ZMYM-1

Overview
NameZMYM-1 (AFD29614.1)
Smed IDSMED30006591
Length (bp)1967
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ZMYM-1 (SMED30006591) t-SNE clustered cells

Violin plots show distribution of expression levels for ZMYM-1 (SMED30006591) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ZMYM-1 (SMED30006591) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ZMYM-1 (SMED30006591) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006591

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006591SMESG000032185.1 SMESG000032173.1 SmedASXL_016678SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006591SMESG000032185.1 SMESG000032173.1 SmedASXL_016678SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30006591SMESG000032185.1 SMESG000032173.1 dd_Smed_v4_3776_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006591SMESG000032185.1 SMESG000032173.1 dd_Smed_v4_3776_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006591SMESG000032185.1 SMESG000032173.1 dd_Smed_v4_3776_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006591SMESG000032185.1 SMESG000032173.1 dd_Smed_v4_3776_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006591SMESG000032185.1 SMESG000032173.1 dd_Smed_v4_3776_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006591SMESG000032185.1 SMESG000032173.1 dd_Smed_v4_3776_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30006591SMESG000032173.1 Contig925uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30006591SMESG000032173.1 Contig925uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30006591SMESG000032173.1 Contig925newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30006591SMESG000032173.1 Contig925newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30006591SMESG000010389.1 SMESG000010378.1 Contig925uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30006591SMESG000010389.1 SMESG000010378.1 Contig925uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30006591SMESG000010389.1 SMESG000010378.1 Contig925newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30006591SMESG000010389.1 SMESG000010378.1 Contig925newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
neoblastSMED30006591SMESG000032173.1 SMED_02942_V2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ZMYM-1 vs. Ensembl Human
Match: ZMYM2 (zinc finger MYM-type containing 2 [Source:HGNC Symbol;Acc:HGNC:12989])

HSP 1 Score: 148.288 bits (373), Expect = 2.365e-36
Identity = 92/303 (30.36%), Postives = 141/303 (46.53%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQL--------------EVSESKITYLSNSDN----------------VKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
             KY+YG+NAW+HW K                        DLL  T  E+N  +  FV +IR+P  E Y PDSI+YLCLGIQ +L     + N+F+DP    F+ ELNKIL ++QP +  +  +  R+EED+LW   QLG H P  LL ++ Y  T+   + TVE+H +LS   +                   +++ L  +DN                V  ++    N  R    +   Y+ K  +  + ++   + YL+P  S   D        +WY S  +D + L+ ML R+ +VK++
Sbjct: 1070 FKYTYGVNAWKHWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGENYAPDSIYYLCLGIQEYLCGSNRKDNIFIDPGYQTFEQELNKILRSWQPSILPDGSIFSRVEEDYLWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSK--SPQNLNQRMDVFYLQPECSSSTDS------PVWYTSTSLDRNTLENMLVRVLLVKDI 1364          
BLAST of ZMYM-1 vs. Ensembl Human
Match: ZMYM2 (zinc finger MYM-type containing 2 [Source:HGNC Symbol;Acc:HGNC:12989])

HSP 1 Score: 148.288 bits (373), Expect = 2.365e-36
Identity = 92/303 (30.36%), Postives = 141/303 (46.53%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQL--------------EVSESKITYLSNSDN----------------VKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
             KY+YG+NAW+HW K                        DLL  T  E+N  +  FV +IR+P  E Y PDSI+YLCLGIQ +L     + N+F+DP    F+ ELNKIL ++QP +  +  +  R+EED+LW   QLG H P  LL ++ Y  T+   + TVE+H +LS   +                   +++ L  +DN                V  ++    N  R    +   Y+ K  +  + ++   + YL+P  S   D        +WY S  +D + L+ ML R+ +VK++
Sbjct: 1070 FKYTYGVNAWKHWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGENYAPDSIYYLCLGIQEYLCGSNRKDNIFIDPGYQTFEQELNKILRSWQPSILPDGSIFSRVEEDYLWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSK--SPQNLNQRMDVFYLQPECSSSTDS------PVWYTSTSLDRNTLENMLVRVLLVKDI 1364          
BLAST of ZMYM-1 vs. Ensembl Human
Match: ZMYM2 (zinc finger MYM-type containing 2 [Source:HGNC Symbol;Acc:HGNC:12989])

HSP 1 Score: 148.288 bits (373), Expect = 2.365e-36
Identity = 92/303 (30.36%), Postives = 141/303 (46.53%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQL--------------EVSESKITYLSNSDN----------------VKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
             KY+YG+NAW+HW K                        DLL  T  E+N  +  FV +IR+P  E Y PDSI+YLCLGIQ +L     + N+F+DP    F+ ELNKIL ++QP +  +  +  R+EED+LW   QLG H P  LL ++ Y  T+   + TVE+H +LS   +                   +++ L  +DN                V  ++    N  R    +   Y+ K  +  + ++   + YL+P  S   D        +WY S  +D + L+ ML R+ +VK++
Sbjct: 1070 FKYTYGVNAWKHWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGENYAPDSIYYLCLGIQEYLCGSNRKDNIFIDPGYQTFEQELNKILRSWQPSILPDGSIFSRVEEDYLWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSK--SPQNLNQRMDVFYLQPECSSSTDS------PVWYTSTSLDRNTLENMLVRVLLVKDI 1364          
BLAST of ZMYM-1 vs. Ensembl Human
Match: ZMYM3 (zinc finger MYM-type containing 3 [Source:HGNC Symbol;Acc:HGNC:13054])

HSP 1 Score: 147.132 bits (370), Expect = 6.273e-36
Identity = 97/311 (31.19%), Postives = 142/311 (45.66%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL-----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKIT------------YLSNSDNVKYELCAETNAKR---------------------SFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESL 1862
            L YSYG+NAW+ W ++                        D+L  +  E+N  + +FV++I +P  E Y PDSI+YLCLGIQ +L ++   +N+F D   + F  ELNK L+T+QP L  N+ +  R+EE+HLWE  QLG + P VLL ++ +  T+   + T EEH +LS + +     K T            Y +     K         KR                      FY     Y+ KC    S      + YL+P      ++       LWY   P+D S+L+ MLNRI  V+E+ E L
Sbjct: 1064 LNYSYGVNAWKCWVQSKYANGETSKGDELRFGPKPMRIKEDILACSAAELNYGLAQFVREITRPNGERYEPDSIYYLCLGIQQYLLENNRMVNIFTDLYYLTFVQELNKSLSTWQPTLLPNNTVFSRVEEEHLWECKQLGVYSPFVLLNTLMFFNTKFFGLQTAEEHMQLSFTNVVRQSRKCTTPRGTTKVVSIRYYAPVRQRKGRDTGPGKRKREDEAPILEQRENRMNPLRCPVKFYEF---YLSKCPE--SLRTRNDVFYLQP------ERSCIAESPLWYSVIPMDRSMLESMLNRILAVREIYEEL 1363          
BLAST of ZMYM-1 vs. Ensembl Human
Match: ZMYM3 (zinc finger MYM-type containing 3 [Source:HGNC Symbol;Acc:HGNC:13054])

HSP 1 Score: 147.132 bits (370), Expect = 6.497e-36
Identity = 97/311 (31.19%), Postives = 142/311 (45.66%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL-----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKIT------------YLSNSDNVKYELCAETNAKR---------------------SFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESL 1862
            L YSYG+NAW+ W ++                        D+L  +  E+N  + +FV++I +P  E Y PDSI+YLCLGIQ +L ++   +N+F D   + F  ELNK L+T+QP L  N+ +  R+EE+HLWE  QLG + P VLL ++ +  T+   + T EEH +LS + +     K T            Y +     K         KR                      FY     Y+ KC    S      + YL+P      ++       LWY   P+D S+L+ MLNRI  V+E+ E L
Sbjct: 1062 LNYSYGVNAWKCWVQSKYANGETSKGDELRFGPKPMRIKEDILACSAAELNYGLAQFVREITRPNGERYEPDSIYYLCLGIQQYLLENNRMVNIFTDLYYLTFVQELNKSLSTWQPTLLPNNTVFSRVEEEHLWECKQLGVYSPFVLLNTLMFFNTKFFGLQTAEEHMQLSFTNVVRQSRKCTTPRGTTKVVSIRYYAPVRQRKGRDTGPGKRKREDEAPILEQRENRMNPLRCPVKFYEF---YLSKCPE--SLRTRNDVFYLQP------ERSCIAESPLWYSVIPMDRSMLESMLNRILAVREIYEEL 1361          
BLAST of ZMYM-1 vs. Ensembl Fly
Match: woc (gene:FBgn0010328 transcript:FBtr0308502)

HSP 1 Score: 141.739 bits (356), Expect = 6.711e-35
Identity = 91/297 (30.64%), Postives = 143/297 (48.15%), Query Frame = 3
Query: 1098 LKYSYGINAWRHW--SKNLD--------------LLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVS---ESKITYLSNSDNVKYELCA--------------------ETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESLLSS 1871
            LKY++G+NAW+ W  +KN D              LL++T  E+N  +  FV+++RKP    Y PD+I+YL LGIQ +L  +    N+F DP    F   L+++   F     ++  +V R+EE+HLWE  QLG H P VLL ++ +  T++  ++TVEEH +LS S +       S+ + +  S NV                          E N  R    +   Y+ KC    S      + YL+P  S   D        +WY +  +    L  ML+R+++VKE+  +LL++
Sbjct:  424 LKYTFGVNAWKQWVMTKNADIEKSSMRRRPFKTELLQMTADELNYSLCLFVKEVRKPNGTEYAPDTIYYLVLGIQQYLYVNGRIDNIFYDPYYERFTECLDEVARKFSVLYNDSQYIVTRVEEEHLWECKQLGAHSPHVLLSTLMFFNTKHFNLTTVEEHMQLSFSHIMKHWKRSSQNSKVPGSRNVLLRFYPPQAGLDANPRKKKVYEQQENEENPLRCPVRLYEFYLSKCPE--SVKTRNDVFYLQPERSCVPD------SPVWYSTQALGQDALQRMLHRVKMVKEINIALLTT 712          
BLAST of ZMYM-1 vs. Ensembl Fly
Match: woc (gene:FBgn0010328 transcript:FBtr0085178)

HSP 1 Score: 142.124 bits (357), Expect = 1.271e-34
Identity = 91/297 (30.64%), Postives = 143/297 (48.15%), Query Frame = 3
Query: 1098 LKYSYGINAWRHW--SKNLD--------------LLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEV---SESKITYLSNSDNVKYELCA--------------------ETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESLLSS 1871
            LKY++G+NAW+ W  +KN D              LL++T  E+N  +  FV+++RKP    Y PD+I+YL LGIQ +L  +    N+F DP    F   L+++   F     ++  +V R+EE+HLWE  QLG H P VLL ++ +  T++  ++TVEEH +LS S +       S+ + +  S NV                          E N  R    +   Y+ KC    S      + YL+P  S   D        +WY +  +    L  ML+R+++VKE+  +LL++
Sbjct: 1400 LKYTFGVNAWKQWVMTKNADIEKSSMRRRPFKTELLQMTADELNYSLCLFVKEVRKPNGTEYAPDTIYYLVLGIQQYLYVNGRIDNIFYDPYYERFTECLDEVARKFSVLYNDSQYIVTRVEEEHLWECKQLGAHSPHVLLSTLMFFNTKHFNLTTVEEHMQLSFSHIMKHWKRSSQNSKVPGSRNVLLRFYPPQAGLDANPRKKKVYEQQENEENPLRCPVRLYEFYLSKCPE--SVKTRNDVFYLQPERSCVPDS------PVWYSTQALGQDALQRMLHRVKMVKEINIALLTT 1688          
BLAST of ZMYM-1 vs. Ensembl Fly
Match: woc (gene:FBgn0010328 transcript:FBtr0112857)

