Major facilitator superfamily domain-containing protein 2

Overview
NameMajor facilitator superfamily domain-containing protein 2
Smed IDSMED30006587
Uniprot Best hitCoiled-coil domain-containing protein 24 OS=Homo sapiens OX=9606 GN=CCDC24 PE=1 SV=1 (E=1.45159e-15)
Length (bp)1485
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Major facilitator superfamily domain-containing protein 2 (SMED30006587) t-SNE clustered cells

Violin plots show distribution of expression levels for Major facilitator superfamily domain-containing protein 2 (SMED30006587) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Major facilitator superfamily domain-containing protein 2 (SMED30006587) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Major facilitator superfamily domain-containing protein 2 (SMED30006587) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006587

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006587SMESG000078057.1 SmedASXL_013250SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30006587SMESG000078057.1 dd_Smed_v6_16835_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30006587SMESG000078057.1 dd_Smed_v4_16835_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30006587SMESG000078057.1 dd_Smed_v4_16835_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Human
Match: CCDC24 (coiled-coil domain containing 24 [Source:HGNC Symbol;Acc:HGNC:28688])

HSP 1 Score: 80.8777 bits (198), Expect = 3.023e-16
Identity = 67/267 (25.09%), Postives = 127/267 (47.57%), Query Frame = 3
Query:  111 SLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSFEQASG----DSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESSRPTTSNDSYISTSRSSYRATPISDRINVNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDVERCFSSMS--KHTISELKQERHELEQIXXXXXXXXXXXXXKINQTSVLTARKSIGETSLNSNHTIAPANSS-QKLKP 890
            SLW ++ E+V L E  EVK  +G   VD S+ELR+E+  L  + +     QA            L  PP +++ L +E++  + G+R +A  +G++  +A   +   ++ +A E  R     +  I   R      P S   +++++K++LN    ++V  +L+  L+EE + L  +++ +Q  L  + +  C  S +  + T++ELK+++  +EQ                        + S+G + ++ NH   P  SS Q L+P
Sbjct:    7 SLWELVEEHVPLRERREVKRILGEAAVDLSLELRAEVAMLRALLQEARSSQAPSSRPISDPSSLLAPPPLLKDLLRQELRQLLQGLRHKAICEGRDQAQAWVQYSPRVLHFALEEPR-CDLPEQEIFQMRG---GGPSSGHRDLSIIKDQLNVSNIDQVARHLRGLLEEECHTLEREILILQRCLEEEYLRPCHPSEAALEPTLAELKEQKKAMEQ----------------------ELQASVGPSCVSPNHRQRPLGSSTQGLRP 247          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Zebrafish
Match: ccdc24 (coiled-coil domain containing 24 [Source:ZFIN;Acc:ZDB-GENE-050327-18])

HSP 1 Score: 80.8777 bits (198), Expect = 1.351e-16
Identity = 60/231 (25.97%), Postives = 115/231 (49.78%), Query Frame = 3
Query:   87 IQNYELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSF-EQASGDSLKQF-LPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESSRPTTSNDSY---------------ISTSRSSYRATPISDRINVNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDVERCFSSMSKH-TISELKQER 725
            + N++   S+WN++ ENV  +EL E+++ +G  L+D   EL SE+    +I++   F E+ S      F L +PP ++E L  EI+  +  +RE+A  QG++ ++ ++ +   ++ YA  +++   S  ++                 +   S  ++  S    +  L+ KLN    +EV ++L+  L EE   L  D+  +Q +L  + V      +    T++ELK+ER
Sbjct:    1 MDNFQHQQSVWNLVKENVPCSELPEIRAVLGDALIDTYTELYSEVEMWEKIWQELHFSERGSRPEAPVFPLADPPALKELLKAEIQLLLLTLREKAARQGRDEEEVISQYSPSVVSYALGNTKRQRSPGTWRERKSPSRPPSSLSETGSRSVSSFSSHSSCEEEIKALRHKLNITHIDEVVAHLRSVLTEESEALRKDVQALQENLEAERVSTQTEPVCPEPTLAELKEER 231          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Zebrafish
Match: ccdc24 (coiled-coil domain containing 24 [Source:ZFIN;Acc:ZDB-GENE-050327-18])

