frizzled receptor-like protein

Overview
Namefrizzled receptor-like protein (ABW97516.1)
Smed IDSMED30006583
Length (bp)2308
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of frizzled receptor-like protein (SMED30006583) t-SNE clustered cells

Violin plots show distribution of expression levels for frizzled receptor-like protein (SMED30006583) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of frizzled receptor-like protein (SMED30006583) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for frizzled receptor-like protein (SMED30006583) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006583

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30006583SMESG000004519.1 EU130789.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30006583SMESG000004519.1 EU130789.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30006583SMESG000004519.1 dd_Smed_v4_11650_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30006583SMESG000004519.1 dd_Smed_v4_11650_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30006583SMESG000004519.1 dd_Smed_v4_11650_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30006583SMESG000004519.1 EU130789.1smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30006583SMESG000004519.1 SmedASXL_012003SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
posterior region of the whole animalSMED30006583SMESG000004519.1 EU130789.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30006583SMESG000004519.1 dd_Smed_v4_11650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006583SMESG000004519.1 dd_Smed_v4_11650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30006583SMESG000004519.1 dd_Smed_v4_11650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30006583SMESG000004519.1 dd_Smed_v4_11650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006583SMESG000004519.1 Contig55610newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006583SMESG000004519.1 Contig55610uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30006583SMESG000004519.1 EU130789.1smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30006583SMESG000004519.1 dd_Smed_v6_11650_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30006583SMESG000004519.1 OX_Smed_1.0.01988ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
posterior region of the whole animalSMED30006583SMESG000004519.1 EU130789.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30006583SMESG000004519.1 EU130789.1smed_ncbi_20200123PMID:24523458
Lin et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30006583SMESG000004519.1 EU130789.1smed_ncbi_20200123PMID:23318635
Blassberg et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30006583SMESG000004519.1 EU130789.1smed_ncbi_20200123PMID:23318635
Blassberg et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30006583SMESG000004519.1 EU130789.1smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30006583SMESG000004519.1 EU130789.1smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30006583SMESG000004519.1 EU130789.1smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30006583SMESG000004519.1 EU130789.1smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of frizzled receptor-like protein vs. Ensembl Human
Match: FZD10 (frizzled class receptor 10 [Source:HGNC Symbol;Acc:HGNC:4039])

HSP 1 Score: 362.459 bits (929), Expect = 2.332e-115
Identity = 204/552 (36.96%), Postives = 306/552 (55.43%), Query Frame = 2
Query:  122 INIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK---ICLTPDSFSQDE-----------FHP--PANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICS--ANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            I+ ++  R GD   +C PI+ P C+D+ Y+ T MPNL+G  +Q EA+ +  +F PL+   C  +L+ FLCS+Y PMC   T   S+ +  CR +C   + +C P+M E F   W + LDC K P +     +C+   +   DE           F P  P ++QE   +D         +G      K    +K                    + SCA +C+   +V ++  DK FA +WL  W+VLCFFS   T++ F  +  RF YPE+PI+FLS+CY  Y+ G L     G   +AC   + +  +++  G E+T C + FL++Y+FG AS+LWWVVLT+TWFL+A + WG+EAIE+ SS  HL +WAIPA+K+I IL++ ++  DELTG C+VG+ +   L GFV++P   YL IG  F+  G+++L  +RR            N  +LEKLM +IG+FS+LY +P  C I  Y  +   M  + I L A  +    C   N     ++ C  ++   +P+VE+ M++IFM LV+GITSG+WIW +K
Sbjct:   21 ISSMDMERPGD--GKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMC---TEQVSTPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPG-----RGGCDNPGKFHHVEK--------------------SASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKI-LAAQHK----CKMNNQTK--TLDC--LMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSK 526          
BLAST of frizzled receptor-like protein vs. Ensembl Human
Match: FZD4 (frizzled class receptor 4 [Source:HGNC Symbol;Acc:HGNC:4042])