HSP 1 Score: 142.124 bits (357), Expect = 1.311e-34
Identity = 91/297 (30.64%), Postives = 143/297 (48.15%), Query Frame = 3
Query: 1098 LKYSYGINAWRHW--SKNLD--------------LLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEV---SESKITYLSNSDNVKYELCA--------------------ETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESLLSS 1871
            LKY++G+NAW+ W  +KN D              LL++T  E+N  +  FV+++RKP    Y PD+I+YL LGIQ +L  +    N+F DP    F   L+++   F     ++  +V R+EE+HLWE  QLG H P VLL ++ +  T++  ++TVEEH +LS S +       S+ + +  S NV                          E N  R    +   Y+ KC    S      + YL+P  S   D        +WY +  +    L  ML+R+++VKE+  +LL++
Sbjct: 1415 LKYTFGVNAWKQWVMTKNADIEKSSMRRRPFKTELLQMTADELNYSLCLFVKEVRKPNGTEYAPDTIYYLVLGIQQYLYVNGRIDNIFYDPYYERFTECLDEVARKFSVLYNDSQYIVTRVEEEHLWECKQLGAHSPHVLLSTLMFFNTKHFNLTTVEEHMQLSFSHIMKHWKRSSQNSKVPGSRNVLLRFYPPQAGLDANPRKKKVYEQQENEENPLRCPVRLYEFYLSKCPE--SVKTRNDVFYLQPERSCVPDS------PVWYSTQALGQDALQRMLHRVKMVKEINIALLTT 1703          
BLAST of ZMYM-1 vs. Ensembl Fly
Match: woc (gene:FBgn0010328 transcript:FBtr0334731)

HSP 1 Score: 142.124 bits (357), Expect = 1.346e-34
Identity = 91/297 (30.64%), Postives = 143/297 (48.15%), Query Frame = 3
Query: 1098 LKYSYGINAWRHW--SKNLD--------------LLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEV---SESKITYLSNSDNVKYELCA--------------------ETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESLLSS 1871
            LKY++G+NAW+ W  +KN D              LL++T  E+N  +  FV+++RKP    Y PD+I+YL LGIQ +L  +    N+F DP    F   L+++   F     ++  +V R+EE+HLWE  QLG H P VLL ++ +  T++  ++TVEEH +LS S +       S+ + +  S NV                          E N  R    +   Y+ KC    S      + YL+P  S   D        +WY +  +    L  ML+R+++VKE+  +LL++
Sbjct: 1414 LKYTFGVNAWKQWVMTKNADIEKSSMRRRPFKTELLQMTADELNYSLCLFVKEVRKPNGTEYAPDTIYYLVLGIQQYLYVNGRIDNIFYDPYYERFTECLDEVARKFSVLYNDSQYIVTRVEEEHLWECKQLGAHSPHVLLSTLMFFNTKHFNLTTVEEHMQLSFSHIMKHWKRSSQNSKVPGSRNVLLRFYPPQAGLDANPRKKKVYEQQENEENPLRCPVRLYEFYLSKCPE--SVKTRNDVFYLQPERSCVPDS------PVWYSTQALGQDALQRMLHRVKMVKEINIALLTT 1702          
BLAST of ZMYM-1 vs. Ensembl Fly
Match: woc (gene:FBgn0010328 transcript:FBtr0334730)

HSP 1 Score: 142.124 bits (357), Expect = 1.440e-34
Identity = 91/297 (30.64%), Postives = 143/297 (48.15%), Query Frame = 3
Query: 1098 LKYSYGINAWRHW--SKNLD--------------LLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEV---SESKITYLSNSDNVKYELCA--------------------ETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESLLSS 1871
            LKY++G+NAW+ W  +KN D              LL++T  E+N  +  FV+++RKP    Y PD+I+YL LGIQ +L  +    N+F DP    F   L+++   F     ++  +V R+EE+HLWE  QLG H P VLL ++ +  T++  ++TVEEH +LS S +       S+ + +  S NV                          E N  R    +   Y+ KC    S      + YL+P  S   D        +WY +  +    L  ML+R+++VKE+  +LL++
Sbjct: 1399 LKYTFGVNAWKQWVMTKNADIEKSSMRRRPFKTELLQMTADELNYSLCLFVKEVRKPNGTEYAPDTIYYLVLGIQQYLYVNGRIDNIFYDPYYERFTECLDEVARKFSVLYNDSQYIVTRVEEEHLWECKQLGAHSPHVLLSTLMFFNTKHFNLTTVEEHMQLSFSHIMKHWKRSSQNSKVPGSRNVLLRFYPPQAGLDANPRKKKVYEQQENEENPLRCPVRLYEFYLSKCPE--SVKTRNDVFYLQPERSCVPDS------PVWYSTQALGQDALQRMLHRVKMVKEINIALLTT 1687          
BLAST of ZMYM-1 vs. Ensembl Zebrafish
Match: zmym2 (zinc finger, MYM-type 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2408])

HSP 1 Score: 131.339 bits (329), Expect = 4.428e-31
Identity = 91/301 (30.23%), Postives = 138/301 (45.85%), Query Frame = 3
Query: 1098 LKYSYGINAWRHW-------SKNLDLLKLTVT-----------EINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKITY-------------------LSNSDNVKYELC-----AETNAKRSFYTIVRT--------YIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
            L   YG+NAWR W       SK  +  K  V+           E+N+ +  FV+++R+P  E Y PDS+ YLCLGIQ  LQD     +LF D +   F  ELNK+L  +QP +  +     R+EE +LW S QLG   P VLL SV Y+ T+   + T E+H +LS + +    S   +                    S S   + + C     +++ +  S +  V+         Y+ KC    S  +     Y++P  S  +D        LW+ S P++ S+L  +L R  +V+EV
Sbjct: 1054 LSSRYGLNAWRRWATTEDSPSKGKESQKQAVSLKSSLLSLSQEELNQSLSRFVKEVRRPNGEHYSPDSLLYLCLGIQKHLQDKGRTDDLFNDSQYEMFGEELNKLLKDWQPSVLPDGSRWSRVEEQYLWSSGQLGEQAPSVLLRSVFYLNTKYFGLRTPEQHLRLSFANVYGPSSSKPHSHETTVCIRIPSISQEQHEQSGSKRRRKDYCDSNFDSDSGSGGSAHCPVKKHECRLYELYLSKCPE--SVRQRTDFFYMKPEVSASSD------SPLWFSSTPLEKSVLSRLLTRALLVREV 1346          
BLAST of ZMYM-1 vs. Ensembl Zebrafish
Match: si:ch211-173p18.3 (si:ch211-173p18.3 [Source:ZFIN;Acc:ZDB-GENE-060503-672])

HSP 1 Score: 125.946 bits (315), Expect = 2.199e-29
Identity = 94/350 (26.86%), Postives = 157/350 (44.86%), Query Frame = 3
Query:  948 ISNDEESSAPPKELP-VESKKRRHSDTESMPNKIRKTEATAIEKKEIDPCKLKYSYGINAWRHW----------------SKNL----DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEV-----SESKITYL--------SNSDNVKYE-----------LCAETNAKRSFYTIVRT---YIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQ 1853
            + ND       K+ P V ++K+R     S+P+ I                KL++ YG+ AWR W                S+++    D+LK    E++  + +F+ ++R+P  E Y PDSI+YLCLGIQ +L ++    N+F D     F  E++ IL  ++P +  N  +  R+EE+ LW   QLG   PGVLL ++ Y  T+     TVE+H  LS + ++      + +K+++L        S+ D V  +           L    N+    +  VR    Y+ KC+       ++   YL P      ++        W+  + +    LD ML+RI  V+E+ 
Sbjct:  736 MENDSGKRRSCKKGPDVSTQKKRGRKCASVPSNILS--------------KLQHEYGVKAWRDWVRWKNAQPNSDAPKFGSRSMTLKEDVLKCCTAELSYGLCKFITEVRRPNGEKYSPDSIYYLCLGIQQYLFENNRMENIFSDVFYTKFCWEMSNILKGWKPTILPNGYIHSRVEEEFLWNCKQLGAFSPGVLLNTLIYFFTKYFNYRTVEQHRLLSFAHVKRYTRGPANAKVSFLRFYPPKEDSSDDGVPAKKRKKDDERQRVLKIGQNSDNPLHCPVRLYEFYLSKCSPGIRHHATK--FYLSP------ERSCVPSSPTWFSISALSDEALDSMLSRILTVRELH 1063          
BLAST of ZMYM-1 vs. Ensembl Zebrafish
Match: si:ch211-173p18.3 (si:ch211-173p18.3 [Source:ZFIN;Acc:ZDB-GENE-060503-672])

HSP 1 Score: 125.561 bits (314), Expect = 2.953e-29
Identity = 94/350 (26.86%), Postives = 157/350 (44.86%), Query Frame = 3
Query:  948 ISNDEESSAPPKELP-VESKKRRHSDTESMPNKIRKTEATAIEKKEIDPCKLKYSYGINAWRHW----------------SKNL----DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEV-----SESKITYL--------SNSDNVKYE-----------LCAETNAKRSFYTIVRT---YIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQ 1853
            + ND       K+ P V ++K+R     S+P+ I                KL++ YG+ AWR W                S+++    D+LK    E++  + +F+ ++R+P  E Y PDSI+YLCLGIQ +L ++    N+F D     F  E++ IL  ++P +  N  +  R+EE+ LW   QLG   PGVLL ++ Y  T+     TVE+H  LS + ++      + +K+++L        S+ D V  +           L    N+    +  VR    Y+ KC+       ++   YL P      ++        W+  + +    LD ML+RI  V+E+ 
Sbjct: 1012 MENDSGKRRSCKKGPDVSTQKKRGRKCASVPSNILS--------------KLQHEYGVKAWRDWVRWKNAQPNSDAPKFGSRSMTLKEDVLKCCTAELSYGLCKFITEVRRPNGEKYSPDSIYYLCLGIQQYLFENNRMENIFSDVFYTKFCWEMSNILKGWKPTILPNGYIHSRVEEEFLWNCKQLGAFSPGVLLNTLIYFFTKYFNYRTVEQHRLLSFAHVKRYTRGPANAKVSFLRFYPPKEDSSDDGVPAKKRKKDDERQRVLKIGQNSDNPLHCPVRLYEFYLSKCSPGIRHHATK--FYLSP------ERSCVPSSPTWFSISALSDEALDSMLSRILTVRELH 1339          
BLAST of ZMYM-1 vs. Ensembl Zebrafish
Match: zmym4 (zinc finger, MYM-type 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5459])

HSP 1 Score: 124.405 bits (311), Expect = 7.361e-29
Identity = 90/337 (26.71%), Postives = 145/337 (43.03%), Query Frame = 3
Query: 1002 KKRRHSDTESMPNKIRKTEATAIEKKEIDP------CKLKYSYGINAWRHW----------------SKNL----DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQL-----EVSESKITYL------SNSDNVK---------------YELCAET-NAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQ 1853
            +K R    +  P K R  +  A    +  P       KL++ YG+ AWR W                S+++    DLLK    EI+  + +F+ ++R+P  E Y PDSI+YLCLGIQ +L ++    N+F D     F  E+  IL  ++P +  +  +  R+EE++LW+  QLG   PGVLL ++ Y  T+     T E+H  LS   +         +K+  L        +D V                YE+   + N  R    +   Y+ KC+   S  +     YL P      ++       +W+  + +    L+ ML RI  V+E+ 
Sbjct:  981 RKSRKRARDGFPQKKRARKTAAELPAKSAPENLSNISKLQHEYGVTAWRDWVRWRNAQPNMETPKFGSRSMTLKEDLLKCCTAEISYGLCKFITEVRRPNGEKYSPDSIYYLCLGIQQYLFENSRMENIFADVFYTKFCQEMTNILRDWRPTVLPSGYIHSRVEEEYLWDCKQLGAFSPGVLLNTLIYFFTKYFNYRTAEQHRLLSFGHIVRCSRSKGNTKVACLRFYPPKDEADGVPAKRRKEEGEEEDETVYEIKENSDNPLRCPVRLYEFYLSKCSP--SVRQRTTDFYLSP------ERSCVPNSPMWFSISALSDEALNSMLTRILTVRELH 1309          
BLAST of ZMYM-1 vs. Ensembl Zebrafish
Match: zmym4 (zinc finger, MYM-type 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5459])

