   +NK      +K DDFFPYA GP+ +WTGYFTSR ALK F + SNN+ QVC QL V+  S   R  L +    +  + MGVAQHHDAVSGTEKQ VA+DYA RLS G   C+ +++++LS L           +C  LNIS C  +++ S     TV++YNPLG +  E  R+PVN   G  Y +   +G+ + S+ +     P+++ T+ +  R     A+ EL FQ+ +P LG+A  ++ R+ +  +       +   +   +   I I N+Y  LT+D  +G L ++ N +S++S+ +TQ+  +Y S +G   NGQ SGAYIFRP ++E+ P+ K+         L+ EV QVFS W   V RLY     +E EWT+GPIP+ D  GKE+++++ T + +D  FFTDSNGR+I+ R+ +KR  +   QTEPVAGNYYPVNS +++     K+ K  L   TDR+ G  S ++G  E+M+HRR L+DD+ GV E LNE G  GNGL+VRG+  +  +      +  R  +   F  P+ +          S   Q+S L   LP  V++L+L    + +      ++R+EN F +         + +    +F   +IT + EL L+ANQ   D+KR++W++      +ND    +Q   T + ++ +TL P +IRTF +  K
Sbjct:   16 SACEQN-CPTSHPDMINVHFVPHTHDDVGWLKTVDEYYYGEKNDIQHAGVQYILDSVIPALEQNPSRRFIYVEMAFLKRWWKQQGEAMRRRVRALISQGRLEIINGGWCMNDEATTHYNGIIDQMTLGLRFVSDEFGGCARPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKEQRMKDKQMELVWRASKSMGPPVADLFTGVLFNGYNPPPGFCFDQFCDDEPIQDDPSLFNYNVDSRTSDFLKEVAKQAKFYRTNHIIMTMGSDFQYENANLWFKNLDKLITYVNQLQVNGSKVNLVYSTPTCYLNELNKANLTWTVKEDDFFPYADGPHQFWTGYFTSRPALKLFERRSNNLLQVCTQLEVIVGSGAARGPLGRGYSFLLWEAMGVAQHHDAVSGTEKQQVAYDYAVRLSLGWDSCQMLVSNALSALSGSGKPTE---ICRYLNISVCPATESAS---AFTVVLYNPLGQSVTENVRLPVN---GSRYLVQDPSGATMVSKSIIVVVFPVSDATRAV--RRTLGTASGELVFQAAIPPLGFARFSVSRAARRPAEALTGFVARGPRAGGNGAPISIKNEYYTLTFDGISGLLSNVENRKSSLSLPVTQNFYWYKSSKGDDDNGQASGAYIFRPNSSEAFPVAKSAVTHFTVDPLLQEVRQVFSPWCSQVIRLYPGKPYVELEWTLGPIPLADKIGKEVLVRFDTPLKTDGVFFTDSNGREILERRRDKRPTWPLNQTEPVAGNYYPVNSRIYI-----KDEKMQLTALTDRSQGGASIRDGSFELMLHRRLLYDDHRGVDEALNEPGVWGNGLVVRGRHLLVLEAPARSAALHRPLAQAEFMAPMPLIGPPVQAWPSSTLTQFSGLTRPLPPSVHLLTLAPWGDGS-----VLLRLENQFERDEDAALSGEVTVELTGLFSRFEITSLEELTLAANQRKADMKRMRWSTASAPTESNDIEKPWQQGQTESALLAITLQPMEIRTFNVTIK 992          
BLAST of Alpha-mannosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006368.1 (pep scaffold:Pmarinus_7.0:GL478975:152485:159376:1 gene:ENSPMAG00000005752.1 transcript:ENSPMAT00000006368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.28 bits (360), Expect = 2.533e-37
Identity = 69/178 (38.76%), Postives = 101/178 (56.74%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQK 694
            L + ++ H+H+D GWLKT D+YY            Q+ILN +++ L E+  R F + E+++F +WW   DS  R+ V+ LV  G+L+F+ GGW M DEA  HY +IIDQM  G  +L+KT G   RP   W IDPFGHS   A +    G   +   R+ Y  K      +++EF+ +
Sbjct:  131 LQIIVVPHSHNDPGWLKTFDKYYVDQ--------TQHILNHMVTKLLEDRRRSFVWAEVSFFAKWWDAADSQRRHSVRRLVERGQLEFVTGGWVMTDEANAHYFAIIDQMIEGHQWLHKTLGV--RPRSGWAIDPFGHSPTMAYVLRRAGLQAMLIQRVHYAVKRHLAHERSLEFMWR 298          
BLAST of Alpha-mannosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003432.1 (pep scaffold:Pmarinus_7.0:GL488094:1155:3927:-1 gene:ENSPMAG00000003140.1 transcript:ENSPMAT00000003432.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 7.325e-28
Identity = 57/182 (31.32%), Postives = 96/182 (52.75%), Query Frame = 2
Query:  161 LNVHIISHTHDD-VGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSF 703
            L ++++ H+H+D  GW+KT + Y+            + IL+  +  L E+  R+F + E++Y  +WW+  D+  R   K L++ G+L+ + GGW M DEA  H  +++DQM  G  +L +  G   RP   W IDPFGHS   A +  + G   +   R  Y  K+     +++EF  + S+
Sbjct:  125 LQIYVVPHSHNDPAGWIKTFEGYFV--------EQTKRILDNAMVKLAEDSRRRFIWAEVSYLAKWWEGADAAQRATAKRLIDGGQLEIVTGGWVMPDEANVHVWAMLDQMLEGHQWLERHLGV--RPRSGWAIDPFGHSPTNAYLLRAAGIQNMLIQRTHYSVKKHLAHERSLEFHWRQSW 296          
BLAST of Alpha-mannosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006359.1 (pep scaffold:Pmarinus_7.0:GL478975:144942:162143:1 gene:ENSPMAG00000005729.1 transcript:ENSPMAT00000006359.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 2.054e-26
Identity = 126/516 (24.42%), Postives = 218/516 (42.25%), Query Frame = 2
Query: 1091 DFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL-----SQQNRTDLN------KKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESV-INSSLSKLISKETVNYDFVLCNLLNISFCAISDNI-SYTKLLTVLIYNPLGVTR-------MEWHRIPVNVLHGDE--YKISHSNGSLVPSQLVPITNCTKHLPER----------PKESLANYELTFQSV------------LPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNGQKSGAYIFRPTTNESMPLTKA--PKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVG-PIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNE 2497
            DFF YA   + YW+GYFTSR   K   +      +  + L  L     S++  T L        ++      + + QHHDA++GT ++ V  DYA RL   L+D + V ++++L  L+++   +           SF  + +N+  Y  L    +       R       +EW R+ V  +  D     +   +GS V +Q+ P+ + +  +  R          P   LA Y LT  +             LP  G          ++      + +    ++  +   +     +   G L  +          +  D+ +Y + +    KSGAY+F P   E  P   A  P + + +G LV+EV  V+      V RLYN   +      V   + + D   +E+ ++  +D++SD  F TD NG Q+  R+  K+         P+  N+YPV +   +     ++ +  L + T +AGGV S  +G +E+M+ RR + DDN G+G+ L +
Sbjct:   73 DFFTYADREDHYWSGYFTSRPFFKHLDRRLEAHLRAAELLFSLASWHASRRGVTPLLPARECFARLEGARRNLALFQHHDAITGTSRELVVSDYAARLMRALADLQRVLVDATLVLLLAEPGRSAASAPSQ---PSFFFLEENVVDYDSLPNKAVIKLTSAPRSLVVHNALEWERVCVVSVRVDSPLANVLTHDGSGVLAQVDPLWSSSTGMSARAFQLQFLARVPALGLAVYRLTLDAPPVPTVRSDTTLYLPGGGPVP------PRTQPLLPLALLPPPTTQFSVETASVEAGFSGRTGMLRWVRLKAGGEPRLLRLDLLWYGTRRSK-DKSGAYLFLPD-GEGKPYESAERPVVRVTRGPLVSEVTCVYPHVQHSV-RLYNLPGVEGLSLEVSNVVDLRDQNNRELSMRVSSDVESDGNFQTDLNGFQMQPRRFWKKL--------PLQANFYPVATMALV-----QDARSRLSLLTAQAGGVASLADGQLEVMLDRRLIQDDNRGLGQGLKD 563          
BLAST of Alpha-mannosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002016.1 (pep scaffold:Pmarinus_7.0:GL477132:216:9947:1 gene:ENSPMAG00000001828.1 transcript:ENSPMAT00000002016.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 2.240e-18
Identity = 83/333 (24.92%), Postives = 150/333 (45.05%), Query Frame = 2