HSP 1 Score: 355.525 bits (911), Expect = 2.580e-113
Identity = 203/535 (37.94%), Postives = 291/535 (54.39%), Query Frame = 2
Query:  137 GRRFGDIY-KQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQ----TPNISCAQICSANVQ-FNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
             R FGD   ++C PI+   CQ++ Y+ T MPNLVG   QT+A  +   F PLI   CS+ L+ FLCSVY PMC    ++    + PC  +C  VK RCEP++KE F   W E L+C KFP                   P N              + M+G   G  ++ +  K     G +C     N  Q      +++C   C  +   ++   K F +IW+  W+ LCF S   T++ F  +++RF YPE+PI+FLS+CY  Y+   +    +GR  ++C         ++  G + T C I FL++YFFG AS++WWV+LT+TWFL+A   WG+EAIE  SS  H+ +WAIPA+K+I ILI+  +DADELTG C+VGN N   L GFV+ P   YL IG +F+  G ++L K+ RS LQ+    D     +LE+LM KIGVFS+LY +P  C I  Y    Y+++N+     ALFR+S +                       ++ + ML+IFM+L++GITSG+WIW  K
Sbjct:   34 ARGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIP---IGPCGGMCLSVKRRCEPVLKE-FGFAWPESLNCSKFP-------------------PQNDHN----------HMCMEGP--GDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKI-RSNLQK----DGTKTDKLERLMVKIGVFSVLYTVPATCVIACYF---YEISNW-----ALFRYSAD---------------------DSNMAVEMLKIFMSLLVGITSGMWIWSAK 499          
BLAST of frizzled receptor-like protein vs. Ensembl Human
Match: FZD9 (frizzled class receptor 9 [Source:HGNC Symbol;Acc:HGNC:4047])

HSP 1 Score: 343.584 bits (880), Expect = 3.976e-108
Identity = 197/528 (37.31%), Postives = 288/528 (54.55%), Query Frame = 2
Query:  149 GDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQ--FNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDI-TLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            G     C  ++ P C+ + Y+ T MPNL+G  SQ EA+    +F PL+   C ++L+ FLCS+Y PMC   T   S+ +  CR +C   + RC P+M E F   W + LDC + P R      P +   +    P N+     +  ++ L ++    R  +   ++           C   E       + SCA  C   V+  ++  DK FA +W+  WS LCFFS   T++ F    +RF YPE+PI+FLS+CY  Y+   L  A+ G   VAC        +++  G E T C + FL++Y+FG AS+LWWVVLT+TWFL+A + WG+EAIE+  S  H+ +W +PALK+I IL L K+  DELTG C+V +++   L GFV+VP   YL +G  FL  G+++L  +R+            N ++LEKLM KIGVFSILY +P  C IV Y+   Y+  N D   L+A  +      G  G    S+    +     P+V + ML+IFM+LV+GITSG+W+W +K
Sbjct:   33 GRGAAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMC---TDQVSTPIPACRPMCEQARLRCAPIM-EQFNFGWPDSLDCARLPTRND----PHALCMEA---PENATAGPAEP-HKGLGMLPVAPRPARPPGDLGPGAGG--SGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQ-EAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTGFVALFHIRKIMK-----TGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYV---YERLNMDFWRLRATEQPCAAAAGPGGRRDCSLPGGSV-----PTVAVFMLKIFMSLVVGITSGVWVWSSK 532          
BLAST of frizzled receptor-like protein vs. Ensembl Human
Match: FZD7 (frizzled class receptor 7 [Source:HGNC Symbol;Acc:HGNC:4045])