HSP 1 Score: 124.405 bits (311), Expect = 7.361e-29
Identity = 90/337 (26.71%), Postives = 145/337 (43.03%), Query Frame = 3
Query: 1002 KKRRHSDTESMPNKIRKTEATAIEKKEIDP------CKLKYSYGINAWRHW----------------SKNL----DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQL-----EVSESKITYL------SNSDNVK---------------YELCAET-NAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQ 1853
            +K R    +  P K R  +  A    +  P       KL++ YG+ AWR W                S+++    DLLK    EI+  + +F+ ++R+P  E Y PDSI+YLCLGIQ +L ++    N+F D     F  E+  IL  ++P +  +  +  R+EE++LW+  QLG   PGVLL ++ Y  T+     T E+H  LS   +         +K+  L        +D V                YE+   + N  R    +   Y+ KC+   S  +     YL P      ++       +W+  + +    L+ ML RI  V+E+ 
Sbjct:  981 RKSRKRARDGFPQKKRARKTAAELPAKSAPENLSNISKLQHEYGVTAWRDWVRWRNAQPNMETPKFGSRSMTLKEDLLKCCTAEISYGLCKFITEVRRPNGEKYSPDSIYYLCLGIQQYLFENSRMENIFADVFYTKFCQEMTNILRDWRPTVLPSGYIHSRVEEEYLWDCKQLGAFSPGVLLNTLIYFFTKYFNYRTAEQHRLLSFGHIVRCSRSKGNTKVACLRFYPPKDEADGVPAKRRKEEGEEEDETVYEIKENSDNPLRCPVRLYEFYLSKCSP--SVRQRTTDFYLSP------ERSCVPNSPMWFSISALSDEALNSMLTRILTVRELH 1309          
BLAST of ZMYM-1 vs. Ensembl Xenopus
Match: zmym4 (zinc finger MYM-type containing 4 [Source:NCBI gene;Acc:100170162])

HSP 1 Score: 143.665 bits (361), Expect = 8.125e-35
Identity = 101/385 (26.23%), Postives = 168/385 (43.64%), Query Frame = 3
Query:  930 QEKHITISNDEESSAPPKELPVESK----------KRRHSDTESMP-NKIRKTEATAIEKKEI-----DPCK-----LKYSYGINAWRHWSK--------------------NLDLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKITYLSNSDNVKY--------------------------------ELCAET-NAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESL 1862
            Q+  +    D ES  P +    + K          +R+H D    P  + RK    A+E + +       C      LKY YG+NAW++W +                      DLL  T +E++  + +F+Q++++P  E Y  DSI YLCLG+Q +L ++    N+F +P    F  EL K+L  + P +  N  +  RIEE+HLWE  QLG + P +LL ++ +  T+  ++ TV EH +LS + +      + Y + +  +++                                E+   T N  R    +   Y+ KC+   S  +   + YL+P      ++       +W+ + P+D   LD ML RI +V+EV E L
Sbjct: 1076 QQSRVGTEQDLESDFPTEAFDPQGKGSSFFSRSRTRRKHRDGFPQPKRRGRKKSIVAVEPRNLIQGTYPGCSPLGSTLKYMYGVNAWKNWVRWKNTQEDHEELKFGVRPIKLKEDLLSCTFSELSYGLCQFIQEVQRPNGEKYNADSILYLCLGVQQYLFENGRIDNIFTEP-YSRFMVELTKLLKNWHPPILPNGFMFSRIEEEHLWECKQLGAYSPIILLNTLLFFTTKYFQLKTVSEHQQLSFAYVMRRTKTMKYNTKTTYLRFMPPYQKSDVEHAGKPPVGKRKRVEGEDGQFVMEMAENTDNPLRCPVRLYEFYLSKCSE--SVKQRNDVFYLQP------ERSCVPNSPMWFSTMPIDPGTLDSMLTRILMVREVHEEL 1451          
BLAST of ZMYM-1 vs. Ensembl Xenopus
Match: zmym4 (zinc finger MYM-type containing 4 [Source:NCBI gene;Acc:100170162])

HSP 1 Score: 143.28 bits (360), Expect = 8.726e-35
Identity = 101/385 (26.23%), Postives = 168/385 (43.64%), Query Frame = 3
Query:  930 QEKHITISNDEESSAPPKELPVESK----------KRRHSDTESMP-NKIRKTEATAIEKKEI-----DPCK-----LKYSYGINAWRHWSK--------------------NLDLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKITYLSNSDNVKY--------------------------------ELCAET-NAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESL 1862
            Q+  +    D ES  P +    + K          +R+H D    P  + RK    A+E + +       C      LKY YG+NAW++W +                      DLL  T +E++  + +F+Q++++P  E Y  DSI YLCLG+Q +L ++    N+F +P    F  EL K+L  + P +  N  +  RIEE+HLWE  QLG + P +LL ++ +  T+  ++ TV EH +LS + +      + Y + +  +++                                E+   T N  R    +   Y+ KC+   S  +   + YL+P      ++       +W+ + P+D   LD ML RI +V+EV E L
Sbjct: 1128 QQSRVGTEQDLESDFPTEAFDPQGKGSSFFSRSRTRRKHRDGFPQPKRRGRKKSIVAVEPRNLIQGTYPGCSPLGSTLKYMYGVNAWKNWVRWKNTQEDHEELKFGVRPIKLKEDLLSCTFSELSYGLCQFIQEVQRPNGEKYNADSILYLCLGVQQYLFENGRIDNIFTEP-YSRFMVELTKLLKNWHPPILPNGFMFSRIEEEHLWECKQLGAYSPIILLNTLLFFTTKYFQLKTVSEHQQLSFAYVMRRTKTMKYNTKTTYLRFMPPYQKSDVEHAGKPPVGKRKRVEGEDGQFVMEMAENTDNPLRCPVRLYEFYLSKCSE--SVKQRNDVFYLQP------ERSCVPNSPMWFSTMPIDPGTLDSMLTRILMVREVHEEL 1503          
BLAST of ZMYM-1 vs. Ensembl Xenopus
Match: comt (catechol-O-methyltransferase [Source:Xenbase;Acc:XB-GENE-948947])

HSP 1 Score: 143.28 bits (360), Expect = 1.069e-34
Identity = 93/304 (30.59%), Postives = 148/304 (48.68%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNLD-----------------------LLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLE--------VSESK------ITYLSNSDN----------------VKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
             KYSYG+NAW+HW K  +                       LL+ + +E++  +  FV +IR+P  + Y PDSI+YLCLGIQ FL   K + N+F DP    F  E NKI+ T+QP +  +  +  R+EE++LW   QLG   P  LLF++ Y  T+   + TVE+H +LS   +          +ESK      ++ L  SD+                V  +L    ++ R    I   Y+ K  +  + ++   + YL+P +S   D       ++WY S+ +D + L+ ML R+ +VK++
Sbjct: 1056 FKYSYGMNAWKHWLKTQNTSSDELSPTTEPSFTKSVKLKEELLQHSPSELSCLLARFVNEIRRPNGKIYAPDSIYYLCLGIQEFLSSCKRKDNIFFDPDYHAFGEEFNKIVRTWQPSILPDGSIFSRVEEEYLWRLDQLGTQSPMSLLFTLLYFNTKYFNLKTVEQHLRLSFGNVFRQQKSNPLTNESKACLQYQVSSLCESDSEDKITPGKRKHEDEEPVYEQLENTADSSRCPVKIFEYYLSK--SPENLNQRMDIFYLKPESSALTD------STIWYSSSSLDRNTLENMLIRVLLVKDI 1351          
BLAST of ZMYM-1 vs. Ensembl Xenopus
Match: ZMYM3 (zinc finger MYM-type containing 3 [Source:NCBI gene;Acc:100495745])

HSP 1 Score: 139.043 bits (349), Expect = 2.004e-33
Identity = 97/311 (31.19%), Postives = 144/311 (46.30%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL-----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSES----------KITYLSNSDNVKYELCAETNAKRS-----------------------FYTIVRTYIEKC--NALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQE 1856
            L ++YG+NAW+ W +                         D+L  T  E+N  + +FV++I +P  + Y PDSI+YLCLGIQ +L ++   +N+F D   + F  ELNKIL  +   L  N +   R++E+HLW+  QLG + P VLL ++ Y  T+   + T EEH +LS S + V  S          K+  +     V+ +   E++AKR                        FY     Y+ KC  N   S +    L YL+P  S  A+        LWY   P+D S+L  ML RI  V++V E
Sbjct:  983 LSFTYGVNAWKAWVQRKYDGVEPSKGEELRFGPKPMRIKEDILACTAAELNYGLAQFVKEITRPNGDRYEPDSIYYLCLGIQQYLLENNRMVNIFTDLYYLTFVQELNKILTAWHRSLAPNRLSFSRVQEEHLWDCKQLGVYSPFVLLNTLMYFNTKFFGLRTAEEHMQLSFSNV-VRHSRKCSTNRGTIKLVSVRYYPPVRQKKGRESSAKRKREDDQPVLEQPENKMNPLRCPVKFYEF---YLSKCPENLRNSGE----LFYLQPERSCVAES------PLWYSVVPMDKSMLHSMLTRILAVRDVYE 1279          
BLAST of ZMYM-1 vs. Ensembl Xenopus
Match: ZMYM3 (zinc finger MYM-type containing 3 [Source:NCBI gene;Acc:100495745])

HSP 1 Score: 137.887 bits (346), Expect = 4.478e-33
Identity = 96/312 (30.77%), Postives = 143/312 (45.83%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL-----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKITYLSNSDNVKY-----------ELCAETNAKRS-----------------------FYTIVRTYIEKC--NALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQE 1856
            L ++YG+NAW+ W +                         D+L  T  E+N  + +FV++I +P  + Y PDSI+YLCLGIQ +L ++   +N+F D   + F  ELNKIL  +   L  N +   R++E+HLW+  QLG + P VLL ++ Y  T+   + T EEH +LS S +     K +  +N   +K            +   E++AKR                        FY     Y+ KC  N   S +    L YL+P  S  A+        LWY   P+D S+L  ML RI  V++V E
Sbjct:  804 LSFTYGVNAWKAWVQRKYDGVEPSKGEELRFGPKPMRIKEDILACTAAELNYGLAQFVKEITRPNGDRYEPDSIYYLCLGIQQYLLENNRMVNIFTDLYYLTFVQELNKILTAWHRSLAPNRLSFSRVQEEHLWDCKQLGVYSPFVLLNTLMYFNTKFFGLRTAEEHMQLSFSNVVRHSRKCS--TNRGTIKLVSVRYYPPVRQKKGRESSAKRKREDDQPVLEQPENKMNPLRCPVKFYEF---YLSKCPENLRNSGE----LFYLQPERSCVAE------SPLWYSVVPMDKSMLHSMLTRILAVRDVYE 1100          
BLAST of ZMYM-1 vs. Ensembl Mouse
Match: Zmym3 (zinc finger, MYM-type 3 [Source:MGI Symbol;Acc:MGI:1927231])

HSP 1 Score: 149.058 bits (375), Expect = 1.080e-36
Identity = 97/307 (31.60%), Postives = 143/307 (46.58%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL-----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKIT------------YLSNSDNVKYELCAETNAKRSFYTIVRT-----------------YIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESL 1862
            L YSYG+NAW+ W ++                        D+L  +  E+N  + +FV++I +P  E Y PDSI+YLCLGIQ +L ++   +N+F D   + F  ELNK L+T+QP L  N+ +  R+EE+HLWE  QLG + P VLL ++ +  T+   + T EEH +LS + +     K T            Y +     K         KR   TI+                   Y+ KC    S      + YL+P      ++       LWY   P+D S+L+ MLNRI  V+E+ E L
Sbjct: 1061 LNYSYGVNAWKCWVQSKYANGETSKGDELRFGPKPMRIKEDILACSAAELNYGLAQFVREITRPNGERYEPDSIYYLCLGIQQYLLENNRMVNIFTDLYYLTFVQELNKSLSTWQPTLLPNNTVFSRVEEEHLWECKQLGVYSPFVLLNTLMFFNTKFFGLQTAEEHMQLSFTNVVRQSRKCTTPRGTTKVVSIRYYAPVRQRKGRDTGPGKRKREDETILEQRENRMNPLRCPVKFYEFYLSKCPE--SLRTRNDVFYLQP------ERSCIAESPLWYSVIPMDRSMLESMLNRILAVREIYEEL 1359          
BLAST of ZMYM-1 vs. Ensembl Mouse
Match: Zmym3 (zinc finger, MYM-type 3 [Source:MGI Symbol;Acc:MGI:1927231])