HSP 1 Score: 77.411 bits (189), Expect = 6.440e-16
Identity = 54/209 (25.84%), Postives = 103/209 (49.28%), Query Frame = 3
Query:   87 IQNYELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSF-EQASGDSLKQF-LPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESSRPTTSNDSY---------------ISTSRSSYRATPISDRINVNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHD 662
            + N++   S+WN++ ENV  +EL E+++ +G  L+D   EL SE+    +I++   F E+ S      F L +PP ++E L  EI+  +  +RE+A  QG++ ++ ++ +   ++ YA  +++   S  ++                 +   S  ++  S    +  L+ KLN    +EV ++L+  L EE   L  D+  +Q   Y D
Sbjct:    1 MDNFQHQQSVWNLVKENVPCSELPEIRAVLGDALIDTYTELYSEVEMWEKIWQELHFSERGSRPEAPVFPLADPPALKELLKAEIQLLLLTLREKAARQGRDEEEVISQYSPSVVSYALGNTKRQRSPGTWRERKSPSRPPSSLSETGSRSVSSFSSHSSCEEEIKALRHKLNITHIDEVVAHLRSVLTEESEALRKDVQALQVRAYFD 209          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Zebrafish
Match: ccdc24 (coiled-coil domain containing 24 [Source:ZFIN;Acc:ZDB-GENE-050327-18])

HSP 1 Score: 76.6406 bits (187), Expect = 1.824e-15
Identity = 54/211 (25.59%), Postives = 105/211 (49.76%), Query Frame = 3
Query:   87 IQNYELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSF-EQASGDSLKQF-LPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESSRPTTSNDSY---------------ISTSRSSYRATPISDRINVNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDV 668
            + N++   S+WN++ ENV  +EL E+++ +G  L+D   EL SE+    +I++   F E+ S      F L +PP ++E L  EI+  +  +RE+A  QG++ ++ ++ +   ++ YA  +++   S  ++                 +   S  ++  S    +  L+ KLN    +EV ++L+  L EE   L  D+  +Q +L  + V
Sbjct:    1 MDNFQHQQSVWNLVKENVPCSELPEIRAVLGDALIDTYTELYSEVEMWEKIWQELHFSERGSRPEAPVFPLADPPALKELLKAEIQLLLLTLREKAARQGRDEEEVISQYSPSVVSYALGNTKRQRSPGTWRERKSPSRPPSSLSETGSRSVSSFSSHSSCEEEIKALRHKLNITHIDEVVAHLRSVLTEESEALRKDVQALQENLEAERV 211          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Xenopus
Match: rpl34 (ribosomal protein L34 [Source:Xenbase;Acc:XB-GENE-957318])

HSP 1 Score: 80.8777 bits (198), Expect = 1.013e-15
Identity = 67/242 (27.69%), Postives = 120/242 (49.59%), Query Frame = 3
Query:  111 SLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTF-------SFEQASGDSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESSRPTTSNDSYISTSRSS----------YRATPISDRINVNLL-------------KEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDV--ERCFSSMSKHTISELKQERHELEQ 740
            SLW ++ + V ++E  E K  +G   VD S+EL +E   LL +++         S   +S  S+   L +PP +++ + +EI+  +  +R++AR +G+N D+ALA +   I+++A      TT +DS I++   +             +  SD   V+ L             KEKL   + +EV ++L+  L EE   L  DL  +Q  L  + V      +S+ + +++EL+QER  +E+
Sbjct:   20 SLWGLVEQQVPVSERAEFKRILGEAAVDLSLELHAEFEVLLGLWRELRSNCLASSQASSSLHSISSLLADPPVIKDMVTQEIRMLLLAVRQKARQEGRNVDQALAKYNPKIVNFALG----TTRSDSRINSGTGARLKDQGANRHQMGSRCSDDRPVSSLSTGSSIEDELEEIKEKLKVSDIDEVIAHLQSLLDEECMTLERDLAFLQQRLEEEHVYATEVQTSLPEPSLAELRQERRVIER 257          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Mouse
Match: Ccdc24 (coiled-coil domain containing 24 [Source:MGI Symbol;Acc:MGI:2685874])