Query: 2117 LETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDN---IYSKMRLESLKIFNRPVVVFSKNT---NISKFDQYSALLDNLPSGVNILSLE--------NHFNLNNEIDYQ------------IIRVENVFYQ-----FGHSIKLNFQKMFRSIKITE-VIELNLSANQFLKDVKRLKWN-----STNDNYQNFFTSNQMIVTLFPGQIRTFKIVSKSI 3004
            LE E  VGP+ ++    +E VL+  T + +     TD+NG Q+      +R    F + E +  NYYP+    F+ E+   E    L IH++R+ GV S  +G +E+MVHRR   ++N      LN+T       IVR   W+      N   +Y +M    L++ NRP+V+  +      +    + +A L  LP  V++LSL+        NH      +  +            ++R+++++          +  ++ + +   + I   V E +L+    +  ++R +WN     S    ++     +  I+T+FP +I TF +  +SI
Sbjct:   28 LEQELWVGPLAMD----REAVLRTSTGLRTGRVLHTDNNGFQM-----QRRLYREFPKNE-LPRNYYPLVRTAFIEEV--MEHGMRLTIHSERSHGVASLHDGEMEVMVHRRMWNNENHDYNLTLNDTS------IVRPLFWLALARKSNSVLLYQRM---GLQLENRPLVLVGETPGQLGVVPVGRATA-LPTLPPNVHLLSLQLPGWSYSSNHQKHLKRLRRRKAGAAVADLGRVLLRLQHLYEAGEDPVLSQAATIDLKILLAPLGIVRHVEERSLTGTWDIAQLRRWQWNVTAPPSAEAAHEERMVHDDFIITIFPKEICTFFVHFESI 338          
BLAST of Alpha-mannosidase vs. Ensembl Nematostella
Match: EDO37584 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFA1])

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 422/1008 (41.87%), Postives = 605/1008 (60.02%), Query Frame = 2
Query:   77 IINILFFGIYSSPTTCGYNSCNPGK---PNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNY-LFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL-----SQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSK--LISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLAN--YELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTY--DNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNGQKSGAYIFRPTTNESMPLTKAPK--LTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTN-----ISKFDQ-YSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVF-----YQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWN----------STNDNYQNFFTSNQMIVTLFPGQIRTFK 2986
            I+ +L+   + S + C +     G       L +HI+ HTHDDVGWLKTVD+Y+YG  ++IQ AGVQYIL++VI AL E+PN++F YVEIA+F RWW QQ+  ++  VK LV + RL+F+ GGWCMNDEA THY +IIDQM++GL F+ +TFG   RP ++W IDPFGHS EQA++FA M FDG FF R+DY DK  R+  + ME + +GS       N  +FT VLY+ Y  PPGFCFD  CSD PI DDP L+D NV++RV++F     +Q   Y++N++++ MG DF ++NAN  + NLDKLI HVN+  + +  FYSTP  Y  A++       +K DDFFPYA  P+ YWTGYFTSR ALK + + +NN+ Q CKQL VL     S    +DL ++ ++      VAQHHDAVSGT KQHVA DYA+RL+ G +DC++++++ + K  + SK      F  CNLLN+S C  +++   +K   V  YNP+      + R+PVN+       + +  G+ + SQL+PI+  T  L    K S +N  YEL F+  LP LG+AS  +     ++  +     K+       VI N+++KL +  D G L S+++L S V+  + Q   +Y +    GQ SGAYIFRP T+ + P+    K   T+ +G LV EV QVFS +   V RLY      E E+TVGPIP  D  G+E++ ++ +DI S+  F+TD+NGR++  R  + R  +    TEPVAGNYYPVNS +F+     K+  + L + TDR+ G  S K+G +E+M+HRR L DD  GV EPLNE+G  G GLIVRGK  +         +  R    ++   P+V F++N +     ++K++  Y+ +   LPS V++L+LE     +N+  Y +IR+E+ F      +    + ++ Q +F  +++++V ELNL+ANQ LKD   ++WN           +    Q         V L P QIRTFK
Sbjct:   10 ILAVLYLTCFISSSLC-FQCAEKGAGKDAEKLQIHIVPHTHDDVGWLKTVDEYFYGANNSIQHAGVQYILDSVIPALNEDPNKRFIYVEIAFFKRWWDQQNVEMQEIVKKLVLQKRLEFINGGWCMNDEAATHYNAIIDQMTVGLKFIEETFGSDARPRIAWHIDPFGHSNEQASLFAQMSFDGFFFGRIDYDDKTLRLKQQRMEMVWRGSKSGNLGKNSDIFTGVLYNGYNPPPGFCFDQFCSDQPIQDDPRLYDENVKQRVEEFIKLACEQGSQYKSNNIMMTMGSDFMYENANLWYKNLDKLIAHVNQDSR-VRAFYSTPTTYLEALHAANLTWGLKTDDFFPYADCPHCYWTGYFTSRPALKRYSRLNNNLLQACKQLEVLNGPAQSGSPSSDLLRRALA------VAQHHDAVSGTSKQHVADDYAKRLAIGAADCQALMSNVIGKKSIKSKGNAPPVFSSCNLLNVSSCPSTED---SKSFVVNAYNPIARDITSYIRVPVNL----PMSVYNPQGAAIKSQLLPISQETMTLRRMQKLSASNSKYELIFKVKLPPLGFASYFV----NTSKTSSKMYGKSFAVDPSTVIQNEFIKLEFSRDTGRLTSMTDLVSEVTTQVDQQFLWYNASVDQGQPSGAYIFRPNTSSTTPVNAGGKATFTVYQGPLVQEVRQVFSPYVSQVVRLYYGQKHAEFEYTVGPIP--DDLGREVITRFDSDIKSNKVFYTDANGREMQLRTRDFRPTWKLNNTEPVAGNYYPVNSRIFV-----KDSNRQLTLLTDRSLGGSSLKDGSVELMLHRRLLVDDKRGVDEPLNESGISGKGLIVRGKVNVVLAPPATSAATHRELGEQMMLEPIVSFAQNPSTVEKWLAKYNSLYTGVARQLPSNVHMLTLET----SNQ--YALIRLEHQFEADEDSKLSMPVNVSLQGLFTDLEVSKVEELNLAANQLLKDKHPMQWNIKSVRKSRVRVSGSAKQPSLRLANTPVELRPMQIRTFK 985          
BLAST of Alpha-mannosidase vs. Ensembl Nematostella
Match: EDO40866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S628])

HSP 1 Score: 192.586 bits (488), Expect = 2.537e-50
Identity = 196/803 (24.41%), Postives = 342/803 (42.59%), Query Frame = 2
Query:  284 VISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQK-----GSFLPTKIHNYLFTNVLYDSYCTP-PGFC--FDDKCSDDPIMDDP------TLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQF---QNANHNFVNLDKLIFHVN-RLRKDINVFYSTPACYTLAXXXXXXXX--------XXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRT----------DLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLL-----TVLIYNPLGVTRMEWHRIPVNVLHGDEY-KISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYA--SLTIIRXXXXXXXXXXXXXXXINSKDK-----------------IVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYY-FSYQGNGQKSGAYIFRPTTNESMPLTKAPKLTII--KGDLVTEVHQVFSEWGMIVTRLYN----DSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNC-FFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGE 2485
            ++  L E+ + KF + EI+YF  WW+  D   + +    +  G+++ + GGW MNDEA  H+ S++DQ+  G  ++    G   +P+  W IDPFGH+     +   +GF  +   R  Y+ K+      N+EF+ +     GS      H   F +      C P P  C  FD +      +  P       + + NV +R     D   K++K Y+TN +L+P+G DF++         + N  K+  ++N          + T   Y  AI +                + DF+ YA   + YW+GY+TSR   K   +      +  + L  L+  +             L++ + +    MG+ QHHDA++GT K  V  DY  RL   L D ++V+   +  L+S         +           ++ I    +L     +V +YN L   R +     V++   D    +  S+G +V SQ   + +       R K S   YEL F + +P LG A   + +     +++     T    ++ DK                 + + N  +   +D+   +  S         +  D+ +  +  +  G +SGAY+F P    + P T     T+    G ++ EV +V     + V RLY     + + L+ + TV    +N+   KE V++ +TDI + N  F++D NG     R+   +         P+  N+YP+ +  FL + N++     L + + +  GV   + GM+E+++ RR L DDN G+G+