HSP 1 Score: 148.673 bits (374), Expect = 1.120e-36
Identity = 97/307 (31.60%), Postives = 143/307 (46.58%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL-----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKIT------------YLSNSDNVKYELCAETNAKRSFYTIVRT-----------------YIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESL 1862
            L YSYG+NAW+ W ++                        D+L  +  E+N  + +FV++I +P  E Y PDSI+YLCLGIQ +L ++   +N+F D   + F  ELNK L+T+QP L  N+ +  R+EE+HLWE  QLG + P VLL ++ +  T+   + T EEH +LS + +     K T            Y +     K         KR   TI+                   Y+ KC    S      + YL+P      ++       LWY   P+D S+L+ MLNRI  V+E+ E L
Sbjct: 1063 LNYSYGVNAWKCWVQSKYANGETSKGDELRFGPKPMRIKEDILACSAAELNYGLAQFVREITRPNGERYEPDSIYYLCLGIQQYLLENNRMVNIFTDLYYLTFVQELNKSLSTWQPTLLPNNTVFSRVEEEHLWECKQLGVYSPFVLLNTLMFFNTKFFGLQTAEEHMQLSFTNVVRQSRKCTTPRGTTKVVSIRYYAPVRQRKGRDTGPGKRKREDETILEQRENRMNPLRCPVKFYEFYLSKCPE--SLRTRNDVFYLQP------ERSCIAESPLWYSVIPMDRSMLESMLNRILAVREIYEEL 1361          
BLAST of ZMYM-1 vs. Ensembl Mouse
Match: Zmym3 (zinc finger, MYM-type 3 [Source:MGI Symbol;Acc:MGI:1927231])

HSP 1 Score: 148.673 bits (374), Expect = 1.186e-36
Identity = 97/307 (31.60%), Postives = 143/307 (46.58%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL-----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKIT------------YLSNSDNVKYELCAETNAKRSFYTIVRT-----------------YIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESL 1862
            L YSYG+NAW+ W ++                        D+L  +  E+N  + +FV++I +P  E Y PDSI+YLCLGIQ +L ++   +N+F D   + F  ELNK L+T+QP L  N+ +  R+EE+HLWE  QLG + P VLL ++ +  T+   + T EEH +LS + +     K T            Y +     K         KR   TI+                   Y+ KC    S      + YL+P      ++       LWY   P+D S+L+ MLNRI  V+E+ E L
Sbjct: 1049 LNYSYGVNAWKCWVQSKYANGETSKGDELRFGPKPMRIKEDILACSAAELNYGLAQFVREITRPNGERYEPDSIYYLCLGIQQYLLENNRMVNIFTDLYYLTFVQELNKSLSTWQPTLLPNNTVFSRVEEEHLWECKQLGVYSPFVLLNTLMFFNTKFFGLQTAEEHMQLSFTNVVRQSRKCTTPRGTTKVVSIRYYAPVRQRKGRDTGPGKRKREDETILEQRENRMNPLRCPVKFYEFYLSKCPE--SLRTRNDVFYLQP------ERSCIAESPLWYSVIPMDRSMLESMLNRILAVREIYEEL 1347          
BLAST of ZMYM-1 vs. Ensembl Mouse
Match: Zmym2 (zinc finger, MYM-type 2 [Source:MGI Symbol;Acc:MGI:1923257])

HSP 1 Score: 148.288 bits (373), Expect = 1.959e-36
Identity = 93/304 (30.59%), Postives = 143/304 (47.04%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQL--EVSESKITYLSNSDNVKYE---LCA--------------------------ETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
             KY+YG+NAW+HW K                        DLL  T  E+N  +  FV +IR+P  E Y PDSI+YLCLGIQ +L     + N+F+DP    F+ ELNKIL ++QP +  +  +  R+EED+LW   QLG H P  LL ++ Y  T+   + TVE+H +LS   +     ++ +T + N   ++Y+   LC                             N  R    +   Y+ K  +  + ++   + YL+P  S   D        +WY S  +D + L+ ML R+ +VK++
Sbjct: 1069 FKYTYGVNAWKHWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGENYAPDSIYYLCLGIQEYLCGSNRKDNIFIDPGYQMFEQELNKILRSWQPSILPDGSIFSRVEEDYLWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLT-MENKACLRYQVSSLCGTDNEDKIATGKRKHEDDEPVFEQVENTANPSRCPVKMFECYLSK--SPQNLNQRMDVFYLQPECSSSTDS------PVWYTSTSLDRNTLENMLVRVLLVKDI 1363          
BLAST of ZMYM-1 vs. Ensembl Mouse
Match: Zmym4 (zinc finger, MYM-type 4 [Source:MGI Symbol;Acc:MGI:1915035])

HSP 1 Score: 134.42 bits (337), Expect = 5.112e-32
Identity = 103/371 (27.76%), Postives = 158/371 (42.59%), Query Frame = 3
Query: 1005 KRRHSDTESMPNKIRKTEATAIEKKEIDPCKLKYSYGINAWR---HWSKNL--------------------------------------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVS------ESKITYL----------------------SNSDN---VKYELCAET-NAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESL 1862
            +RR      +P + R     A++   +    LKY YG+NAW+    W KN                                                   D+L  T +E++  + +F+Q++R+P  E Y PDSI YLCLGIQ +L ++    N+F +P    F  EL K+L  ++P +  N  +  RIEE+HLWE  QLG + P VLL ++ +  T+  ++  V EH KLS + +          +K+TYL                       N D+   V  E+   T N  R    +   Y+ KC+   S  +   + YL+P      ++       +WY + P+D   LD ML RI +V+EV E L
Sbjct:  835 RRRGRKKSVVPVEPRSLIQGALQGCSVSGMTLKYMYGVNAWKNWVQW-KNAKDEQGDLKCGGGELASASPCSDSLGSAQDHALSQESSEQGCKARSVKLKEDILSCTFSELSLGLCQFIQEVRRPNGEKYDPDSILYLCLGIQQYLFENGRIDNIFTEP-YSRFMIELTKLLKIWEPTILPNGYMFSRIEEEHLWECKQLGAYSPIVLLNTLLFFNTKYFQLRNVTEHLKLSFAHVMRRTRTLKYSTKMTYLRFFPPLQKPESEPDKVTIGKRKRNEDDEAPVGVEMAENTDNPLRCPVRLYEFYLSKCSE--SVKQRSDVFYLQP------ERSCVPNSPMWYSTFPIDPGTLDTMLTRILMVREVHEEL 1195          
BLAST of ZMYM-1 vs. UniProt/SwissProt
Match: sp|Q9JLM4|ZMYM3_MOUSE (Zinc finger MYM-type protein 3 OS=Mus musculus OX=10090 GN=Zmym3 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 7.835e-36
Identity = 97/307 (31.60%), Postives = 143/307 (46.58%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL-----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKIT------------YLSNSDNVKYELCAETNAKRSFYTIVRT-----------------YIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESL 1862
            L YSYG+NAW+ W ++                        D+L  +  E+N  + +FV++I +P  E Y PDSI+YLCLGIQ +L ++   +N+F D   + F  ELNK L+T+QP L  N+ +  R+EE+HLWE  QLG + P VLL ++ +  T+   + T EEH +LS + +     K T            Y +     K         KR   TI+                   Y+ KC    S      + YL+P      ++       LWY   P+D S+L+ MLNRI  V+E+ E L
Sbjct: 1063 LNYSYGVNAWKCWVQSKYANGETSKGDELRFGPKPMRIKEDILACSAAELNYGLAQFVREITRPNGERYEPDSIYYLCLGIQQYLLENNRMVNIFTDLYYLTFVQELNKSLSTWQPTLLPNNTVFSRVEEEHLWECKQLGVYSPFVLLNTLMFFNTKFFGLQTAEEHMQLSFTNVVRQSRKCTTPRGTTKVVSIRYYAPVRQRKGRDTGPGKRKREDETILEQRENRMNPLRCPVKFYEFYLSKCPE--SLRTRNDVFYLQP------ERSCIAESPLWYSVIPMDRSMLESMLNRILAVREIYEEL 1361          
BLAST of ZMYM-1 vs. UniProt/SwissProt
Match: sp|Q5RDJ2|ZMYM2_PONAB (Zinc finger MYM-type protein 2 OS=Pongo abelii OX=9601 GN=ZMYM2 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.057e-35
Identity = 92/303 (30.36%), Postives = 141/303 (46.53%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQL--------------EVSESKITYLSNSDN----------------VKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
             KY+YG+NAW+HW K                        DLL  T  E+N  +  FV +IR+P  E Y PDSI+YLCLGIQ +L     + N+F+DP    F+ ELNKIL ++QP +  +  +  R+EED+LW   QLG H P  LL ++ Y  T+   + TVE+H +LS   +                   +++ L  +DN                V  ++    N  R    +   Y+ K  +  + ++   + YL+P  S   D        +WY S  +D + L+ ML R+ +VK++
Sbjct: 1070 FKYTYGVNAWKHWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGENYAPDSIYYLCLGIQEYLCGSNRKDNIFIDPGYQTFEQELNKILRSWQPSILPDGSIFSRVEEDYLWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSK--SPQNLNQRMDVFYLQPECSSSTDS------PVWYTSTSLDRNTLENMLVRVLLVKDI 1364          
BLAST of ZMYM-1 vs. UniProt/SwissProt
Match: sp|Q9UBW7|ZMYM2_HUMAN (Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.136e-35
Identity = 92/303 (30.36%), Postives = 141/303 (46.53%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQL--------------EVSESKITYLSNSDN----------------VKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
             KY+YG+NAW+HW K                        DLL  T  E+N  +  FV +IR+P  E Y PDSI+YLCLGIQ +L     + N+F+DP    F+ ELNKIL ++QP +  +  +  R+EED+LW   QLG H P  LL ++ Y  T+   + TVE+H +LS   +                   +++ L  +DN                V  ++    N  R    +   Y+ K  +  + ++   + YL+P  S   D        +WY S  +D + L+ ML R+ +VK++
Sbjct: 1070 FKYTYGVNAWKHWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGENYAPDSIYYLCLGIQEYLCGSNRKDNIFIDPGYQTFEQELNKILRSWQPSILPDGSIFSRVEEDYLWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSK--SPQNLNQRMDVFYLQPECSSSTDS------PVWYTSTSLDRNTLENMLVRVLLVKDI 1364          
BLAST of ZMYM-1 vs. UniProt/SwissProt
Match: sp|Q9CU65|ZMYM2_MOUSE (Zinc finger MYM-type protein 2 OS=Mus musculus OX=10090 GN=Zmym2 PE=1 SV=3)