HSP 1 Score: 62.3882 bits (150), Expect = 2.909e-10
Identity = 54/213 (25.35%), Postives = 111/213 (52.11%), Query Frame = 3
Query:  111 SLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSFEQASGDSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESSRPTTSNDSYISTSRSSYRAT-PISDRINVNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDVERCFSSMSKH--TISELKQERHELEQ 740
            +LW ++ E+V L E  EVK  +G   VD S+ELR E+  L  + +     Q S       L  PP +R+ + +E++  + G+R +A S+G++  +  A +   ++ +A E +R  ++            RA  P +   ++ ++K++LN    ++V  +L+  L+EE + L +++ ++Q+ L  + ++ C  S      T+ E+K ++  +E+
Sbjct:    7 ALWELVEEHVPLPERPEVKRILGEAAVDLSLELREEVAMLKALLQEIQSSQVSNSDPPSLLAPPPLLRDLIRQELRQLLQGLRLKAISEGRDQTQMWAQYSPRVLRFALEDTRCDSTQQEL------PMRADEPSTCPRDLTVIKDQLNVSNIDQVVRHLRSLLEEECHMLQNEISDLQHCLEMEQMQACQPSKDTQMPTLGEIKDQKAAMER 213          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Mouse
Match: Ccdc24 (coiled-coil domain containing 24 [Source:MGI Symbol;Acc:MGI:2685874])