Sbjct:    1 MVDFLAEHKDMKFIWAEISYFSMWWKDADPHRKKQALSQIKSGQMELVTGGWVMNDEANPHFYSMLDQLIEGHQWIKNHLGPDIKPVSGWAIDPFGHTSTMPYLLRRIGFHSMLIQRTHYQVKKHLARETNLEFMWRQIWDHGSSTDILCHMMPFYSYDVPHTCGPDPKICCQFDFRRLPGGRVTCPWRIPPVPITEQNVAERATMLLDQYKKKAKLYKTNVVLIPLGDDFRYDLKMEPAAQYDNYQKIFNYINSHPEMHAQAQFGTLKDYFQAIYQKTGTNPGERPPNFVSLSGDFYTYADRDDHYWSGYYTSRPYYKNLDRVMEAHHRGAEMLFYLAHSHAKRAGVTHYPADKLSQLLTNARRNMGLFQHHDAITGTAKDFVVVDYGNRLHRSLQDMQNVMQECMQFLLSPNKAQEPKHILKPGEDRPAQDANPIKEVIILSSSPRSVYVYNSLPEQREQV----VSLFVSDPLVTVRDSSGDVVISQTNLVWDA------RNKISSVKYELLFVASVPPLGVAVFKVKLGSVSDAHNRPSRVTAYTRDTLDKPTSEHFNIELQAPGSEVLTMNNHLISAEFDSTTGMLKSITTKADGSRVNVDLEFMTYGTKSYGDRSGAYLFLP-DGPAKPHTVPAHTTVFFTSGKVMQEV-RVVLPNVVHVVRLYRTDGPEGHSLDIQNTVDVRSMNN---KEFVMRLRTDIQNKNREFYSDLNGFSYQRRRTLDKL--------PIQANFYPMPTMAFLEDSNHR-----LSLLSAQPNGVAGLQTGMLEVVMDRRLLQDDNRGLGQ 775          
BLAST of Alpha-mannosidase vs. Ensembl Medaka
Match: man2b1 (mannosidase alpha class 2B member 1 [Source:NCBI gene;Acc:101168422])

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 416/1006 (41.35%), Postives = 610/1006 (60.64%), Query Frame = 2
Query:   44 FIMAFILVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGS-FLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLR---KDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVL-SQQNRTDLNKKIISMAMK--MGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTY--DNGFXXXXXXXXXXXXXXITQDMRYYFSYQG----NGQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNE-TGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSK-NTNISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHS------IKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDN---YQNFFTSNQMIVTLFPGQIRTFKI 2989
             + A +L +  +++            CGY SC+P  P +LNVH++ HTHDDVGWLKTVDQY+YG R++IQ AGVQYIL++V+  L +NP+R+F YVE A+FYRWW+QQ S+++  VK LVNEGRL+F+ GGWCM+DEA THY ++IDQM+LGL FLN+TFG CGRP V+W IDPFGH+ E A++F+ MG+DG FF RLDY+D++ R + K  E + + S  LP  + + LFT +L + Y  P GFC+D  C+D PI DDP L DYNV   V  F     KQ++ Y+TNH+++ MG DFQ++NAN  + NLDKL+ HVN  +     +NV YSTP+CY   +++  +   +K DDFFPYA   +++WTGYFTSR ALK + + SN+  Q C QL VL    +R     +  S  ++  M VAQHHDAVSGT KQHV  DYA++L+DG   C+ ++++SL+ L          + C+LLN+S C ++++   +K  +V +YNPL    +   R+PV   +G  Y I    G+ V SQ++ ++  T+ +  R     A  EL FQ   P LGY + ++   +   S   S       S     I NK+L++ +  D G +  LSNL++  S+N+TQ+  +Y +  G    + Q SGAYIFRP +     +++  +   I+  +V EV Q FS W   V RLY DS  LE EWTVGP+P++D  GKE++ +  + I +   F+TDSNGR+I+ R+ + R  +   Q+EP+AGNYYP+N+  F+     K+    L + TDR+ G GS +NG +EIM+HRR L+DD  GVGEPLNE +     GL+VRG+  +  D  D+     R    +   +P++ F+  + N +   +++ L   LP  V++L+L        + D  ++R+E+ F Q   S      + +N QK+F ++ +  + ELNLSANQ+  ++ RL W    +     +     +   VTL P +IRTF +
Sbjct:   16 IVAALVLTLGEVLSFPLGLEKRDSVACGYQSCHPTVPGMLNVHLVPHTHDDVGWLKTVDQYFYGDRNDIQHAGVQYILDSVVDQLLKNPDRRFIYVETAFFYRWWKQQSSSMQQTVKQLVNEGRLEFVNGGWCMSDEAATHYSAVIDQMTLGLRFLNETFGACGRPRVAWHIDPFGHAREHASLFSQMGYDGFFFGRLDYQDRDSRRSKKEQELLWRASDSLPAPMAD-LFTGILPNGYNPPTGFCWDQLCNDPPIRDDPELEDYNVDDVVQRFLQIANKQAEVYKTNHIIMTMGSDFQYENANLWYKNLDKLLLHVNSQQAKGSKVNVLYSTPSCYLQELHRANRTWPLKMDDFFPYADDAHNFWTGYFTSRPALKRYERISNSNLQTCNQLEVLGGAASRKGPFGEGDSQTLRKAMAVAQHHDAVSGTAKQHVTNDYARKLADGWQRCQVLVSNSLASLSGSSAPR---IYCDLLNVSVCPLTES---SKKFSVTVYNPLARPVVWPVRLPV---YGSAYLIKDPKGNSVDSQVLSVSKATREV--RRNRGHAANELVFQVQAPPLGYTTYSVSSLQGRPSSAASPKRGAPTS-----IQNKFLQVNFDPDTGLISGLSNLETKQSINLTQNFYWYNASDGKNSESKQPSGAYIFRPNSTVPFVISRVAQTETIQTSVVQEVRQWFSPWVSQVVRLYADSRALELEWTVGPLPVSDGLGKEVITRLDSSIKTSEMFYTDSNGREILQRRKDFRPTWQLKQSEPIAGNYYPINTRAFI-----KDDVDQLTVVTDRSQGGGSIQNGSLEIMLHRRLLYDDYRGVGEPLNEVSNIFPEGLVVRGRFMLSLDRPDSAADIYRPLGQEEVLQPLLSFTDGDLNGNTQLEFTGLKAALPPAVHLLTLSQW-----DADSVLLRLEHQF-QISESKLNSQPVTVNLQKLFSTLNVLGISELNLSANQWKDEMTRLSWTPEKEEKPYLKILEDPSAWEVTLRPMEIRTFLV 993          
BLAST of Alpha-mannosidase vs. Ensembl Medaka
Match: man2a2 (mannosidase alpha class 2A member 2 [Source:NCBI gene;Acc:101158104])

HSP 1 Score: 276.174 bits (705), Expect = 6.150e-77
Identity = 254/1022 (24.85%), Postives = 449/1022 (43.93%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQK-----GSFLPTKIHNYLFTNVLYDSYCTP-PGFC--FDDKCSDDPIMDDP------TLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNA---NHNFVNLDKLIFHVNR------------LRKDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLS--------QQNRTDLN--KKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCN--LLNISFCAISDNISYTKLLT--------VLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYA---------------SLTIIRXXXXXXXXXXXXXXXINSK----DKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYY-FSYQGNGQKSGAYIFRPTTNESMPLTKAPKLT-IIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGP-IPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNG---LIVRGKQWIK-----FDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQMIVTLFPGQIRTFKI 2989
            L V +I H+H+D GW+KT D+Y+            Q+ILN ++  L E+P RKF + EI+YF +WW+  +   +  ++ L+ EG+L+ + GGW M DEA  HY ++IDQ+  G  +L +  G    P   W +DPFGHS     +        +   R+ Y  K+   +T+N+EF+ +     GS      H   F +      C P P  C  FD K      ++ P       + + NV +R     D   K+SK Y++  LLVP+G DF++  +   +  ++N  KL  ++N             L    +  Y T      A         + + DFF YA   + YWTGY+TSR   K   +   +  +  + L+ L+         + R  +     ++     +G+ QHHDA++GT K++V  DY  +L   L   + VI ++   L+ K    Y F      L      A  D +    L+         ++++NP+   R+   ++ VN +     ++   +G  +P QL         +      S   ++ TF + LP LG A               S T++R    +   ++S    ++S+        I +++L L +     +  S  + + S  +   +++  +    +  KSGAY+F P         K P +  +++G L +EV   +  +   + R++N   +      +   + I D   KE+ ++  TDI SD+ F+TD NG QI  R+        F Q  P+ GN+YP++S  ++ +  ++     L +HT +A GV S+++G +E+++ RR + DDN G+G+ L +     N    L+ R     K      +   +I S M    L     P+ V  K   I     ++ L+   P   ++L+L +  N  + +         + ++      +  Q +  +   T+  +LN+S+     D++ L+  S    Y +   +N   ++L P +I  FK+