HSP 1 Score: 318.546 bits (815), Expect = 1.139e-98
Identity = 183/542 (33.76%), Postives = 274/542 (50.55%), Query Frame = 2
Query:  167 CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERG--KICL---TPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEI---------------YQKMSDM-VGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDIT--LKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            C PI  P C D+ Y+ T +PNL+G  +Q +A      F PL+ ++CS  L+ FLCS+Y P+C    ++    + PCR LC   ++ CE LM + F   W E L CE FP  G  +IC+   T D        P A        DL      +  G   G+ +                  Y+ + +   GA C P   N                + F   ++ FA +W+  WSVLC  S L T++ +  +  RF YPE+PI+FLS CYF  A  ++ G +L    V    F+D     V  G +   C I F+++YFFG AS++WWV+L++TWFL+A   WG+EAIE+ S   HL +WA+PA+K+I IL + ++D D L+G C+VG S+   L GFV+ P  +YLFIG  FL  G++SL ++R          D    ++LEKLM +IGVFS+LY +P    +  Y  +     +++ T  L+    ++  C   +              P+ P   + M++  M +++GIT+G WIW  K
Sbjct:   49 CQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC----TVLDQAIPPCRSLCERARQGCEALMNK-FGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDL--PFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN--------------GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGH------------FPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGK 552          
BLAST of frizzled receptor-like protein vs. Ensembl Human
Match: FZD1 (frizzled class receptor 1 [Source:HGNC Symbol;Acc:HGNC:4038])

HSP 1 Score: 317.39 bits (812), Expect = 2.114e-97
Identity = 189/542 (34.87%), Postives = 273/542 (50.37%), Query Frame = 2
Query:  134 NGRRFGDI--YKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSAN-----VQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIV-----DAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            NG R   +  +  C PI  P C D+ Y+ T MPNL+G  +Q +A      F PL+ ++CS  LK FLCS+Y P+C    ++    + PCR LC   ++ CE LM + F   W + L CEKFP  G   L     + D+  P  +   + +    +      +G   G +      K S    A  +PS +N        C   C        + F   +  F+  W+  WSVLC  S L T++ +  +  RF YPE+PI+FLS CY   A   + G +L   VV    F +     V  G +   C I F+M+YFF  AS++WWV+L++TWFL+A   WG+EAIE+ S   HL +WA+PA+K+I IL L ++D D L+G CFVG +N   L GFV+ P  +YLFIG  FL  G++SL ++R          D    ++LEKLM +IGVFS+LY +P    I  Y       D ++ +    + K+     P+     G             P+ P   + M++  M L++GITSG WIW  K
Sbjct:  103 NGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVC----TVLEQALPPCRSLCERARQGCEALMNK-FGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFS-CPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGG--------APPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGK 625          
BLAST of frizzled receptor-like protein vs. Ensembl Celegans
Match: mom-5 (pep chromosome:WBcel235:I:9965580:9970037:1 gene:WBGene00003397.1 transcript:T23D8.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-5)

HSP 1 Score: 263.848 bits (673), Expect = 1.210e-78
Identity = 164/531 (30.89%), Postives = 266/531 (50.09%), Query Frame = 2
Query:  161 KQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQ-CLPSEVNIGQTPNISCAQICSANVQ----FNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRN-----GINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            ++C  I  P C+++ Y+ T  PNL+G  +Q+EA      FNPLI +KCS  ++LFLC+VY P+C    ++    ++PCR LC   K  CE LMK+ F   W ++LDC KFP    +C+  +S          +S + ++        +    N +  S  +    M    G+   LP  +  G+ P   C+  C A+ Q    F+   +    IW   WSV CF   L T++ F  + +RF YP +PI++L+ CY   ++  + G ++G +  AC  +      +V  G E   C    ++ YFF  +S  WW+VL + WFL+A+  WG E+I ++S   H + W +PA+ S+ +L+ + +D D  TG C VGN N   L  F   P ++ L +G V L  G  S++++ RS+++        N+ +LEKLM +IG F+I+Y LP   T ++  +  Y+  N    L+        C+        G  +    C    +   P + + +L+    LV+GIT  IW+  +K
Sbjct:   35 RKCEHITIPMCKNLDYNQTVFPNLLGHTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVC----TVLEKPIQPCRELCLSAKNGCESLMKK-FGFQWPDQLDCNKFPVT-DLCVGKNSSESSNSKNYRSSNDVTFG-------VSTIANEVVLSPKKCPHHMHTTSGSHFSLP--LLSGRLPE--CSLTCEADNQVPMMFDGRVRRILRIWTAAWSVACFVCSLFTLVTFLVDLSRFAYPVRPILYLAFCYLAISTVYMIG-VVGEDGFACGTYGSTPTTLVTQGGENVGCSALAVVHYFFFMSSCAWWLVLCLAWFLAANLKWGAESIAALSPYFHAMCWGVPAVLSVTVLVTNSVDGDVFTGICSVGNLNPSALVYFFFTPIVVSLALGAVLLVCGIWSMIRI-RSYIKLQHADVERNISKLEKLMLRIGAFAIMYSLP---TAMNAAIMWYQAVNMPAWLEGWLHH--RCVRLQDRELFGFTYPVDDCPMDPKVAAPEIIVFLLKYVSQLVVGITCAIWVVSSK 541          
BLAST of frizzled receptor-like protein vs. Ensembl Celegans
Match: mom-5 (pep chromosome:WBcel235:I:9965580:9969413:1 gene:WBGene00003397.1 transcript:T23D8.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-5)