HSP 1 Score: 48.9062 bits (115), Expect = 2.666e-6
Identity = 46/181 (25.41%), Postives = 94/181 (51.93%), Query Frame = 3
Query:  111 SLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSFEQASGDSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESSR--------PTTSND--SYISTSRSSYRATPISDRI-NVNLLKEKLNYMEFEEVQSNLKQFLQEEVNHL 620
            +LW ++ E+V L E  EVK  +G   VD S+ELR E+  L  + +     Q S       L  PP +R+ + +E++  + G+R +A S+G++  +  A +   ++ +A E +R        P  +++  + ++ +      +P+S    ++ ++K++LN    ++V  +L+  L+EE + L
Sbjct:    7 ALWELVEEHVPLPERPEVKRILGEAAVDLSLELREEVAMLKALLQEIQSSQVSNSDPPSLLAPPPLLRDLIRQELRQLLQGLRLKAISEGRDQTQMWAQYSPRVLRFALEDTRCDSTQQELPMRADEPRAGMNNTERVMVTSPVSTCPRDLTVIKDQLNVSNIDQVVRHLRSLLEEECHML 187          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. UniProt
Match: sp|Q8N4L8|CCD24_HUMAN (Coiled-coil domain-containing protein 24 OS=Homo sapiens OX=9606 GN=CCDC24 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.452e-15
Identity = 67/267 (25.09%), Postives = 127/267 (47.57%), Query Frame = 3
Query:  111 SLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSFEQASG----DSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESSRPTTSNDSYISTSRSSYRATPISDRINVNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDVERCFSSMS--KHTISELKQERHELEQIXXXXXXXXXXXXXKINQTSVLTARKSIGETSLNSNHTIAPANSS-QKLKP 890
            SLW ++ E+V L E  EVK  +G   VD S+ELR+E+  L  + +     QA            L  PP +++ L +E++  + G+R +A  +G++  +A   +   ++ +A E  R     +  I   R      P S   +++++K++LN    ++V  +L+  L+EE + L  +++ +Q  L  + +  C  S +  + T++ELK+++  +EQ                        + S+G + ++ NH   P  SS Q L+P
Sbjct:    7 SLWELVEEHVPLRERREVKRILGEAAVDLSLELRAEVAMLRALLQEARSSQAPSSRPISDPSSLLAPPPLLKDLLRQELRQLLQGLRHKAICEGRDQAQAWVQYSPRVLHFALEEPR-CDLPEQEIFQMRG---GGPSSGHRDLSIIKDQLNVSNIDQVARHLRGLLEEECHTLEREILILQRCLEEEYLRPCHPSEAALEPTLAELKEQKKAMEQ----------------------ELQASVGPSCVSPNHRQRPLGSSTQGLRP 247          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|23526245 (tr|A0A210PEC2|A0A210PEC2_MIZYE Coiled-coil domain-containing protein 24 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08521 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.563e-34
Identity = 89/239 (37.24%), Postives = 147/239 (61.51%), Query Frame = 3
Query:   87 IQNYELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSFEQASGDSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKAL-ANHPSDIIDYAYESSRPTTSNDSYISTSRSSYRA-TPI------SDRIN--------VNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSL-----YHDDVERCFSSMSKHTISELKQERHELEQ 740
            +Q Y  P+SLW ++ ++V  +E DE+K+ +G  +VDQS+EL  EI  LLEI++ +  E      +K  LPEPP +R+RL++EI FFV  IR++A++ G NPD+ + A H ++IIDYA +++R  +   S   T+ S   + TP+      SDRI+        ++ + +KLN + F+EV  +L+  L+EEV+ L  D+  +Q+ L     Y  +V+  FS   + TI++L+QER ++E+
Sbjct:    8 LQGYNPPISLWQLVEQHVPKHEQDEIKNLLGESMVDQSLELHQEIDLLLEIWRDYRDETNGTQRVK--LPEPPGLRDRLVQEINFFVENIRDKAKNNGVNPDRFIKAKHNTEIIDYAMDTARSGSRCRSRPGTAMSRDGSETPMITTPTGSDRISAASTLSEEIDSMNDKLNILHFDEVVQHLRSTLEEEVSMLLKDIRFLQDCLDDEATYRAEVKGTFS--REPTIADLQQERSKMEK 242          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|20322332 (tr|A0A1S3KE63|A0A1S3KE63_LINUN coiled-coil domain-containing protein 24 OS=Lingula unguis OX=7574 GN=LOC106181041 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.778e-33
Identity = 84/232 (36.21%), Postives = 138/232 (59.48%), Query Frame = 3
Query:   87 IQNYELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSFEQASGDSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESSRPTTS-NDSYISTSRSS--------YRATPISDRI-----NVNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDVERCFSSMSKHTISELKQERHELEQ 740
            +  YE P+SLW ++  +V  +E +EVK  +G  LV+QS+EL  E+ TLL+I++ +  +        Q   EPP VR+RL +EIKFFV+ +RE+A+  G++P   L+ H +++I+YA +  RP ++   S  ST+RSS         R TP SDR      +V  + +KLN ++ ++V  +L++ ++EEVN L  D+  +Q  L  +   R  +   + +I+EL++ER  LEQ
Sbjct:    7 VYAYEPPLSLWELVKHHVPEHEQEEVKDMLGESLVEQSLELHEEVNTLLDIWRDYRDDTNQTVQRSQMF-EPPLVRDRLKQEIKFFVDSLREKAQKNGRDPSLVLSRHNTEVIEYALDKKRPGSAETSSRPSTARSSRDGRETPLTRLTPTSDRASTLSDDVESMNDKLNVLKLDDVVLHLRETMEEEVNQLLRDIAFLQECLQGEVDYRDEAQAEEPSITELQKERGHLEQ 237          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|17696871 (tr|A0A2G8KIW3|A0A2G8KIW3_STIJA Putative coiled-coil domain-containing protein OS=Stichopus japonicus OX=307972 GN=BSL78_15215 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 4.117e-32
Identity = 94/244 (38.52%), Postives = 141/244 (57.79%), Query Frame = 3
Query:   96 YELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSFEQASGDSLK----QFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESSRPTTS----------NDSYISTSRSSYRATPIS---DRIN--------VNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDVERCFSSM---SKHTISELKQERHELEQI 743
            YE P SLW ++ ENV+L E +EV+  +G  LVDQS+EL +E+  LLEI++TF  E    D+LK    + LPEPP +R+ L   IK  V  IRE+++  G++ +  L+N  SDIIDYA E S   +S          + S  S   +  R TP S   DR++        V+ ++++LN ++ +EV   L+  L+EEV  L SD+  +QN L  +   RC S M   S+ +I EL++ER +LE++
Sbjct:   13 YEPPESLWRLVEENVSLEEKEEVREILGDSLVDQSLELHAEVGALLEIWQTFKNET---DNLKSSQPKTLPEPPGMRDSLRNHIKMLVENIREKSKITGRDSEIVLSNRKSDIIDYAMEGSSRGSSPSLVRSRPSSSVSSRSGRDTPMRMTPSSSEEDRLSESTTASEKVDSVRDRLNVLKIDEVVHELRSTLREEVTQLISDIKFLQNCLEDEKDFRCESQMSVCSEPSIQELREERSKLEKM 253          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|17793862 (tr|A0A2G8K7A4|A0A2G8K7A4_STIJA Putative coiled-coil domain-containing protein OS=Stichopus japonicus OX=307972 GN=BSL78_19226 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.164e-31
Identity = 93/244 (38.11%), Postives = 141/244 (57.79%), Query Frame = 3
Query:   96 YELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSFEQASGDSLK----QFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESSRPTTS----------NDSYISTSRSSYRATPIS---DRIN--------VNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDVERCFSSM---SKHTISELKQERHELEQI 743
            YE P SLW ++ ENV+L E +EV+  +G  LVDQS+EL +E+  LLEI++TF  E    D+LK    + LPEPP +R+ L   IK  V  IRE+++  G++ +  L+N  SDIIDYA E S   +S          + S  S   +  R TP S   DR++        V+ ++++L+ ++ +EV   L+  L+EEV  L SD+  +QN L  +   RC S M   S+ +I EL++ER +LE++
Sbjct:   13 YEPPESLWRLVEENVSLEEKEEVREILGDSLVDQSLELHAEVGALLEIWQTFKNET---DNLKSSQPKTLPEPPGMRDSLRNHIKMLVENIREKSKITGRDSEVVLSNRKSDIIDYAMEGSSRGSSPSLVRSRPSSSLSSRSGRETPMRMTPSSSEEDRLSESTTASEKVDSVRDRLSVLKIDEVVHELRSTLREEVTQLISDIKFLQNCLEDEKDFRCESQMSVNSEPSIQELREERSKLEKM 253          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|18313634 (tr|A0A267GAL6|A0A267GAL6_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016138g1 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.762e-31
Identity = 93/256 (36.33%), Postives = 138/256 (53.91%), Query Frame = 3
Query:   90 QNYELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTF-----SFEQASGDSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYE--SSRPTTSND---------SYISTSRSSYRAT------PISDRINVNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLY----------------HDDVERCFSSMSKH-TISELKQERHELEQ 740
            ++YE P SLW ++ E+ A +E  E+K  IG DL+DQ++ELR EI  LLE+         S EQ+S       LPEPP++R RL +EI FF+  IREQ R+      K   N   +++DYAYE  SSRP+T N          +  S++RS  R T      P ++  +V  ++++L YM  +EV+  L+  LQEE++ L  DL ++Q SL                 H        S+S+  T+S+L+ ERH+LE+
Sbjct:   17 RSYEAPSSLWEIVREHAAPSEHHELKHLIGADLIDQTLELRREIGLLLELSMDLQDDEDSHEQSSAAQRPAPLPEPPQMRARLAQEIVFFLEAIREQQRTTDLR--KYDVNQ--EVVDYAYESSSSRPSTGNSRLSLGEIRVTPCSSARSGSRRTARSVEAPTAE--DVAGMRDQLTYMRCDEVRRRLRSHLQEEIDQLKQDLEQLQESLQTQQQPGFTARSDTHHGHRPPSSLQRSLSREPTLSDLRSERHKLER 266          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000012549.2 (coiled-coil domain containing 24 [Source:NCBI gene;Acc:103039706])