HSP 1 Score: 148.288 bits (373), Expect = 1.370e-35
Identity = 93/304 (30.59%), Postives = 143/304 (47.04%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQL--EVSESKITYLSNSDNVKYE---LCA--------------------------ETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
             KY+YG+NAW+HW K                        DLL  T  E+N  +  FV +IR+P  E Y PDSI+YLCLGIQ +L     + N+F+DP    F+ ELNKIL ++QP +  +  +  R+EED+LW   QLG H P  LL ++ Y  T+   + TVE+H +LS   +     ++ +T + N   ++Y+   LC                             N  R    +   Y+ K  +  + ++   + YL+P  S   D        +WY S  +D + L+ ML R+ +VK++
Sbjct: 1069 FKYTYGVNAWKHWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGENYAPDSIYYLCLGIQEYLCGSNRKDNIFIDPGYQMFEQELNKILRSWQPSILPDGSIFSRVEEDYLWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLT-MENKACLRYQVSSLCGTDNEDKIATGKRKHEDDEPVFEQVENTANPSRCPVKMFECYLSK--SPQNLNQRMDVFYLQPECSSSTDS------PVWYTSTSLDRNTLENMLVRVLLVKDI 1363          
BLAST of ZMYM-1 vs. UniProt/SwissProt
Match: sp|Q14202|ZMYM3_HUMAN (Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 3.120e-35
Identity = 97/311 (31.19%), Postives = 142/311 (45.66%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL-----------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKIT------------YLSNSDNVKYELCAETNAKR---------------------SFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESL 1862
            L YSYG+NAW+ W ++                        D+L  +  E+N  + +FV++I +P  E Y PDSI+YLCLGIQ +L ++   +N+F D   + F  ELNK L+T+QP L  N+ +  R+EE+HLWE  QLG + P VLL ++ +  T+   + T EEH +LS + +     K T            Y +     K         KR                      FY     Y+ KC    S      + YL+P      ++       LWY   P+D S+L+ MLNRI  V+E+ E L
Sbjct: 1062 LNYSYGVNAWKCWVQSKYANGETSKGDELRFGPKPMRIKEDILACSAAELNYGLAQFVREITRPNGERYEPDSIYYLCLGIQQYLLENNRMVNIFTDLYYLTFVQELNKSLSTWQPTLLPNNTVFSRVEEEHLWECKQLGVYSPFVLLNTLMFFNTKFFGLQTAEEHMQLSFTNVVRQSRKCTTPRGTTKVVSIRYYAPVRQRKGRDTGPGKRKREDEAPILEQRENRMNPLRCPVKFYEF---YLSKCPE--SLRTRNDVFYLQP------ERSCIAESPLWYSVIPMDRSMLESMLNRILAVREIYEEL 1361          
BLAST of ZMYM-1 vs. TrEMBL
Match: H9CXU3 (ZMYM-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1173.69 bits (3035), Expect = 0.000e+0
Identity = 613/619 (99.03%), Postives = 615/619 (99.35%), Query Frame = 3
Query:   21 MNDSNQYMVQVADYDQNTYIIQDANGVQYDGSAIISSDIAEGNNLISEPRWIQQNSARGGKIMTNQGFVNGGDLVSVNGTGLNLNTRFTPSSIVFNSANAGQFDQDSLRIASAVXXXXXXXXXXXXXXXXXNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIESSAKCIHXXXXXXXXXXXXXXXXTFVREKPKPKELEITQEIKYDESELIVERETTSDDKNIVSVEASSIENLIEKSAEESNTNAVDVLMLTEESPIKDVTPSQSFVPSSQEKHITISNDEESSAPPKELPVESKKRRHSDTESMPNKIRKTEATAIEKKEIDPCKLKYSYGINAWRHWSKNLDLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKITYLSNSDNVKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESLLSSNC 1877
            MNDSNQYMVQVADYDQNTYIIQDANGVQYDGSAIISSDIAEGNNLISEPRWIQQNSARGGKIMT Q FVNGGDLVSVNGTGLNL+TRFTPSSIV NSANAGQFDQDSLRIASAVTGTGGRGRPRGRKPSRGNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIESSAKCIHVPVFIPIPVPVYIPIPTFVREKPKPKELEIT+EIKYDESELIVERETTSDDKNIVSVEASSIENLIEKSAEESNTNAVDVLMLTEESPIKDVTPSQSFVPSSQEKHITISNDEES APPKELPVESKKRRHSDTESMPNKIRKTEATAIEKKEIDPCKLKYSYGINAWRHWSKNLDLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKITYLSNSDNVKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESLLSSNC
Sbjct:    1 MNDSNQYMVQVADYDQNTYIIQDANGVQYDGSAIISSDIAEGNNLISEPRWIQQNSARGGKIMTXQXFVNGGDLVSVNGTGLNLSTRFTPSSIVLNSANAGQFDQDSLRIASAVTGTGGRGRPRGRKPSRGNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIESSAKCIHVPVFIPIPVPVYIPIPTFVREKPKPKELEITEEIKYDESELIVERETTSDDKNIVSVEASSIENLIEKSAEESNTNAVDVLMLTEESPIKDVTPSQSFVPSSQEKHITISNDEES-APPKELPVESKKRRHSDTESMPNKIRKTEATAIEKKEIDPCKLKYSYGINAWRHWSKNLDLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKITYLSNSDNVKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESLLSSNC 618          
BLAST of ZMYM-1 vs. TrEMBL
Match: A0A5K3FGM8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.596e-54
Identity = 106/273 (38.83%), Postives = 159/273 (58.24%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKN-------LDLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKITYLS-------NSDNVKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESLLSSN 1874
            LK+SYGINAWRHW+ +        +LL  +  E+N  +  FV ++RKP NE YV DSIFYLCLGIQ +L ++   +NLF +PR   F   L+ +LA FQP++    +L+CRIEE+HLWE+ QLG   P ++LFS+ Y +T+++ + T ++HA+L     +V   + +  S        SD+ +  + AE    R    + RTY++KC     A+     LYLRP+    A        S W+   P+ +  L +MLNRI++VKE+QE+ + S 
Sbjct:  510 LKFSYGINAWRHWASHTSQPKVVAELLDASDDELNAALTRFVHEVRKPNNETYVADSIFYLCLGIQEYLNENGRIINLFGEPRFASFARALDTVLADFQPRISPEGLLICRIEEEHLWEARQLGADSPNIMLFSLLYFITKHLWLRTGDQHAQLRFVNFKVKREQPSIESIFFVPTEGSDSYRMFVSAE-QLSRCPVRLYRTYLKKCPQAVIANGGS--LYLRPLVEPSA--------STWFSDTPMTAGDLQIMLNRIKMVKEIQEAFMDSQ 771          

HSP 2 Score: 78.5666 bits (192), Expect = 3.075e-11
Identity = 81/238 (34.03%), Postives = 114/238 (47.90%), Query Frame = 3
Query:   27 DSNQYMVQVADYDQNTYIIQD-----------ANGVQYDGSAIISSDIAE------GNNLISEPRWIQQNSARGGKIMTNQGFVNGGDLVSVNGTGL---------------NLNTRFTPSS---------------IVFNSANA--------------GQFDQDS-LRIASAVXXXXXXXXXXXXXXXXXNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQC 554
            DS Q +V+V      T ++QD             G+   G +++  ++A+      G   + +PR + Q + RGG+    +   +   +  + GT L               +L TR+TPSS               I+ NS  +                 D+D+  R+A+A+TG   RGRPRGR+P RG FPVVPIDMVRQLGIEQQVILQP  PVA +NKAI    + +S KTQ 
Sbjct:   14 DSCQ-LVEVPIDASGTIVVQDPGTLIAGGQVQVGGIVQSGKSLLKPELAQHLIQPVGIRSVIDPR-VSQTAQRGGRFPARKPLGSAQGMQVIQGTQLIQQPTVLTPTASGLLSLGTRYTPSSGITLGAATGAGAASGILANSQGSIFTSGGSTMVTTTGTGVDRDAGYRLAAAMTGASSRGRPRGRRPLRGQFPVVPIDMVRQLGIEQQVILQPAAPVAMRNKAILCRPLSVSCKTQA 249          
BLAST of ZMYM-1 vs. TrEMBL
Match: A0A5K3FFB1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.727e-54
Identity = 106/273 (38.83%), Postives = 159/273 (58.24%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKN-------LDLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKITYLS-------NSDNVKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESLLSSN 1874
            LK+SYGINAWRHW+ +        +LL  +  E+N  +  FV ++RKP NE YV DSIFYLCLGIQ +L ++   +NLF +PR   F   L+ +LA FQP++    +L+CRIEE+HLWE+ QLG   P ++LFS+ Y +T+++ + T ++HA+L     +V   + +  S        SD+ +  + AE    R    + RTY++KC     A+     LYLRP+    A        S W+   P+ +  L +MLNRI++VKE+QE+ + S 
Sbjct:  510 LKFSYGINAWRHWASHTSQPKVVAELLDASDDELNAALTRFVHEVRKPNNETYVADSIFYLCLGIQEYLNENGRIINLFGEPRFASFARALDTVLADFQPRISPEGLLICRIEEEHLWEARQLGADSPNIMLFSLLYFITKHLWLRTGDQHAQLRFVNFKVKREQPSIESIFFVPTEGSDSYRMFVSAE-QLSRCPVRLYRTYLKKCPQAVIANGGS--LYLRPLVEPSA--------STWFSDTPMTAGDLQIMLNRIKMVKEIQEAFMDSQ 771          

HSP 2 Score: 78.5666 bits (192), Expect = 2.796e-11
Identity = 81/238 (34.03%), Postives = 114/238 (47.90%), Query Frame = 3
Query:   27 DSNQYMVQVADYDQNTYIIQD-----------ANGVQYDGSAIISSDIAE------GNNLISEPRWIQQNSARGGKIMTNQGFVNGGDLVSVNGTGL---------------NLNTRFTPSS---------------IVFNSANA--------------GQFDQDS-LRIASAVXXXXXXXXXXXXXXXXXNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQC 554
            DS Q +V+V      T ++QD             G+   G +++  ++A+      G   + +PR + Q + RGG+    +   +   +  + GT L               +L TR+TPSS               I+ NS  +                 D+D+  R+A+A+TG   RGRPRGR+P RG FPVVPIDMVRQLGIEQQVILQP  PVA +NKAI    + +S KTQ 
Sbjct:   14 DSCQ-LVEVPIDASGTIVVQDPGTLIAGGQVQVGGIVQSGKSLLKPELAQHLIQPVGIRSVIDPR-VSQTAQRGGRFPARKPLGSAQGMQVIQGTQLIQQPTVLTPTASGLLSLGTRYTPSSGITLGAATGAGAASGILANSQGSIFTSGGSTMVTTTGTGVDRDAGYRLAAAMTGASSRGRPRGRRPLRGQFPVVPIDMVRQLGIEQQVILQPAAPVAMRNKAILCRPLSVSCKTQA 249          
BLAST of ZMYM-1 vs. TrEMBL
Match: A0A0R3U5P8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2059 PE=4 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 3.031e-54
Identity = 106/273 (38.83%), Postives = 159/273 (58.24%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKN-------LDLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKITYLS-------NSDNVKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESLLSSN 1874
            LK+SYGINAWRHW+ +        +LL  +  E+N  +  FV ++RKP NE YV DSIFYLCLGIQ +L ++   +NLF +PR   F   L+ +LA FQP++    +L+CRIEE+HLWE+ QLG   P ++LFS+ Y +T+++ + T ++HA+L     +V   + +  S        SD+ +  + AE    R    + RTY++KC     A+     LYLRP+    A        S W+   P+ +  L +MLNRI++VKE+QE+ + S 
Sbjct:  523 LKFSYGINAWRHWASHTSQPKVVAELLDASDDELNAALTRFVHEVRKPNNETYVADSIFYLCLGIQEYLNENGRIINLFGEPRFASFARALDTVLADFQPRISPEGLLICRIEEEHLWEARQLGADSPNIMLFSLLYFITKHLWLRTGDQHAQLRFVNFKVKREQPSIESIFFVPTEGSDSYRMFVSAE-QLSRCPVRLYRTYLKKCPQAVIANGGS--LYLRPLVEPSA--------STWFSDTPMTAGDLQIMLNRIKMVKEIQEAFMDSQ 784          

HSP 2 Score: 75.0998 bits (183), Expect = 3.172e-10
Identity = 65/155 (41.94%), Postives = 87/155 (56.13%), Query Frame = 3
Query:  183 NSARGGKIMTNQGFVNGGDLVSVNGTGL-NLNTRFTPSS---------------IVFNSANA--------------GQFDQDS-LRIASAVXXXXXXXXXXXXXXXXXNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQC 554
             SA+G +++     +    +++   +GL +L TR+TPSS               I+ NS  +                 D+D+  R+A+A+TG   RGRPRGR+P RG FPVVPIDMVRQLGIEQQVILQP  PVA +NKAI    + +S KTQ 
Sbjct:  108 GSAQGMQVIQGTQLIQQPTVLTPTASGLLSLGTRYTPSSGITLGAATGAGAASGILANSQGSIFTSGGSTMVTTTGTGVDRDAGYRLAAAMTGASSRGRPRGRRPLRGQFPVVPIDMVRQLGIEQQVILQPAAPVAMRNKAILCRPLSVSCKTQA 262          
BLAST of ZMYM-1 vs. TrEMBL
Match: A0A158QFL2 (DUF3504 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9026 PE=4 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 4.054e-52
Identity = 107/272 (39.34%), Postives = 164/272 (60.29%), Query Frame = 3
Query: 1098 LKYSYGINAWRHW------SKNL-DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEV----SESK-ITYLSNSDNVKYELCAETN-AKRSFYTIVRTYIEKC-NALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESLLSS 1871
            LK+SYGINAWRHW       K L D++++   E+N  +  FV+++RKP NE YV DSIFYLCLGIQ FL +H   +N+F + +   F   L+ ILA F+P++    +L+CRIEE+H+WE+ QLG H+P VLLF++ Y +T++M + T ++HA+L  S  ++    +ES+ + ++    +  Y + A    + R    + R Y++KC  AL S        YL P  S+          S WY  N + ++ L +MLNRI++VKE+QE+ + S
Sbjct:  480 LKFSYGINAWRHWITQNAQPKALADVVEIPDEELNTALSRFVREVRKPNNETYVADSIFYLCLGIQEFLNEHGRTVNIFAE-KFGTFTMALDTILADFRPRISPEGMLICRIEEEHMWEAKQLGDHNPHVLLFTLLYFITKHMWLRTGDQHAQLCFSNFKLKRENAESECVLFVPGGGSESYRMFATAEPSTRCPVQLFRAYLKKCPQALTSGSGP---FYLVPQHSE-------SSTSTWYSENAMPAAQLQIMLNRIKMVKEIQEAFMDS 740          