Sbjct:  166 LQVFVIPHSHNDPGWIKTFDKYFTDQ--------TQHILNNMVVKLAEDPRRKFIWSEISYFSKWWETAEPQKQEAMRKLILEGQLEIVTGGWVMTDEANAHYFAMIDQLIEGHQWLERNIGVT--PRSGWAVDPFGHSATMPYLLKKSNLTSMLIQRIHYSIKKHFSSTRNLEFMWRQAWDTGSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPKPIVEANVAERAQLLLDQYRKKSKLYRSKVLLVPLGDDFRYDKSLEWDQQYINYQKLFDYMNSHPELHVQAQFGTLTDYFSALYKTTGA---AAGSRPADFPVLSGDFFAYADREDHYWTGYYTSRPFYKSLDRVIESHLRGAEILYSLAVATARHEGMEGRYPVTDYSLLVDARRAVGLFQHHDAITGTAKENVVIDYGNKLLRSLIGLKRVIINAAHFLVMKNRDFYRFYQTEAFLETDDRRATQDALPQRTLIELDPAGPRYLVVFNPIEQERLCLVKVLVNTV---RVRVLTEDGQTLPVQLSAQWGSATQM------SAEVFQATFMARLPPLGLAVFHLYDSADSPMTLRSDTLLRLSSRSVTARASDPLPVHSQLADPQSFYISSQFLTLGFSGSTGLLESIKRKDDSKEVKVQIQFMVYGTSPSKDKSGAYLFLPDGKPKPYNQKEPPVVRVVEGPLFSEVVAHYQHFEQTI-RIHNVPGVDGLSVDISTMVDIRDQSNKELSMRLSTDIKSDDIFYTDLNGFQIQPRR--------FYQKLPLQGNFYPISSQAYIQDSQHR-----LTLHTAQALGVTSFESGQLEVIMDRRLMQDDNRGLGQGLKDNKRTENRFRLLLERRSSGNKGTDSSTNSFPSIVSHMTSAILNHEVLPLPVVPKRRGIPPLKTFAPLMSRFPCDFHLLNLRSIQNKQDGLTPS-PHTALLLHRLALDCSIEAQNLGFNCTTTQG-QLNVSSLFKNLDLQLLQPVSLTLMYSSTPLANHSTISLDPMEISAFKL 1149          
BLAST of Alpha-mannosidase vs. Ensembl Medaka
Match: man2b2 (mannosidase alpha class 2B member 2 [Source:NCBI gene;Acc:101167078])

HSP 1 Score: 261.536 bits (667), Expect = 2.897e-72
Identity = 269/1063 (25.31%), Postives = 474/1063 (44.59%), Query Frame = 2
Query:   92 FFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNR-VKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPT-KIHNYLFTNVLYD-SYCTPPGFCFDDKCS---------DDPIMDD--PTLHDYNVQKRVDDFADYV---IKQSKA-YQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKD--INVFYSTPACYTLAXXXXXXX-XXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTD-------LNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLT--VLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKD----------KIVIGNKYLKLTYDNG----FXXXXXXXXXXXXXXITQDMRYYFSYQGNGQKSGA-----YIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVF------SEWGMIVTRLYND-------SNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDD--NFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDNLP--------------SGVNILSLENH-FNLNN---------EIDYQ--IIRVENVFY-----QFGHSIKLNFQKMFRSI-KITEVIELNLSANQFLKDVKRLKWNSTNDN---YQNFFTSNQMIVTLFPGQIRTF 2983
            F  +      C ++S   G+   +   +I H+H DVGW+ T+ +  + Y  N+         ++V   L +   R+F  VE  +F  WW    S ++ + V+ LV +GRL+F++GG  M+DEA T     I QM+ G  FL +TFG   RP  SW +DPFG S     +FA  GF+     R+DY  K+    TK ++F+ +GS  P+      +FT+ +   SYCTP    F +             DP  D   P +     ++ +D +A  +   IKQ  A ++TNH+L P GCD QF N++  F N+D L+ ++N+  K+  + V Y+T + Y  A+++         + DF PY++ P   WTG++ SR+ LKG  + +++     + L    + +  D          K+ ++   +   QHHD ++GTE   VA  Y Q L  G+   +  + ++L            F+L + L+             + L   V+IYNPL      W     N+       ++ +  ++   +  P++   +H      +S A+Y+L     L  L +    +IR    +  T  +       +           ++ + N+  KL +D        ++         V +TQD   ++ Y  NG  +       YIF    + ++   +A ++ II G +VTE+ Q F      S++   +T L  +        + L+  ++VGP+ +N     E+VL+  T + ++   +TD NG Q++     KRT Y   Q   +A NY+P+    ++     K+ +  LV+ +DRA GV S  NG +E+M+HRR   +   N G    LN++       +VR   W+     +      + E++++ +RPVV+   N    + ++        P               G N  S  NH  +LN+         E DY   ++R+ +++      +    + +N +++ + + ++T + E +L+       ++R KW + ND     +        I+T+ P +IRTF
Sbjct:   73 FLSVLVFACCCRWSSGGRGEDQPVQTFVIPHSHMDVGWVYTIQESMHAYAANV--------YSSVTEELSKVKERRFIAVEQEFFRLWWDTVASDLQKKQVRQLVKDGRLEFIIGGQVMHDEAVTDLDDQILQMTEGHGFLYQTFGV--RPQFSWHVDPFGASATTPVLFALAGFNAHLISRIDYDLKDAMQKTKKLQFVWRGS--PSLAAQQEIFTHTMDQFSYCTPSHVPFSNSSGFYWNGVALFPDPPKDGVYPNMSLPVTKETIDAYAKTMVENIKQRAAWFRTNHVLWPWGCDKQFYNSSVQFRNMDPLMKYINQKSKEFGVTVQYATLSQYFQAVHQSNLTWDVRGSQDFLPYSTEPYQAWTGFYASRNVLKGLARRASSQLHAAEILFTRYRVHFPDGPVAKDWALDKLRALRWAVSEVQHHDGITGTESPKVADMYVQHLMQGMMGVQE-LQAAL------------FLLPHYLDNPAVENFHGAGVDQALEQHVIIYNPLA-----W-----NITTVVNITVTLAGAAVYDDEGQPVSAQIQH----SAQSNASYDLFVVVQLGGLQHRKY-LIRFSGKSGHTYEAKAVVFERRRVKDWTRTGRLRLPVLNRCYKLMFDQETNLLHSITHLYSPKKQRVMMTQD---FWEYHANGDVNAGPISDNYIFSANAS-AVRAYQAVEMQIIPGQIVTEIRQYFYRGENDSDYAYSITTLVPEFSGAGLPCHRLQQTYSVGPLQLN----TEVVLRTSTSLKNNQSLYTDDNGFQMM-----KRT-YKKFQNNTLARNYFPMVRTAYI-----KDDRSGLVLLSDRAHGVSSQANGELEVMLHRRLWNNQPWNLGYNLTLNDSS------VVRPTLWMLLGSANATSRLYQREAVELQHRPVVMPIDNPRKPRQEKTGCSSPVRPVVLPPSLHLLSLSVLGWNYSS--NHSIHLNHIHSGKDFPPEPDYDRVLLRIMHLYEEGEDPELSKPVTINIKEVLQGVGEVTMLEERSLTGTWDSAGLQRWKWKTANDEGKMKEPHQGHKDFILTISPKEIRTF 1068          
BLAST of Alpha-mannosidase vs. Ensembl Medaka
Match: ENSORLT00000044084.1 (alpha-mannosidase 2 [Source:NCBI gene;Acc:101174073])

HSP 1 Score: 237.269 bits (604), Expect = 5.412e-64
Identity = 222/925 (24.00%), Postives = 405/925 (43.78%), Query Frame = 2
Query:  161 LNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSY-----CTP-PGFC--FD------DKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANH---NFVNLDKLIFHVNRLRK-DINVFYSTPACYTLAXXXXXXXXXXX----XDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLN-------------KKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLS--KLISKETVNYDFVLCNLLNISFCAISDNISYTKLL-------TVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTII----------------------RXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNGQKSGAYIFRPTTNESMPLTKAPKLT-IIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGN--GLIV---RGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSK-NTNISKFDQYSALLDNLPSGVNILSLEN 2716