HSP 1 Score: 73.1738 bits (178), Expect = 1.489e-13
Identity = 62/228 (27.19%), Postives = 116/228 (50.88%), Query Frame = 3
Query:   87 IQNYELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSFEQASGDSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESSRPTTSNDSYISTSRSSYRATPISDRI---------------NVNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDVERCFSSMSKHTISELKQER 725
            ++++ +  SLW+M+ E V  +EL EV++ +G  L+D  +E+ SE+  L  I++  + +  +  + +  L +PP V+E L  E++  +  +RE+A   G++ D+ ++ +   ++ YA      T S DS   T+  S    P   R                ++  L+EKLN    +EV SNLK    +E   L  D+  +Q S+  +  ++    + + T++ELK+ER
Sbjct:    1 MESFRVQQSLWDMVKEYVPDSELVEVRAALGGGLIDLYLEIYSEVQMLERIWR--NVQGGTPRTPRTPLADPPAVKELLRAELQLLLLNLRERAARLGRDGDEVVSRYNHRVVSYALAGR--TGSPDSQCETAAPSSSPEPSLSRCDSRSSSRLSSRSSEDDIEALREKLNVTHIDEVVSNLKSIFTDECEALKEDVQFLQESVKLEYQKQREPELVEPTLTELKEER 224          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO45440 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTB5])