HSP 2 Score: 80.8777 bits (198), Expect = 4.613e-12
Identity = 74/205 (36.10%), Postives = 108/205 (52.68%), Query Frame = 3
Query:   42 MVQVADYDQNTYIIQDANGVQYDGS--AIISSDIAEGNNLISE-PRWIQQNSARGGKIMTNQGFVNGGDLVSVNGTGL-NLNTRFTPSSIV-----------------FNSA-----NAGQ-FDQDSLRIASAVXXXXXXXXXXXXXXXXXNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQ----CNDI 563
            +V+V        ++QD +G+   G   +++   +++G    S  P       A+G +++ +   +    +++   +GL +L TR+TPSS +                 F+S      NAG   D+D     + V G   RGRPRGR+P RG FPVVPIDMVRQLGIEQQVILQP  PVA KNKA+    + +S+KTQ    C D+
Sbjct:   11 LVEVPIDANGAIVVQDPSGLIASGQVQSVLDPRVSQGGQRGSRTPARKPLVPAQGLQMIQSAQLIPQSAVIAPTASGLLSLGTRYTPSSGIPLTTGQGGGMITSQGNIFSSGSAIVTNAGSGIDRDGGYRFATVGGASNRGRPRGRRPLRGQFPVVPIDMVRQLGIEQQVILQPAAPVAMKNKAVLCRPLSVSRKTQAGINCRDV 215          
BLAST of ZMYM-1 vs. Ensembl Cavefish
Match: zmym2 (zinc finger MYM-type containing 2 [Source:NCBI gene;Acc:103047518])

HSP 1 Score: 133.65 bits (335), Expect = 6.661e-32
Identity = 94/306 (30.72%), Postives = 141/306 (46.08%), Query Frame = 3
Query: 1098 LKYSYGINAWRHW----------SKNLDLLK-------------LTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVS---------------------------QLEVSESKITYLSNSD-NVKYELCAETN----AKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
            L   YG+NAWR W          S+  DLLK             L+  E+N+ +  FV+++R+P  E Y PDS+ Y+CLGIQ  LQD     +LF +P    F  ELNKIL  +QP +  +  L  R+EE  LW S QLG H P VLL S+ Y+ T+   + TVE+H +LS                             Q E + SK      S+ N + + C+  +     K+    +   Y+ KC    S  +     Y++P  S       T    LW+ S P++  +L+ +L ++ +VK++
Sbjct: 1073 LTSRYGLNAWRSWTVSSSTQPTDSEEKDLLKQVTPARLKGSLLSLSSAELNQALARFVKEVRRPNGERYAPDSVLYICLGIQKHLQDKGRTDDLFNEPAYQMFGEELNKILKDWQPSVLPDGSLWGRVEELCLWSSKQLGEHSPSVLLRSLVYLNTKYFGLRTVEQHLRLSFGNVYGPSTSKPHNHETTVCIRIPSISQDQHEPTASKRRRKDGSNSNFELDECSGGSDRCPVKKRECRLYELYLSKCPE--SVRERTDFFYVKPEVS-------TSDGPLWFSSTPLEKHVLESLLTQVLLVKDI 1369          
BLAST of ZMYM-1 vs. Ensembl Cavefish
Match: zmym2 (zinc finger MYM-type containing 2 [Source:NCBI gene;Acc:103047518])

HSP 1 Score: 133.65 bits (335), Expect = 7.452e-32
Identity = 94/306 (30.72%), Postives = 141/306 (46.08%), Query Frame = 3
Query: 1098 LKYSYGINAWRHW----------SKNLDLLK-------------LTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVS---------------------------QLEVSESKITYLSNSD-NVKYELCAETN----AKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
            L   YG+NAWR W          S+  DLLK             L+  E+N+ +  FV+++R+P  E Y PDS+ Y+CLGIQ  LQD     +LF +P    F  ELNKIL  +QP +  +  L  R+EE  LW S QLG H P VLL S+ Y+ T+   + TVE+H +LS                             Q E + SK      S+ N + + C+  +     K+    +   Y+ KC    S  +     Y++P  S       T    LW+ S P++  +L+ +L ++ +VK++
Sbjct: 1065 LTSRYGLNAWRSWTVSSSTQPTDSEEKDLLKQVTPARLKGSLLSLSSAELNQALARFVKEVRRPNGERYAPDSVLYICLGIQKHLQDKGRTDDLFNEPAYQMFGEELNKILKDWQPSVLPDGSLWGRVEELCLWSSKQLGEHSPSVLLRSLVYLNTKYFGLRTVEQHLRLSFGNVYGPSTSKPHNHETTVCIRIPSISQDQHEPTASKRRRKDGSNSNFELDECSGGSDRCPVKKRECRLYELYLSKCPE--SVRERTDFFYVKPEVS-------TSDGPLWFSSTPLEKHVLESLLTQVLLVKDI 1361          
BLAST of ZMYM-1 vs. Ensembl Cavefish
Match: zmym2 (zinc finger MYM-type containing 2 [Source:NCBI gene;Acc:103047518])

HSP 1 Score: 133.65 bits (335), Expect = 7.452e-32
Identity = 94/306 (30.72%), Postives = 141/306 (46.08%), Query Frame = 3
Query: 1098 LKYSYGINAWRHW----------SKNLDLLK-------------LTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVS---------------------------QLEVSESKITYLSNSD-NVKYELCAETN----AKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
            L   YG+NAWR W          S+  DLLK             L+  E+N+ +  FV+++R+P  E Y PDS+ Y+CLGIQ  LQD     +LF +P    F  ELNKIL  +QP +  +  L  R+EE  LW S QLG H P VLL S+ Y+ T+   + TVE+H +LS                             Q E + SK      S+ N + + C+  +     K+    +   Y+ KC    S  +     Y++P  S       T    LW+ S P++  +L+ +L ++ +VK++
Sbjct: 1065 LTSRYGLNAWRSWTVSSSTQPTDSEEKDLLKQVTPARLKGSLLSLSSAELNQALARFVKEVRRPNGERYAPDSVLYICLGIQKHLQDKGRTDDLFNEPAYQMFGEELNKILKDWQPSVLPDGSLWGRVEELCLWSSKQLGEHSPSVLLRSLVYLNTKYFGLRTVEQHLRLSFGNVYGPSTSKPHNHETTVCIRIPSISQDQHEPTASKRRRKDGSNSNFELDECSGGSDRCPVKKRECRLYELYLSKCPE--SVRERTDFFYVKPEVS-------TSDGPLWFSSTPLEKHVLESLLTQVLLVKDI 1361          
BLAST of ZMYM-1 vs. Ensembl Cavefish
Match: zmym2 (zinc finger MYM-type containing 2 [Source:NCBI gene;Acc:103047518])

HSP 1 Score: 133.65 bits (335), Expect = 7.452e-32
Identity = 94/306 (30.72%), Postives = 141/306 (46.08%), Query Frame = 3
Query: 1098 LKYSYGINAWRHW----------SKNLDLLK-------------LTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVS---------------------------QLEVSESKITYLSNSD-NVKYELCAETN----AKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
            L   YG+NAWR W          S+  DLLK             L+  E+N+ +  FV+++R+P  E Y PDS+ Y+CLGIQ  LQD     +LF +P    F  ELNKIL  +QP +  +  L  R+EE  LW S QLG H P VLL S+ Y+ T+   + TVE+H +LS                             Q E + SK      S+ N + + C+  +     K+    +   Y+ KC    S  +     Y++P  S       T    LW+ S P++  +L+ +L ++ +VK++
Sbjct: 1065 LTSRYGLNAWRSWTVSSSTQPTDSEEKDLLKQVTPARLKGSLLSLSSAELNQALARFVKEVRRPNGERYAPDSVLYICLGIQKHLQDKGRTDDLFNEPAYQMFGEELNKILKDWQPSVLPDGSLWGRVEELCLWSSKQLGEHSPSVLLRSLVYLNTKYFGLRTVEQHLRLSFGNVYGPSTSKPHNHETTVCIRIPSISQDQHEPTASKRRRKDGSNSNFELDECSGGSDRCPVKKRECRLYELYLSKCPE--SVRERTDFFYVKPEVS-------TSDGPLWFSSTPLEKHVLESLLTQVLLVKDI 1361          
BLAST of ZMYM-1 vs. Ensembl Cavefish
Match: si:ch211-173p18.3 (zinc finger MYM-type protein 4 [Source:NCBI gene;Acc:103037930])

HSP 1 Score: 126.331 bits (316), Expect = 1.757e-29
Identity = 85/303 (28.05%), Postives = 139/303 (45.87%), Query Frame = 3
Query: 1095 KLKYSYGINAWRHW----------------SKNL----DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQL-----EVSESKITYL-----------SNSDNVKYE------------LCAETNAKRSFYTIVRT---YIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
            KL + YG+ AW+ W                S+N+    D+L+ +  E++  + +F+ + R+P  E Y PDSI YLCLGIQ  L ++    N+F D     F   +N +L  ++P +  +  +  R+EE++LW+  QLG   P VLL ++ Y  T+     TV +H +LS + +         SK   L           SN++ V  +            +  + NA       VR    Y+ KC++  S  +   + YLRP      ++       LW+ S+ +D   LD+ML RI  V+E+
Sbjct: 1328 KLHHEYGVQAWKSWIRWRNSQPNIEVPKMGSRNMMLKEDMLQCSTAELSYGLCKFISEARRPNGEMYRPDSIHYLCLGIQQHLFENGRMENIFADLFYSKFSQSINTLLKDWKPTIMPSGYVHSRVEEEYLWQCKQLGAFSPSVLLNTLLYFCTKFFNFKTVAQHRRLSFAHVMRCTRSHGNSKTACLRFYPPVPKEGTSNAEEVPAKRKREDEEDEGVVMEMQENAGNPLRCPVRLYEFYLSKCSS--SVKQRTNIFYLRP------ERSCIPNSPLWFSSSALDDEELDIMLTRILTVREL 1622          
BLAST of ZMYM-1 vs. Ensembl Medaka
Match: ENSORLT00000038920.1 (zinc finger MYM-type protein 4 [Source:NCBI gene;Acc:101157791])

HSP 1 Score: 133.65 bits (335), Expect = 5.860e-32
Identity = 87/305 (28.52%), Postives = 141/305 (46.23%), Query Frame = 3
Query: 1095 KLKYSYGINAWRHW----------------SKNL----DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQL------EVSESKITYL------------SNSDNVKYELCAET--------------NAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQ 1853
            KLK  YG++AW+ W                S+ L    DLL+ T  E++  +  FV ++++P  EPY PDS+FYLCLGIQ +L ++    N+F+D     F +E   +L  FQP +  +  +  R+EE+ LW+  QLG + P VLL ++ Y   +    +TVE+H +LS + +          +K T+L            ++S+ V  +   E               N  R    +   Y+ KC+ L    +   + YL P      ++       LW+ S P+D   ++ ML RI  V+E+ 
Sbjct:  710 KLKSQYGVDAWKRWIQWRQTQPDLKKPRFGSRQLELKEDLLRCTTAELSYGLCCFVTEVKRPNGEPYSPDSLFYLCLGIQKYLFENSRVENIFMDRFYSKFSAEFTNMLRGFQPAITPSGYVHSRVEEEFLWDCKQLGAYSPIVLLNTLLYFCCKYFGFTTVEQHRQLSFAHVMRCTKTNQDNTKTTFLRFYPPIAMNEADTDSNGVPAKRKKEEENKEEILEMMENTDNPLRCPVRLYEFYLSKCSEL--VKQRTNIFYLHP------ERCCVPNSPLWFSSTPLDDDTMEAMLTRILTVRELH 1006          
BLAST of ZMYM-1 vs. Ensembl Medaka
Match: zmym2 (zinc finger MYM-type containing 2 [Source:NCBI gene;Acc:101163938])