            L + ++ H+H+D GWLKT D YY            ++ILN ++  L E+  RK  + EI+YF +WW + D   R  VK LV  G+L+ + GGW M DEA +HY +++DQ+  G  +L +  G   +P   W IDPFGHS     +    G   +   R+ Y  K+     K +EF+ + S+  +   +     + + SY     C P P  C  FD       + S    +    + + NV++R     D   ++S+ ++   LLVP+G DF++  +      F N  KL  + ++  +  I   + T + Y  A+++     +      + DFF YA   + YW+GY+TSR   K   +   +  +  + L  L+       +             ++++     +G+ QHHD ++GT +  V  DY  RL   +     V  SS     L+ K   ++D     L      +  D +     L        +++YNP    R     I V V   D   +       +P Q+  +        E  + S   ++L+F + LP L   SLT+                       R   ++   + S ++   ++  + + NK+L++       +      S+  V   Q    ++    N  KSGAY+F P    + P +  P L  + +G + +++   F      V   + + +  ++      + I     +E+V++ ++D+ S N F+TD NG Q+  R+  K+         P+  N+YP++S  FL +  ++     L + + ++    S ++G +E+++ RR   DDN G+G+ + +    G+   L++   R  Q +    ID++     LESL + + P+++F++ +  + K   +  L  +LP  V++L+L  
Sbjct:  151 LELFLVPHSHNDPGWLKTFDGYYQDQ--------TRHILNNMLLKLGEDSRRKMIWAEISYFSKWWNEIDEQKRMMVKRLVEAGQLEMVTGGWVMADEANSHYFALLDQLMEGHQWLQRHLGL--KPSSGWAIDPFGHSPSMTYLLKGAGLRNMVIQRIHYAVKKHFAQKKTLEFLWRQSWDSSHSSDITCHMMPFYSYDVPHTCGPNPAVCCQFDFYRLPGGRTSCPWRIPPQPITEKNVKERAHVLLDQYRQKSRLFRIPVLLVPLGDDFRYVESGEWDAQFNNYQKLFDYFDQHPELHIKARFGTLSDYFSALHRRLSATETSLPTLSGDFFTYADRDDHYWSGYYTSRPFYKRLDRALESTLRATEILFSLTLAEMRRFHGDLVVGFPAREHFQRLVEGRRNLGLFQHHDGITGTGRDPVVVDYGTRLFHAILHLRQVQQSSAHWLLLLDKNQYHHDQSKPFLQTDDVISAQDALPQKTPLVLSDEPRVLIVYNPTEQRRSS--VISVVVSSPDARVVDSETAQPMPVQISAVWV------EPQQVSSQAFQLSFVAELPPL---SLTVYHVTKAPAGSTPRSTYVIHRHGNRPSIASQHFQLSRLEAAEAQTHLSLSNKHLQIWSSPETGLLQKLRLSSGLVRRVQVKFLWYGTTTNRDKSGAYLFLPGQGGAQPYSSEPPLVRVSRGPIFSDITSCFQHVTHTVRLFHLEGHSGKSIEISNMVDIRAETNRELVMRLESDVASSNRFYTDLNGFQMQQRRTLKKL--------PLQANFYPMSSSSFLQDSLSR-----LTLLSAQSQAAASLQSGELEVILDRRLQQDDNRGLGQGVTDNKLTGSLYHLLLEDRRAVQEVGGATIDHLSLLAHLESLSLCHPPIIMFAQSDIQLPKLRPFLPLHSSLPCDVHLLNLRT 1041          
BLAST of Alpha-mannosidase vs. Ensembl Medaka
Match: man2b2 (mannosidase alpha class 2B member 2 [Source:NCBI gene;Acc:101167078])

HSP 1 Score: 72.7886 bits (177), Expect = 1.088e-13
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 2
Query:   92 FFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTV-RNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMS 493
            F  +      C ++S   G+   +   +I H+H DVGW+ T+ +  + Y  N        + ++V   L +   R+F  VE  +F  WW    S + + +V+ LV +GRL+F++GG  M+DEA T     I QM+
Sbjct:    3 FLSVLVFACCCRWSSGGRGEDQPVQTFVIPHSHMDVGWVYTIQESMHAYAAN--------VYSSVTEELSKVKERRFIAVEQEFFRLWWDTVASDLQKKQVRQLVKDGRLEFIIGGQVMHDEAVTDLDDQILQMT 129          
BLAST of Alpha-mannosidase vs. Planmine SMEST
Match: SMESG000045085.1 (SMESG000045085.1)

HSP 1 Score: 1946.01 bits (5040), Expect = 0.000e+0
Identity = 981/985 (99.59%), Postives = 985/985 (100.00%), Query Frame = 2
Query:   50 MAFILVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNGQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQMIVTLFPGQIRTFKIVSKSI 3004
            MAFILVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDF+DYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKDINVFYSTPACYTLAINKIGKKLKIKNDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRSKKSNSFTKSSTIKNINSKDKIVIGNKYLKLTYDNGFLVSLSNLQSNVSVNITQDMRYYFSYQGNGQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVI+TDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEV+ELNLSANQFLK+VKRLKWNSTNDNYQNFFTSNQMIVTLFPGQIRTFKIVSKSI
Sbjct:    1 MAFILVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFSDYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKDINVFYSTPACYTLAINKIGKKLKIKNDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRSKKSNSFTKSSTIKNINSKDKIVIGNKYLKLTYDNGFLVSLSNLQSNVSVNITQDMRYYFSYQGNGQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIYTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVVELNLSANQFLKNVKRLKWNSTNDNYQNFFTSNQMIVTLFPGQIRTFKIVSKSI 985          
BLAST of Alpha-mannosidase vs. Planmine SMEST
Match: SMESG000045072.1 (SMESG000045072.1)

HSP 1 Score: 1814.28 bits (4698), Expect = 0.000e+0
Identity = 923/985 (93.71%), Postives = 924/985 (93.81%), Query Frame = 2
Query:   50 MAFILVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXXXXXXXXXXXXINSKDKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNGQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQMIVTLFPGQIRTFKIVSKSI 3004
            MAFILVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQ STVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKDINVFYSTPACYTLAINKIGKKLKIKNDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRSKKSNSFTKSSTIKNINSKDKI   NK +     N F                                         NE   LT      IIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQMIVTLFPGQIRTFKIVSKSI
Sbjct:    1 MAFILVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQGSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKDINVFYSTPACYTLAINKIGKKLKIKNDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRSKKSNSFTKSSTIKNINSKDKIT-DNKRI-----NAF-----------------------------------------NEGPKLT------IIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKWNSTNDNYQNFFTSNQMIVTLFPGQIRTFKIVSKSI 932          
BLAST of Alpha-mannosidase vs. Planmine SMEST
Match: SMESG000032135.1 (SMESG000032135.1)

HSP 1 Score: 432.18 bits (1110), Expect = 1.446e-135
Identity = 278/915 (30.38%), Postives = 466/915 (50.93%), Query Frame = 2