HSP 1 Score: 103.99 bits (258), Expect = 2.923e-24
Identity = 91/296 (30.74%), Postives = 148/296 (50.00%), Query Frame = 3
Query:   78 MDY-IQNYELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSFE------QASGDSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYE------------SSRPTTSNDSYISTSRSSYRATPISD--RINVNL------LKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDVER---CFSSMSKHTISELKQERHELEQIXXXXXXXXXXXXXKINQTS-----VLTARKSIGETSLNSNHTIA 860
            MD+    +E+  SLW +I E VA +E  E+K  +G DLV+++VEL +E T+LLEI++ +  E      + + +     LPEPP +RE L KEI  FV  ++++A  +G+     L+   ++I+DY  E            SSRP+T+  S     ++  RATP S+  R   +L      + +KLN +E + +  +L+  L EE   L+ D+  +Q  L  +   R     S   + +I EL++    LE+           +   +NQTS     V   + S+ ETSL++N   A
Sbjct:   10 MDWTFSEFEIQPSLWKLIEEFVAKSERPEIKEVLGEDLVEETVELHNEATSLLEIWREYHEETDREEREVALNRHLSRLPEPPLIRENLKKEIMMFVGMLQQRAEEEGRQSSSVLSKKDNEIVDYVMERPEATVKRCRSASSRPSTAASSQ-DGRQTPMRATPSSEGSRCTSSLSDHLESMNDKLNALEIDRITDHLRSLLLEEKQRLSDDISFLQECLVEESDYRQQVMASPDPEPSIKELRELGTRLEK--------ELLSKPTVNQTSPKHKPVRFKQTSLEETSLDNNRNRA 296          
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000078057.1 (SMESG000078057.1)