HSP 1 Score: 127.487 bits (319), Expect = 6.829e-30
Identity = 84/306 (27.45%), Postives = 138/306 (45.10%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL--------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSES------------KITYLSNSDNVKYE-----------------------LCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
            LK  YG+NAW+ W+ +                     +LL L+  E+N  + +FV+++ +P  E Y PDS+ YLCLGIQ  L     +L+LF DP    F  ELNK+L  +QP +  +  L  R+EE  LW S  LG   P  LL S+ Y+ T+   + TVE+H +LS + +   ++            ++  +S   +V+ E                        C     +   Y I R+   KC    S  +   + Y++P      D   +    LW+ S P++  +L+ +L R+ +V+++
Sbjct: 1078 LKARYGVNAWKRWALSFSDKSEDTKAAENTKPVRPKSNLLTLSPEELNAALSKFVKEVCRPNGERYSPDSMLYLCLGIQQHLYAKGRKLDLFSDPCFQQFGEELNKVLKDWQPSVLPDGSLWGRVEEQSLWSSQHLGEQSPATLLRSLVYLNTKYFGLRTVEQHLRLSFANVYGPDTVHPVTKESTVCIRVPSISQDHHVQTESRKRKRSLKDGEQEDEDTGSSSIRCPVKKHECRLYEIYRS---KCPP--SLWEHHGVFYMQP------DPACSPETQLWFSSAPLERRILESLLTRVLLVRDI 1372          
BLAST of ZMYM-1 vs. Ensembl Medaka
Match: zmym2 (zinc finger MYM-type containing 2 [Source:NCBI gene;Acc:101163938])

HSP 1 Score: 127.487 bits (319), Expect = 6.829e-30
Identity = 84/306 (27.45%), Postives = 138/306 (45.10%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL--------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSES------------KITYLSNSDNVKYE-----------------------LCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
            LK  YG+NAW+ W+ +                     +LL L+  E+N  + +FV+++ +P  E Y PDS+ YLCLGIQ  L     +L+LF DP    F  ELNK+L  +QP +  +  L  R+EE  LW S  LG   P  LL S+ Y+ T+   + TVE+H +LS + +   ++            ++  +S   +V+ E                        C     +   Y I R+   KC    S  +   + Y++P      D   +    LW+ S P++  +L+ +L R+ +V+++
Sbjct: 1078 LKARYGVNAWKRWALSFSDKSEDTKAAENTKPVRPKSNLLTLSPEELNAALSKFVKEVCRPNGERYSPDSMLYLCLGIQQHLYAKGRKLDLFSDPCFQQFGEELNKVLKDWQPSVLPDGSLWGRVEEQSLWSSQHLGEQSPATLLRSLVYLNTKYFGLRTVEQHLRLSFANVYGPDTVHPVTKESTVCIRVPSISQDHHVQTESRKRKRSLKDGEQEDEDTGSSSIRCPVKKHECRLYEIYRS---KCPP--SLWEHHGVFYMQP------DPACSPETQLWFSSAPLERRILESLLTRVLLVRDI 1372          
BLAST of ZMYM-1 vs. Ensembl Medaka
Match: zmym2 (zinc finger MYM-type containing 2 [Source:NCBI gene;Acc:101163938])

HSP 1 Score: 127.487 bits (319), Expect = 6.829e-30
Identity = 84/306 (27.45%), Postives = 138/306 (45.10%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL--------------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSES------------KITYLSNSDNVKYE-----------------------LCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEV 1850
            LK  YG+NAW+ W+ +                     +LL L+  E+N  + +FV+++ +P  E Y PDS+ YLCLGIQ  L     +L+LF DP    F  ELNK+L  +QP +  +  L  R+EE  LW S  LG   P  LL S+ Y+ T+   + TVE+H +LS + +   ++            ++  +S   +V+ E                        C     +   Y I R+   KC    S  +   + Y++P      D   +    LW+ S P++  +L+ +L R+ +V+++
Sbjct: 1078 LKARYGVNAWKRWALSFSDKSEDTKAAENTKPVRPKSNLLTLSPEELNAALSKFVKEVCRPNGERYSPDSMLYLCLGIQQHLYAKGRKLDLFSDPCFQQFGEELNKVLKDWQPSVLPDGSLWGRVEEQSLWSSQHLGEQSPATLLRSLVYLNTKYFGLRTVEQHLRLSFANVYGPDTVHPVTKESTVCIRVPSISQDHHVQTESRKRKRSLKDGEQEDEDTGSSSIRCPVKKHECRLYEIYRS---KCPP--SLWEHHGVFYMQP------DPACSPETQLWFSSAPLERRILESLLTRVLLVRDI 1372          
BLAST of ZMYM-1 vs. Ensembl Medaka
Match: ENSORLT00000022211.2 (pep primary_assembly:ASM223467v1:22:19920706:19948966:-1 gene:ENSORLG00000017743.2 transcript:ENSORLT00000022211.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 5.531e-29
Identity = 88/292 (30.14%), Postives = 141/292 (48.29%), Query Frame = 3
Query: 1098 LKYSYGINAWRHWSKNL--------------DLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLV-CRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSE------SKITYLSNSDNVKYELCAETNAKR-------------SFYTIVRT---YIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESL 1862
            + + YG+ AW++W                  D+L+   TE++  +  F++++R+P  + Y PDSIFYLCLGIQ ++       N+F D     F SE++ +L  ++PKL  N  +V  R+EE  LWE  QLG + P VLL ++ +  T+   ++TVE+H  LS S             K+ YL +  NV+ +   +  AK+               +  VR    Y+ +C    S      + YL+P      +K+       WY   P+D+++L  ML RI  V+EVQ+ L
Sbjct:  859 INHLYGLKAWKNWVHQCRQQPQESCSLDFKEDILQYDSTELSFALSRFIKELRRPNGDTYSPDSIFYLCLGIQQYIFLKGRIENIFTDELYGQFASEISAMLQLWKPKLLPNGGVVPSRVEESFLWECKQLGAYSPIVLLNTLLFFCTKKFHLTTVEQHRHLSFSNFTRRSKPCNRAGKVCYL-HYRNVQEKKRKDIPAKQEEEDLEMLENVTYPLHCPVRLYEFYLSRCPE--SVRDRTDVFYLQP------EKNVCH----WYSPQPLDAAILQTMLTRILAVREVQQEL 1137          
BLAST of ZMYM-1 vs. Planmine SMEST
Match: SMESG000032173.1 (SMESG000032173.1)

HSP 1 Score: 1183.7 bits (3061), Expect = 0.000e+0
Identity = 615/619 (99.35%), Postives = 618/619 (99.84%), Query Frame = 3
Query:   21 MNDSNQYMVQVADYDQNTYIIQDANGVQYDGSAIISSDIAEGNNLISEPRWIQQNSARGGKIMTNQGFVNGGDLVSVNGTGLNLNTRFTPSSIVFNSANAGQFDQDSLRIASAVXXXXXXXXXXXXXXXXXNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIESSAKCIHXXXXXXXXXXXXXXXXTFVREKPKPKELEITQEIKYDESELIVERETTSDDKNIVSVEASSIENLIEKSAEESNTNAVDVLMLTEESPIKDVTPSQSFVPSSQEKHITISNDEESSAPPKELPVESKKRRHSDTESMPNKIRKTEATAIEKKEIDPCKLKYSYGINAWRHWSKNLDLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKITYLSNSDNVKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMMLNRIRIVKEVQESLLSSNC 1877
            MND+NQYMVQVADYDQNTYIIQDANGVQYDGSAIISSDIAEGNNLISEPRWIQQNSARGGKIMT+Q FVNGGDLVSVNGTGLNLNTRFTPSSIVFNSANAGQFDQDSLRIASAVTGTGGRGRPRGRKPSRGNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIESSAKCIHVPVFIPIPVPVYIPIPTFVREKPKPKELEITQEIKYDESELIVERETTSDDKNIVSVEASSIENLIEKSAEESNTNAVDVLMLTEESPIKDVTPSQSFVPSSQEKHITISNDEESSAPPKELPVESKKRRHSDTESMPNKIRKTEATAIEKKEIDPCKLKYSYGINAWRHWSKNLDLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKITYLSNSDNVKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYE+NPVDSSLLDMMLNRIRIVKEVQESLLSSNC
Sbjct:    1 MNDNNQYMVQVADYDQNTYIIQDANGVQYDGSAIISSDIAEGNNLISEPRWIQQNSARGGKIMTSQSFVNGGDLVSVNGTGLNLNTRFTPSSIVFNSANAGQFDQDSLRIASAVTGTGGRGRPRGRKPSRGNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIESSAKCIHVPVFIPIPVPVYIPIPTFVREKPKPKELEITQEIKYDESELIVERETTSDDKNIVSVEASSIENLIEKSAEESNTNAVDVLMLTEESPIKDVTPSQSFVPSSQEKHITISNDEESSAPPKELPVESKKRRHSDTESMPNKIRKTEATAIEKKEIDPCKLKYSYGINAWRHWSKNLDLLKLTVTEINKYMIEFVQKIRKPTNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATFQPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTVEEHAKLSVSQLEVSESKITYLSNSDNVKYELCAETNAKRSFYTIVRTYIEKCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYENNPVDSSLLDMMLNRIRIVKEVQESLLSSNC 619          
BLAST of ZMYM-1 vs. Planmine SMEST
Match: SMESG000032185.1 (SMESG000032185.1)

HSP 1 Score: 353.214 bits (905), Expect = 1.135e-118
Identity = 192/199 (96.48%), Postives = 196/199 (98.49%), Query Frame = 3
Query:   21 MNDSNQYMVQVADYDQNTYIIQDANGVQYDGSAIISSDIAEGNNLISEPRWIQQNSARGGKIMTNQGFVNGGDLVSVNGTGLNLNTRFTPSSIVFNSANAGQFDQDSLRIASAVXXXXXXXXXXXXXXXXXNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIESSAKC 617
            MNDSNQYMVQVADYDQNTYIIQDANGVQYDGSAIISSDI+EGNNLISEPRWIQQNSARGGKIMTNQGFVNGGDLVSVNGTGLNL+TRFTPSSIV NSAN GQFDQDSLRIASAVTGTGGRGRPRGRKPSRGNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIES+A+ 
Sbjct:    1 MNDSNQYMVQVADYDQNTYIIQDANGVQYDGSAIISSDISEGNNLISEPRWIQQNSARGGKIMTNQGFVNGGDLVSVNGTGLNLSTRFTPSSIVLNSANPGQFDQDSLRIASAVTGTGGRGRPRGRKPSRGNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIESTARL 199          
BLAST of ZMYM-1 vs. Planmine SMEST
Match: SMESG000032185.1 (SMESG000032185.1)

HSP 1 Score: 313.538 bits (802), Expect = 1.799e-103
Identity = 178/199 (89.45%), Postives = 181/199 (90.95%), Query Frame = 3
Query:   21 MNDSNQYMVQVADYDQNTYIIQDANGVQYDGSAIISSDIAEGNNLISEPRWIQQNSARGGKIMTNQGFVNGGDLVSVNGTGLNLNTRFTPSSIVFNSANAGQFDQDSLRIASAVXXXXXXXXXXXXXXXXXNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIESSAKC 617
            MNDSNQYMVQVADYDQNTYIIQDANGVQYDGSAIISSDI+EGNNLISEPRWIQQNSARGGKIMTNQGFVNGGDLVSVN               V NSAN GQFDQDSLRIASAVTGTGGRGRPRGRKPSRGNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIES+A+ 
Sbjct:    1 MNDSNQYMVQVADYDQNTYIIQDANGVQYDGSAIISSDISEGNNLISEPRWIQQNSARGGKIMTNQGFVNGGDLVSVN---------------VLNSANPGQFDQDSLRIASAVTGTGGRGRPRGRKPSRGNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIESTARL 184          
BLAST of ZMYM-1 vs. Planmine SMEST
Match: SMESG000032185.1 (SMESG000032185.1)