Query:  185 THDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFI-QKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSDDPIMDDPTLHDYNVQKRVDDFADYVIKQ-SKAYQTNHLLVPMGCDFQFQNANHNFVNLDKLIFHVNRLRKDINVFYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQN----RTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINS---SLSKLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEWHRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRXXXXX-XXXXXXXXXXINSKDKIVIGNKYLKLTYDNGFXXXXXXXXXXXXXXITQDMRYYFSYQGNGQKSGAYIFRPTTNESMPLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIPINDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLKIFNRPVVVFSKNTNISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQIIRVENV-------FYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLK 2878
            +H +  WLK + + +     ++    ++ + N+V  AL  N  R+F   EI++F +W++  D+T +  V++  + G+ QF+ GG  +NDEATTHY SII+Q+SLGL F+   FG C RPLVSWQI+P+GHS E ANI   M F  +F   +       +++  +++F+ Q      T  +N +  +++ +    P  FCF   C +            N++   ++F +YV+K+ S      H+L+P+GCDF FQ A   F N DK+I  VN  +K   VFYSTPACY  AI+   K L+I   DFFP+      +W G+++SR  LK  ++ + +  Q CK +  LS +     +T L   ++ ++  +   QH+D ++G     +A    + LS  +  C  +  +   S  KL S    +  F  C   + SFC+++DNI   K++ ++++NPL      W  +PVN+     Y++     +L+P  +VPI     +   R  +S A Y + F++ LP  GY   +I R +K+   F K    K++  K+ I I N  + ++ +      +   QS           Y  +       SG ++     N S  +   P   I+ G LV E+ + +S    +  RL+ D + +E EW +G I  N +  +E VL Y +D+  +N FFTDSNGRQ+I R + K           +  N+YP+ SHV +    N  R  +++IHTDR+  VG      +E++++R  L  D     + L E GA+   L V G+ WI+    D +    RL+S +IF +P+++F KN     + +  + +   P  +NIL+LE  F  N+ +   ++R+EN+            ++++++ +  F ++ I E IE+NL+ ++ LK
Sbjct:    2 SHLENSWLKELGELFKCTEIHMNKVNIKTLFNSVYLALKINSTRRFIITEISFFQQWYEDLDTTQKATVRIFFDRGQFQFVSGGIVINDEATTHYSSIINQISLGLKFIKVNFGVCARPLVSWQINPYGHSREVANILKKMDFKAIFLGHV-----PSKLSNFDLDFLWQTKDTNDTNFNNTILASIITNGLVAPKMFCFHGHCQN------------NLKSASENFINYVMKRISLQNNKKHILIPIGCDFHFQQALETFQNFDKIIDTVNSKQKVFRVFYSTPACYLEAISNSVKTLQIYKSDFFPFDKSMKEFWIGFYSSRPNLKLIIRLAESYIQTCKMITALSDKEFNRRKTKLINDLVYLSNLISKTQHYDYITGNHPGQIAQLKIKELSSAIKMCHDLSAAGVESTMKLKSSNRKSMLFFDCPYHDFSFCSLTDNIQLNKIVNLIVFNPLPYPHTVWIYLPVNLDIHQTYEVKDVWNTLLPIDIVPINKMILNNINRQPKSKAKYNIYFKAQLPETGYTIFSIRRKRKNFWDFNKVLVSKSLILKNNIYISNSIINVSLNLKTNRLIIQKQSRKISLFLGIKCYCTNLDVVNASSGVFVSELKDN-SQAIHSKPTSYILDGSLVKEIRRRYSNGIGLTIRLFEDQDNVEIEWIIGGIDENSNFNREYVLTYNSDLSINNQFFTDSNGRQLIKRFLKKGLS--------IESNFYPITSHVLV----NNSRNLAMLIHTDRSVAVGGKTPNSVELLINRIILSSDKGSFNKQLKEVGANRKILSVIGRNWIEIGSTDELIINRRLKSNEIFKKPLLMFKKNNIAEYYLKIFSHVKTQPRHLNILTLEPIFEPNSNVGLILLRLENLKDVSRNEIRNRINTVRVDLKHFFENLNILEAIEMNLAGDKELK 886          
BLAST of Alpha-mannosidase vs. Planmine SMEST
Match: SMESG000018139.1 (SMESG000018139.1)

HSP 1 Score: 175.637 bits (444), Expect = 2.052e-44
Identity = 151/531 (28.44%), Postives = 247/531 (46.52%), Query Frame = 2
Query:  182 HTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQK---GSFLPTKIHNYLFTNVLYD--SYCTP-PGFCFDDKCSDD---------PIMDDPT-LHDYNVQKRVDDFADYVIKQSKAYQT-NHLLVPMGCDFQFQNANH---NFVNLDKLIFHVNRLRKDINV---FYSTPACYTLAXXXXXXXXXXXXDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQ-------------NRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVN--YDFVLCNLLNI-SFCAISDNISYTKLLT-----VLIYNPLGVTRMEWHRIPVNV-LHGDEYKISHSNGSLVPSQLVPI 1639
            H+H D GW+KTVD+Y+   +D+ Q      ILN+++  L + PN KF + E+ YF +WW       +++VK L+   +L+ + GGW M DEAT HY S+I+Q++ G  +L         P   W IDPFG+S     +    G + +   R+ Y  K++  ++K +EF  K    S     I+ ++     YD    C P P  C    C  D         P  +DP  + D NV+ R +   D   K++  Y   N++LVP+G DF+++        + N  KL+ ++N+ +K+ NV   F      +        K     + D F YA   + YWTGYFTSR  LK   +   N  +  + +  LS               N++ L++KI      + + QHHDAV+GT K HV  D+  +L + +   + V   +  +++     N  +D ++ ++ N+ S+    +  ++  + T     V ++N L   R     IP+ V       KI  S   L+  Q+ PI
Sbjct:  162 HSHLDPGWIKTVDEYF---KDDTQP-----ILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYT--PTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSIC----CQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNK-QKEWNVEIKFGILSDYFDSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPI 677          
The following BLAST results are available for this feature:
BLAST of Alpha-mannosidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAN2B10.000e+040.55mannosidase alpha class 2B member 1 [Source:HGNC S... [more]
MAN2B10.000e+040.41mannosidase alpha class 2B member 1 [Source:HGNC S... [more]
MAN2B23.657e-7026.28mannosidase alpha class 2B member 2 [Source:HGNC S... [more]
MAN2A24.185e-6926.65mannosidase alpha class 2A member 2 [Source:HGNC S... [more]
MAN2A24.185e-6926.65mannosidase alpha class 2A member 2 [Source:HGNC S... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aman-10.000e+038.48Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
aman-10.000e+038.48Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
aman-10.000e+038.48Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
aman-25.799e-6025.03Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
aman-32.810e-3226.54Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:O0... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LManII0.000e+041.13gene:FBgn0027611 transcript:FBtr0080030[more]
LManII0.000e+040.93gene:FBgn0027611 transcript:FBtr0080031[more]
LManV0.000e+039.94gene:FBgn0032068 transcript:FBtr0079742[more]
LManV0.000e+039.94gene:FBgn0032068 transcript:FBtr0345752[more]
LManVI0.000e+038.39gene:FBgn0032069 transcript:FBtr0079741[more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
man2b10.000e+043.83mannosidase, alpha, class 2B, member 1 [Source:ZFI... [more]
man2b18.642e-9058.47mannosidase, alpha, class 2B, member 1 [Source:ZFI... [more]
man2a21.810e-7227.42mannosidase, alpha, class 2A, member 2 [Source:ZFI... [more]
man2a21.810e-7227.42mannosidase, alpha, class 2A, member 2 [Source:ZFI... [more]