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 362/366 (98.91%), Postives = 363/366 (99.18%), Query Frame = 3
Query:   78 MDYIQNYELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSFEQASGDSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESS--RPTTSNDSYISTSRSSYRATPISDRINVNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDVERCFSSMSKHTISELKQERHELEQIXXXXXXXXXXXXXKINQTSVLTARKSIGETSLNSNHTIAPANSSQKLKPICNKDLNRSSGYVKSPLEIELPXXXXXXXXXXXXXXXXXXXXRDLNHFNLPKTLPQKSYLENAAKFNSAQRFRQKVLQNRKDTLPNRYEFQFH 1169
            MDYIQNYELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSFEQASGDSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESS  RPTTSNDSYISTSRSSYRATPISDRINVNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDVERCFSSMSKHTISELKQERHELEQILLQSSR LSSANSKINQTSVLTARKSIGETSLNSNHTIAPANSSQKLKPICNKDLNRSSGYVKSPLEIELPDNTDSSFDDSVNTNNSSVTSRDL+HFNLPKTLPQKSYLENAAKFNSAQRFRQKVLQNRKDTLPNRYEFQFH
Sbjct:    1 MDYIQNYELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITTLLEIYKTFSFEQASGDSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQGKNPDKALANHPSDIIDYAYESSSSRPTTSNDSYISTSRSSYRATPISDRINVNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDVERCFSSMSKHTISELKQERHELEQILLQSSRPLSSANSKINQTSVLTARKSIGETSLNSNHTIAPANSSQKLKPICNKDLNRSSGYVKSPLEIELPDNTDSSFDDSVNTNNSSVTSRDLDHFNLPKTLPQKSYLENAAKFNSAQRFRQKVLQNRKDTLPNRYEFQFH 366          
The following BLAST results are available for this feature:
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC243.023e-1625.09coiled-coil domain containing 24 [Source:HGNC Symb... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ccdc241.351e-1625.97coiled-coil domain containing 24 [Source:ZFIN;Acc:... [more]
ccdc246.440e-1625.84coiled-coil domain containing 24 [Source:ZFIN;Acc:... [more]
ccdc241.824e-1525.59coiled-coil domain containing 24 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl341.013e-1527.69ribosomal protein L34 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ccdc242.909e-1025.35coiled-coil domain containing 24 [Source:MGI Symbo... [more]
Ccdc242.666e-625.41coiled-coil domain containing 24 [Source:MGI Symbo... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 2 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8N4L8|CCD24_HUMAN1.452e-1525.09Coiled-coil domain-containing protein 24 OS=Homo s... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|235262451.563e-3437.24tr|A0A210PEC2|A0A210PEC2_MIZYE Coiled-coil domain-... [more]
gnl|BL_ORD_ID|203223323.778e-3336.21tr|A0A1S3KE63|A0A1S3KE63_LINUN coiled-coil domain-... [more]
gnl|BL_ORD_ID|176968714.117e-3238.52tr|A0A2G8KIW3|A0A2G8KIW3_STIJA Putative coiled-coi... [more]
gnl|BL_ORD_ID|177938621.164e-3138.11tr|A0A2G8K7A4|A0A2G8K7A4_STIJA Putative coiled-coi... [more]
gnl|BL_ORD_ID|183136341.762e-3136.33tr|A0A267GAL6|A0A267GAL6_9PLAT Uncharacterized pro... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000012549.21.489e-1327.19coiled-coil domain containing 24 [Source:NCBI gene... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO454402.923e-2430.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000078057.10.000e+098.91SMESG000078057.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006587 ID=SMED30006587|Name=Major facilitator superfamily domain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1485bp
GTTGATTCTAATTTTAAGCCTAACAAATTTAAAATTCAAAAATTTATAAT
TTCAAATTAATGAATTTGTGACAGAAAATGGACTATATTCAAAATTATGA
ATTGCCAATGTCTTTATGGAACATGATAATAGAAAATGTAGCGCTAAATG
AACTTGACGAGGTTAAATCTTTTATCGGGCGAGATTTAGTAGATCAATCA
GTCGAATTGAGATCTGAAATAACTACATTATTGGAAATATACAAAACATT
TTCATTTGAACAAGCCTCTGGCGATTCATTGAAACAATTTTTACCGGAAC
CACCTGAAGTCCGAGAGCGATTAATTAAAGAAATTAAATTTTTTGTCAAT
GGTATTCGAGAACAAGCGCGTTCACAAGGAAAGAATCCTGACAAAGCTCT
AGCCAACCATCCCAGTGACATAATAGATTACGCATATGAAAGCAGCAGGC
CAACCACATCCAATGATTCTTACATATCAACCTCTCGCAGTTCGTACCGA
GCCACGCCTATTTCTGACCGTATTAATGTTAATCTTTTGAAAGAAAAGCT
AAACTACATGGAATTTGAAGAAGTTCAAAGTAATCTAAAACAATTCCTTC
AAGAGGAAGTAAATCATTTAAATTCTGATTTAATTGAGATTCAAAATAGT
CTATATCATGATGATGTAGAAAGATGTTTTTCCAGTATGTCTAAACATAC
TATTTCAGAATTGAAACAAGAACGCCATGAACTAGAACAAATATTGTTAC
AATCATCAAGATCTTTGTCAAGTGCTAACTCGAAAATCAACCAAACATCA
GTTCTAACGGCGAGAAAGTCAATTGGGGAAACTTCTCTGAATTCCAACCA
CACAATAGCGCCAGCAAATTCATCGCAGAAACTCAAACCAATTTGCAATA
AAGATTTGAATAGATCCTCCGGCTACGTGAAAAGCCCTTTAGAAATTGAA
TTGCCAGACAATACCGATTCATCATTCGATGACTCTGTGAATACTAATAA
TTCTTCAGTCACTTCTAGAGATTTGAACCATTTTAATCTACCGAAAACTT
TGCCTCAAAAATCCTACTTGGAAAACGCAGCGAAATTCAATTCAGCTCAA
AGGTTTCGACAGAAAGTCTTACAGAACCGCAAAGATACTTTGCCAAATAG
ATATGAATTTCAGTTTCATTGAAGCGAATCCAAATATGTTAATTTTTAGA
TTTTCAGCTTCTATTTCGATATGAAGAATAATAGAGAAAAAGTTTCAATT
GTATATAAATAATTATTAGAAGTTTGAAAAATTTTCAACTAATTTCTGCA
ACTCTTTTCAGATGTAGCTTACTAGTTTTGGTAATAAATTGCATAGAATG
CGGTTTTCATCGGTCCACAGTTCATCCTTTTGAATAAGTTACATATCACT
GTGAATATAATCATTGTTTTTACAATTTGGCCGATAACTCACACAAACTC
GATTTCTTAGGAAACAAATTATTGTTTCTTTAAAG
back to top