HSP 1 Score: 298.13 bits (762), Expect = 9.715e-98
Identity = 171/192 (89.06%), Postives = 174/192 (90.62%), Query Frame = 3
Query:   42 MVQVADYDQNTYIIQDANGVQYDGSAIISSDIAEGNNLISEPRWIQQNSARGGKIMTNQGFVNGGDLVSVNGTGLNLNTRFTPSSIVFNSANAGQFDQDSLRIASAVXXXXXXXXXXXXXXXXXNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIESSAKC 617
            MVQVADYDQNTYIIQDANGVQYDGSAIISSDI+EGNNLISEPRWIQQNSARGGKIMTNQGFVNGGDLVSVN               V NSAN GQFDQDSLRIASAVTGTGGRGRPRGRKPSRGNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIES+A+ 
Sbjct:    1 MVQVADYDQNTYIIQDANGVQYDGSAIISSDISEGNNLISEPRWIQQNSARGGKIMTNQGFVNGGDLVSVN---------------VLNSANPGQFDQDSLRIASAVTGTGGRGRPRGRKPSRGNFPVVPIDMVRQLGIEQQVILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIESTARL 177          
The following BLAST results are available for this feature:
BLAST of ZMYM-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZMYM22.365e-3630.36zinc finger MYM-type containing 2 [Source:HGNC Sym... [more]
ZMYM22.365e-3630.36zinc finger MYM-type containing 2 [Source:HGNC Sym... [more]
ZMYM22.365e-3630.36zinc finger MYM-type containing 2 [Source:HGNC Sym... [more]
ZMYM36.273e-3631.19zinc finger MYM-type containing 3 [Source:HGNC Sym... [more]
ZMYM36.497e-3631.19zinc finger MYM-type containing 3 [Source:HGNC Sym... [more]
back to top
BLAST of ZMYM-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ZMYM-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
woc6.711e-3530.64gene:FBgn0010328 transcript:FBtr0308502[more]
woc1.271e-3430.64gene:FBgn0010328 transcript:FBtr0085178[more]
woc1.311e-3430.64gene:FBgn0010328 transcript:FBtr0112857[more]
woc1.346e-3430.64gene:FBgn0010328 transcript:FBtr0334731[more]
woc1.440e-3430.64gene:FBgn0010328 transcript:FBtr0334730[more]
back to top
BLAST of ZMYM-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zmym24.428e-3130.23zinc finger, MYM-type 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
si:ch211-173p18.32.199e-2926.86si:ch211-173p18.3 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
si:ch211-173p18.32.953e-2926.86si:ch211-173p18.3 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
zmym47.361e-2926.71zinc finger, MYM-type 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
zmym47.361e-2926.71zinc finger, MYM-type 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of ZMYM-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zmym48.125e-3526.23zinc finger MYM-type containing 4 [Source:NCBI gen... [more]
zmym48.726e-3526.23zinc finger MYM-type containing 4 [Source:NCBI gen... [more]
comt1.069e-3430.59catechol-O-methyltransferase [Source:Xenbase;Acc:X... [more]
ZMYM32.004e-3331.19zinc finger MYM-type containing 3 [Source:NCBI gen... [more]
ZMYM34.478e-3330.77zinc finger MYM-type containing 3 [Source:NCBI gen... [more]
back to top
BLAST of ZMYM-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zmym31.080e-3631.60zinc finger, MYM-type 3 [Source:MGI Symbol;Acc:MGI... [more]
Zmym31.120e-3631.60zinc finger, MYM-type 3 [Source:MGI Symbol;Acc:MGI... [more]
Zmym31.186e-3631.60zinc finger, MYM-type 3 [Source:MGI Symbol;Acc:MGI... [more]
Zmym21.959e-3630.59zinc finger, MYM-type 2 [Source:MGI Symbol;Acc:MGI... [more]
Zmym45.112e-3227.76zinc finger, MYM-type 4 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of ZMYM-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JLM4|ZMYM3_MOUSE7.835e-3631.60Zinc finger MYM-type protein 3 OS=Mus musculus OX=... [more]
sp|Q5RDJ2|ZMYM2_PONAB1.057e-3530.36Zinc finger MYM-type protein 2 OS=Pongo abelii OX=... [more]
sp|Q9UBW7|ZMYM2_HUMAN1.136e-3530.36Zinc finger MYM-type protein 2 OS=Homo sapiens OX=... [more]
sp|Q9CU65|ZMYM2_MOUSE1.370e-3530.59Zinc finger MYM-type protein 2 OS=Mus musculus OX=... [more]
sp|Q14202|ZMYM3_HUMAN3.120e-3531.19Zinc finger MYM-type protein 3 OS=Homo sapiens OX=... [more]
back to top
BLAST of ZMYM-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXU30.000e+099.03ZMYM-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A5K3FGM81.596e-5438.83Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FFB11.727e-5438.83Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3U5P83.031e-5438.83Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A158QFL24.054e-5239.34DUF3504 domain-containing protein OS=Hymenolepis d... [more]
back to top
BLAST of ZMYM-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zmym26.661e-3230.72zinc finger MYM-type containing 2 [Source:NCBI gen... [more]
zmym27.452e-3230.72zinc finger MYM-type containing 2 [Source:NCBI gen... [more]
zmym27.452e-3230.72zinc finger MYM-type containing 2 [Source:NCBI gen... [more]
zmym27.452e-3230.72zinc finger MYM-type containing 2 [Source:NCBI gen... [more]
si:ch211-173p18.31.757e-2928.05zinc finger MYM-type protein 4 [Source:NCBI gene;A... [more]
back to top
BLAST of ZMYM-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ZMYM-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ZMYM-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ZMYM-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038920.15.860e-3228.52zinc finger MYM-type protein 4 [Source:NCBI gene;A... [more]
zmym26.829e-3027.45zinc finger MYM-type containing 2 [Source:NCBI gen... [more]
zmym26.829e-3027.45zinc finger MYM-type containing 2 [Source:NCBI gen... [more]
zmym26.829e-3027.45zinc finger MYM-type containing 2 [Source:NCBI gen... [more]
ENSORLT00000022211.25.531e-2930.14pep primary_assembly:ASM223467v1:22:19920706:19948... [more]
back to top
BLAST of ZMYM-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000032173.10.000e+099.35SMESG000032173.1[more]
SMESG000032185.11.135e-11896.48SMESG000032185.1[more]
SMESG000032185.11.799e-10389.45SMESG000032185.1[more]
SMESG000032185.19.715e-9889.06SMESG000032185.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006591
GenBankAFD29614.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006591 ID=SMED30006591|Name=ZMYM-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1967bp
CAATTTTAATATTTTTATAAATGAATGACAGTAATCAGTATATGGTACAA
GTGGCGGACTATGACCAGAACACATATATAATTCAAGACGCGAACGGCGT
TCAATATGATGGTAGTGCAATTATATCTAGTGACATTGCTGAAGGAAATA
ATCTGATTAGTGAACCACGATGGATCCAACAAAATTCAGCAAGAGGTGGC
AAAATTATGACTAATCAAGGATTCGTAAATGGTGGTGATTTAGTATCAGT
TAATGGTACTGGGTTAAATCTGAACACTAGATTTACTCCTTCCTCAATTG
TTTTTAATTCGGCTAATGCAGGTCAATTTGACCAAGACAGTTTAAGAATA
GCATCAGCTGTCACTGGAACTGGTGGAAGAGGGCGACCAAGAGGGCGAAA
ACCTTCACGAGGGAATTTCCCAGTTGTACCAATAGACATGGTGAGGCAAT
TAGGAATCGAACAACAGGTAATACTCCAACCAACAGTACCGGTAGCAACA
AAGAATAAGGCAATCCAAACATCAACAATACAAATGTCAAAGAAAACGCA
ATGCAACGATATCGGGATTAACGAGATTTCTATCAATCCAGTGGCCATCG
AGTCAAGTGCAAAATGCATCCATGTTCCAGTATTTATTCCGATCCCGGTA
CCAGTTTACATACCGATTCCAACATTTGTTAGAGAAAAACCGAAACCGAA
GGAATTGGAAATTACTCAGGAAATAAAATATGACGAATCAGAACTTATTG
TGGAACGGGAAACTACAAGTGATGATAAAAACATCGTTTCGGTTGAGGCT
TCATCAATTGAGAATTTGATAGAGAAATCTGCAGAAGAGTCTAATACTAA
TGCGGTTGACGTGTTGATGCTAACAGAAGAATCACCAATCAAAGATGTTA
CACCAAGTCAATCTTTTGTTCCATCTTCCCAAGAGAAACATATTACTATT
TCAAATGATGAGGAATCATCAGCTCCACCGAAAGAATTACCAGTGGAATC
CAAAAAGCGTCGTCATAGCGATACGGAATCGATGCCGAATAAAATCAGAA
AAACCGAAGCGACAGCAATAGAAAAGAAAGAAATTGATCCATGCAAATTG
AAATATTCCTACGGCATCAATGCATGGCGTCACTGGTCTAAAAATCTCGA
TCTGCTGAAGTTGACAGTTACAGAAATCAATAAGTATATGATTGAATTTG
TGCAGAAAATCCGCAAGCCAACAAATGAGCCTTACGTTCCAGATTCAATA
TTCTATTTGTGTCTAGGCATCCAATTATTTCTGCAAGATCATAAAAATGA
ATTGAACTTGTTTGTTGATCCGCGACTTGTGGGATTTCAGAGTGAATTGA
ATAAAATTTTGGCGACTTTTCAACCGAAACTCGGAGAAAATCACGTGCTC
GTTTGTCGAATCGAAGAAGATCATCTGTGGGAATCGCTACAGCTCGGTTG
TCACGATCCTGGAGTGCTCTTGTTCTCGGTTTGTTACATATTGACGAGGA
ACATGAAAATATCCACTGTTGAGGAACACGCAAAGCTCTCCGTCAGCCAA
TTGGAAGTCAGTGAATCAAAAATCACATATTTATCCAACAGCGACAACGT
GAAATATGAATTGTGTGCCGAAACAAATGCTAAGCGCTCTTTCTATACAA
TTGTTCGCACTTATATTGAGAAATGCAACGCATTGGGGTCCGCCGATAAA
TCTCGAATGCTGTTATATCTGAGGCCTGTTACGTCACAGCCCGCTGACAA
GGACACCACTGACAGAGATTCCCTGTGGTACGAGAGCAATCCCGTGGATT
CCTCTCTATTGGACATGATGCTGAATAGAATCAGAATTGTCAAAGAAGTC
CAGGAAAGCCTTTTATCATCGAATTGTTAAATCATTATTTGAAGCAGGCA
TTTGTTTGTATGATGTAAATATTGATGAAATCTGTAATTTATGTTAGCTG
ATTATAATAAACTGTCC
back to top

protein sequence of SMED30006591-orf-1

>SMED30006591-orf-1 ID=SMED30006591-orf-1|Name=SMED30006591-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=620bp
MNDSNQYMVQVADYDQNTYIIQDANGVQYDGSAIISSDIAEGNNLISEPR
WIQQNSARGGKIMTNQGFVNGGDLVSVNGTGLNLNTRFTPSSIVFNSANA
GQFDQDSLRIASAVTGTGGRGRPRGRKPSRGNFPVVPIDMVRQLGIEQQV
ILQPTVPVATKNKAIQTSTIQMSKKTQCNDIGINEISINPVAIESSAKCI
HVPVFIPIPVPVYIPIPTFVREKPKPKELEITQEIKYDESELIVERETTS
DDKNIVSVEASSIENLIEKSAEESNTNAVDVLMLTEESPIKDVTPSQSFV
PSSQEKHITISNDEESSAPPKELPVESKKRRHSDTESMPNKIRKTEATAI
EKKEIDPCKLKYSYGINAWRHWSKNLDLLKLTVTEINKYMIEFVQKIRKP
TNEPYVPDSIFYLCLGIQLFLQDHKNELNLFVDPRLVGFQSELNKILATF
QPKLGENHVLVCRIEEDHLWESLQLGCHDPGVLLFSVCYILTRNMKISTV
EEHAKLSVSQLEVSESKITYLSNSDNVKYELCAETNAKRSFYTIVRTYIE
KCNALGSADKSRMLLYLRPVTSQPADKDTTDRDSLWYESNPVDSSLLDMM
LNRIRIVKEVQESLLSSNC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR021893DUF3504
Vocabulary: molecular function
TermDefinition
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0007010cytoskeleton organization
GO:0007275multicellular organism development
GO:0022604regulation of cell morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021893Protein of unknown function DUF3504PFAMPF12012DUF3504coord: 461..522
e-value: 6.1E-15
score: 55.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 292..339
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 292..307
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 319..339
NoneNo IPR availablePANTHERPTHR45736:SF1WITHOUT CHILDREN, ISOFORM Bcoord: 247..616
coord: 44..232
NoneNo IPR availablePANTHERPTHR45736FAMILY NOT NAMEDcoord: 247..616
coord: 44..232