man2b25.379e-7025.55mannosidase, alpha, class 2B, member 2 [Source:ZFI... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnnc13.807e-13254.37troponin C1, slow skeletal and cardiac type [Sourc... [more]
tnnc13.947e-13254.37troponin C1, slow skeletal and cardiac type [Sourc... [more]
tnnc15.166e-13254.37troponin C1, slow skeletal and cardiac type [Sourc... [more]
tnnc15.632e-13254.32troponin C1, slow skeletal and cardiac type [Sourc... [more]
tnnc16.696e-13254.37troponin C1, slow skeletal and cardiac type [Sourc... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Man2b10.000e+040.04mannosidase 2, alpha B1 [Source:MGI Symbol;Acc:MGI... [more]
Man2a22.518e-7327.60mannosidase 2, alpha 2 [Source:MGI Symbol;Acc:MGI:... [more]
Man2a11.236e-6827.21mannosidase 2, alpha 1 [Source:MGI Symbol;Acc:MGI:... [more]
Man2b24.679e-6624.95mannosidase 2, alpha B2 [Source:MGI Symbol;Acc:MGI... [more]
Man2a21.298e-4130.56mannosidase 2, alpha 2 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Alpha-mannosidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29451|MA2B1_BOVIN0.000e+041.20Lysosomal alpha-mannosidase OS=Bos taurus OX=9913 ... [more]
sp|Q60HE9|MA2B1_MACFA0.000e+040.61Lysosomal alpha-mannosidase OS=Macaca fascicularis... [more]
sp|Q8VHC8|MA2B1_CAVPO0.000e+041.31Lysosomal alpha-mannosidase OS=Cavia porcellus OX=... [more]
sp|O00754|MA2B1_HUMAN0.000e+040.41Lysosomal alpha-mannosidase OS=Homo sapiens OX=960... [more]
sp|O09159|MA2B1_MOUSE0.000e+040.04Lysosomal alpha-mannosidase OS=Mus musculus OX=100... [more]
back to top
BLAST of Alpha-mannosidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QAB90.000e+045.16Alpha-mannosidase OS=Mizuhopecten yessoensis OX=65... [more]
A0A1S3IXF10.000e+045.07Alpha-mannosidase OS=Lingula unguis OX=7574 GN=LOC... [more]
R7T6U80.000e+043.70Alpha-mannosidase OS=Capitella teleta OX=283909 GN... [more]
V9KD730.000e+043.32Alpha-mannosidase (Fragment) OS=Callorhinchus mili... [more]
A0A498NPX40.000e+044.24Alpha-mannosidase OS=Labeo rohita OX=84645 GN=ROHU... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
man2b10.000e+041.86mannosidase, alpha, class 2B, member 1 [Source:ZFI... [more]
man2b10.000e+041.54mannosidase, alpha, class 2B, member 1 [Source:ZFI... [more]
ENSAMXT00000050868.14.755e-8161.90pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
man2a21.886e-7124.80mannosidase alpha class 2A member 2 [Source:NCBI g... [more]
man2a29.235e-7025.99mannosidase alpha class 2A member 2 [Source:NCBI g... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
man2b10.000e+043.44mannosidase, alpha, class 2B, member 1 [Source:ZFI... [more]
ENSPMAT00000006368.12.533e-3738.76pep scaffold:Pmarinus_7.0:GL478975:152485:159376:1... [more]
ENSPMAT00000003432.17.325e-2831.32pep scaffold:Pmarinus_7.0:GL488094:1155:3927:-1 ge... [more]
ENSPMAT00000006359.12.054e-2624.42pep scaffold:Pmarinus_7.0:GL478975:144942:162143:1... [more]
ENSPMAT00000002016.12.240e-1824.92pep scaffold:Pmarinus_7.0:GL477132:216:9947:1 gene... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-mannosidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO375840.000e+041.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408662.537e-5024.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
man2b10.000e+041.35mannosidase alpha class 2B member 1 [Source:NCBI g... [more]
man2a26.150e-7724.85mannosidase alpha class 2A member 2 [Source:NCBI g... [more]
man2b22.897e-7225.31mannosidase alpha class 2B member 2 [Source:NCBI g... [more]
ENSORLT00000044084.15.412e-6424.00alpha-mannosidase 2 [Source:NCBI gene;Acc:10117407... [more]
man2b21.088e-1330.37mannosidase alpha class 2B member 2 [Source:NCBI g... [more]
back to top
BLAST of Alpha-mannosidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000045085.10.000e+099.59SMESG000045085.1[more]
SMESG000045072.10.000e+093.71SMESG000045072.1[more]
SMESG000032135.11.446e-13530.38SMESG000032135.1[more]
SMESG000018139.12.052e-4428.44SMESG000018139.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006606 ID=SMED30006606|Name=Alpha-mannosidase|organism=Schmidtea mediterranea sexual|type=transcript|length=3119bp
TGTGCTAATTTGTATAAAATAAACGTTTGCTAAATTATAAAATTTTATTA
TGGCTTTCATTTTAGTTGTTTCTTTAATAATTAATATATTATTTTTTGGA
ATATATTCCAGTCCCACGACATGTGGCTACAATAGCTGTAACCCTGGAAA
GCCGAATGTTCTCAATGTCCATATAATTTCTCATACACACGATGATGTCG
GGTGGTTGAAGACCGTTGATCAGTATTATTACGGTTATCGAGATAATATC
CAGGGTGCAGGTGTTCAATATATATTGAATACGGTCATTTCCGCATTGTG
GGAAAATCCAAACAGGAAGTTTAGTTATGTTGAGATTGCATACTTCTATC
GGTGGTGGCAGCAGCAAGACAGTACTGTTAGAAACCGTGTTAAGGTTTTA
GTTAACGAAGGTCGATTGCAATTTCTTTTGGGTGGTTGGTGCATGAATGA
TGAAGCCACCACTCATTATGTCTCAATAATTGATCAAATGAGTTTAGGAC
TTGACTTCCTTAATAAAACCTTTGGTGAATGTGGAAGACCGCTTGTGTCT
TGGCAAATAGATCCATTTGGGCATTCAATAGAACAGGCCAATATTTTTGC
TAGCATGGGATTTGACGGATTGTTTTTCTGGCGTCTTGATTACAGAGATA
AAGAACAAAGAATTGCCACTAAAAATATGGAATTCATTCAAAAAGGATCC
TTTCTTCCGACTAAAATTCACAATTATTTATTCACAAATGTTTTATACGA
TTCTTACTGTACTCCACCAGGGTTTTGTTTCGATGACAAATGCAGTGATG
ACCCGATCATGGATGATCCTACATTACACGATTACAATGTGCAAAAACGT
GTTGATGATTTTGCCGATTACGTAATTAAACAATCCAAAGCTTATCAAAC
TAATCACTTGTTAGTCCCCATGGGTTGCGATTTTCAATTCCAAAATGCCA
ACCATAATTTCGTCAATCTTGACAAACTGATTTTCCATGTCAATAGATTA
CGAAAGGATATCAATGTATTTTATTCCACTCCGGCTTGTTACACATTAGC
AATCAACAAAATTGGTAAAAAACTCAAAATCAAGAATGATGACTTTTTTC
CATATGCTAGTGGACCGAATAGCTATTGGACTGGTTATTTCACGAGTAGA
TCTGCTTTGAAAGGATTCGTTCAATATTCGAACAACGTATTTCAAGTATG
CAAACAGCTCCATGTATTAAGTCAACAGAATAGAACCGATTTAAACAAAA
AAATCATTTCAATGGCAATGAAAATGGGAGTTGCCCAGCATCATGATGCT
GTGTCTGGTACGGAAAAGCAGCACGTAGCATTCGATTATGCACAGAGGTT
AAGTGATGGCTTGAGTGACTGTGAAAGTGTTATCAATTCAAGTCTATCAA