protein sequence of SMED30006587-orf-1

>SMED30006587-orf-1 ID=SMED30006587-orf-1|Name=SMED30006587-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=365bp
MDYIQNYELPMSLWNMIIENVALNELDEVKSFIGRDLVDQSVELRSEITT
LLEIYKTFSFEQASGDSLKQFLPEPPEVRERLIKEIKFFVNGIREQARSQ
GKNPDKALANHPSDIIDYAYESSRPTTSNDSYISTSRSSYRATPISDRIN
VNLLKEKLNYMEFEEVQSNLKQFLQEEVNHLNSDLIEIQNSLYHDDVERC
FSSMSKHTISELKQERHELEQILLQSSRSLSSANSKINQTSVLTARKSIG
ETSLNSNHTIAPANSSQKLKPICNKDLNRSSGYVKSPLEIELPDNTDSSF
DDSVNTNNSSVTSRDLNHFNLPKTLPQKSYLENAAKFNSAQRFRQKVLQN
RKDTLPNRYEFQFH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008643carbohydrate transport
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0015293symporter activity
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR031367CCDC24
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 171..191
IPR031367Coiled-coil domain-containing protein 24PFAMPF15669CCDC24coord: 26..194
e-value: 3.5E-32
score: 111.9
IPR031367Coiled-coil domain-containing protein 24PANTHERPTHR28601FAMILY NOT NAMEDcoord: 5..272