AATTAATTTCTAAGGAAACTGTTAATTACGACTTTGTTTTATGTAATTTA
CTTAATATCAGTTTTTGTGCTATTTCGGATAATATTTCCTACACAAAATT
GTTGACAGTTTTAATTTATAACCCTTTAGGTGTAACAAGAATGGAATGGC
ATAGGATTCCTGTGAATGTTTTACATGGTGATGAATATAAAATATCTCAT
TCTAATGGAAGTTTAGTACCATCTCAGCTAGTTCCCATAACAAACTGTAC
AAAGCATCTTCCTGAAAGGCCAAAAGAAAGTTTAGCAAATTATGAGTTAA
CTTTTCAGTCAGTTCTTCCGGCTTTGGGATATGCATCTCTCACGATAATT
AGGTCGAAAAAATCAAATTCATTTACAAAATCGTCAACAATCAAAAATAT
TAATTCGAAAGACAAGATTGTAATTGGGAATAAATATTTGAAATTAACAT
ATGATAATGGGTTTTTAGTCAGCCTTTCAAACCTACAATCAAATGTATCC
GTGAATATTACACAAGATATGCGTTATTATTTTTCTTATCAAGGAAATGG
TCAAAAGTCAGGAGCTTACATTTTTAGACCGACAACAAACGAATCAATGC
CTTTAACGAAGGCCCCAAAATTGACAATAATCAAAGGGGATTTAGTAACA
GAAGTTCATCAAGTTTTTTCCGAATGGGGAATGATCGTTACAAGACTATA
TAATGATTCTAATATTTTGGAAACTGAATGGACAGTTGGACCGATACCAA
TCAACGATTCAAAGGGTAAAGAAATTGTTCTTCAATATCAAACCGACATA
GATTCTGATAATTGTTTTTTTACTGATTCTAACGGTAGACAAATCATCAC
CCGACAAATAAACAAAAGAACCGATTACAACTTTACTCAAACAGAACCAG
TCGCAGGAAACTATTATCCGGTCAACTCTCATGTTTTCTTGGCCGAATTA
AATAATAAGGAACGAAAAAAATCTTTGGTTATTCATACAGACAGAGCAGG
CGGCGTTGGGTCTTATAAAAATGGAATGATAGAAATAATGGTTCATAGAA
GAACTTTATTTGATGATAATTTTGGTGTTGGTGAACCTCTAAATGAGACA
GGGGCAGATGGAAATGGGCTGATTGTAAGGGGAAAGCAGTGGATAAAATT
TGATTACATTGATAACATATACTCAAAAATGAGATTAGAAAGTCTTAAAA
TATTCAATCGGCCAGTTGTTGTCTTTTCCAAAAATACAAACATATCAAAA
TTTGATCAATATTCTGCTCTTTTAGACAATCTGCCTTCCGGTGTAAATAT
TTTGAGTCTAGAGAATCATTTCAATCTCAACAATGAAATTGATTATCAAA
TTATTCGGGTAGAAAATGTATTTTATCAATTCGGCCACTCGATCAAATTA
AATTTTCAAAAGATGTTTCGATCAATCAAAATCACTGAAGTCATCGAACT
CAATTTATCAGCCAATCAATTTCTGAAAGATGTCAAACGGCTGAAATGGA
ATTCCACCAATGATAACTACCAGAATTTCTTTACATCCAATCAAATGATA
GTAACATTATTTCCGGGTCAAATTCGAACATTTAAAATCGTTTCAAAATC
GATTTAGTTGGTATTCAATTGTTGAAATTTTGGATTTTGACTTTTAATTT
TTATGAATAATATTCATATTTAAAATAATATGGAGCATAAAATTTATTTT
TTATTTTTATTAAAAAGAG
back to top

protein sequence of SMED30006606-orf-1

>SMED30006606-orf-1 ID=SMED30006606-orf-1|Name=SMED30006606-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=986bp
MAFILVVSLIINILFFGIYSSPTTCGYNSCNPGKPNVLNVHIISHTHDDV
GWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFY
RWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLG
LDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRD
KEQRIATKNMEFIQKGSFLPTKIHNYLFTNVLYDSYCTPPGFCFDDKCSD
DPIMDDPTLHDYNVQKRVDDFADYVIKQSKAYQTNHLLVPMGCDFQFQNA
NHNFVNLDKLIFHVNRLRKDINVFYSTPACYTLAINKIGKKLKIKNDDFF
PYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQNRTDLNK
KIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLS
KLISKETVNYDFVLCNLLNISFCAISDNISYTKLLTVLIYNPLGVTRMEW
HRIPVNVLHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYEL
TFQSVLPALGYASLTIIRSKKSNSFTKSSTIKNINSKDKIVIGNKYLKLT
YDNGFLVSLSNLQSNVSVNITQDMRYYFSYQGNGQKSGAYIFRPTTNESM
PLTKAPKLTIIKGDLVTEVHQVFSEWGMIVTRLYNDSNILETEWTVGPIP
INDSKGKEIVLQYQTDIDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEP
VAGNYYPVNSHVFLAELNNKERKKSLVIHTDRAGGVGSYKNGMIEIMVHR
RTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDNIYSKMRLESLK
IFNRPVVVFSKNTNISKFDQYSALLDNLPSGVNILSLENHFNLNNEIDYQ
IIRVENVFYQFGHSIKLNFQKMFRSIKITEVIELNLSANQFLKDVKRLKW
NSTNDNYQNFFTSNQMIVTLFPGQIRTFKIVSKSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037094Glyco_hydro_38_cen_sf
IPR015341Glyco_hydro_38_cen
IPR011682Glyco_hydro_38_C
IPR000602Glyco_hydro_38_N
IPR013780Glyco_hydro_b
IPR027291Glyco_hydro_38_N_sf
IPR011330Glyco_hydro/deAcase_b/a-brl
IPR028995Glyco_hydro_57/38_cen_sf
IPR011013Gal_mutarotase_sf_dom
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0015923mannosidase activity
GO:0004559alpha-mannosidase activity
GO:0003824catalytic activity
GO:0030246carbohydrate binding
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006013mannose metabolic process
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015341Glycoside hydrolase family 38, central domainSMARTSM00872Alpha_mann_mid_2coord: 358..434
e-value: 7.6E-16
score: 68.6
IPR015341Glycoside hydrolase family 38, central domainPFAMPF09261Alpha-mann_midcoord: 358..452
e-value: 6.0E-19
score: 68.0
IPR000602Glycoside hydrolase family 38, N-terminal domainPFAMPF01074Glyco_hydro_38Ncoord: 39..353
e-value: 5.6E-83
score: 278.6
IPR013780Glycosyl hydrolase, all-betaGENE3DG3DSA:2.60.40.1180coord: 464..569
e-value: 6.1E-19
score: 70.0
IPR037094Glycoside hydrolase family 38, central domain superfamilyGENE3DG3DSA:1.20.1270.50coord: 401..459
e-value: 2.4E-22
score: 80.2
IPR037094Glycoside hydrolase family 38, central domain superfamilyGENE3DG3DSA:1.20.1270.50coord: 320..400
e-value: 1.3E-30
score: 106.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.1360coord: 868..984
e-value: 4.2E-18
score: 67.5
NoneNo IPR availableGENE3DG3DSA:2.70.98.30coord: 588..852
e-value: 5.4E-91
score: 306.2
NoneNo IPR availablePANTHERPTHR11607:SF3LYSOSOMAL ALPHA-MANNOSIDASEcoord: 12..980
NoneNo IPR availablePANTHERPTHR11607ALPHA-MANNOSIDASEcoord: 12..980
NoneNo IPR availableCDDcd10810GH38N_AMII_LAM_likecoord: 38..315
e-value: 9.99143E-176
score: 509.831
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.85
NoneNo IPR availableTMHMMTMhelixcoord: 2..19
IPR011682Glycosyl hydrolase family 38, C-terminalPFAMPF07748Glyco_hydro_38Ccoord: 592..807
e-value: 5.0E-37
score: 128.1
IPR027291Glycoside hydrolase 38, N-terminal domain superfamilyGENE3DG3DSA:3.20.110.10coord: 38..319
e-value: 3.1E-116
score: 389.8
IPR028995Glycoside hydrolase families 57/38, central domain superfamilySUPERFAMILYSSF88688Families 57/38 glycoside transferase middle domaincoord: 357..455
IPR011013Galactose mutarotase-like domain superfamilySUPERFAMILYSSF74650Galactose mutarotase-likecoord: 460..980
IPR011330Glycoside hydrolase/deacetylase, beta/alpha-barrelSUPERFAMILYSSF88713Glycoside hydrolase/deacetylasecoord: 26..356