HSP 1 Score: 261.922 bits (668), Expect = 8.204e-78
Identity = 165/531 (31.07%), Postives = 269/531 (50.66%), Query Frame = 2
Query:  161 KQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQ-CLPSEVNIGQTPNISCAQICSANVQ----FNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRN-----GINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            ++C  I  P C+++ Y+ T  PNL+G  +Q+EA      FNPLI +KCS  ++LFLC+VY P+C    ++    ++PCR LC   K  CE LMK+ F   W ++LDC KFP    +C+  +S         +++ + S  D+   +  +   N +  S  +    M    G+   LP  +  G+ P   C+  C A+ Q    F+   +    IW   WSV CF   L T++ F  + +RF YP +PI++L+ CY   ++  + G ++G +  AC  +      +V  G E   C    ++ YFF  +S  WW+VL + WFL+A+  WG E+I ++S   H + W +PA+ S+ +L+ + +D D  TG C VGN N   L  F   P ++ L +G V L  G  S++++ RS+++        N+ +LEKLM +IG F+I+Y LP   T ++  +  Y+  N    L+        C+        G  +    C    +   P + + +L+    LV+GIT  IW+  +K
Sbjct:   35 RKCEHITIPMCKNLDYNQTVFPNLLGHTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVC----TVLEKPIQPCRELCLSAKNGCESLMKK-FGFQWPDQLDCNKFPVT-DLCVGKNSSE-------SSNSKKSSNDVTFGVSTI--ANEVVLSPKKCPHHMHTTSGSHFSLP--LLSGRLPE--CSLTCEADNQVPMMFDGRVRRILRIWTAAWSVACFVCSLFTLVTFLVDLSRFAYPVRPILYLAFCYLAISTVYMIG-VVGEDGFACGTYGSTPTTLVTQGGENVGCSALAVVHYFFFMSSCAWWLVLCLAWFLAANLKWGAESIAALSPYFHAMCWGVPAVLSVTVLVTNSVDGDVFTGICSVGNLNPSALVYFFFTPIVVSLALGAVLLVCGIWSMIRI-RSYIKLQHADVERNISKLEKLMLRIGAFAIMYSLP---TAMNAAIMWYQAVNMPAWLEGWLHH--RCVRLQDRELFGFTYPVDDCPMDPKVAAPEIIVFLLKYVSQLVVGITCAIWVVSSK 539          
BLAST of frizzled receptor-like protein vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 245.358 bits (625), Expect = 7.685e-72
Identity = 154/536 (28.73%), Postives = 252/536 (47.01%), Query Frame = 2
Query:  119 FINIINGRRFGDIYK-QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            FI +  G  F    K +C+PI    C+D+ Y+ T  PN +    Q         F PL+  KC  ++  F+CSV+ PMC      +   V  C+ +C  VK  C  +++E F + W E L+C +FP+  ++C+ P               ED     +   +L  +G+    SK       SD+V              P   CA  C +NV F+  +K     W + ++       L + + F+ +  RF +PE+ + +LS+C F  +   L    +   + +C A  +   ++     + ++C  +FL+ YFF +A+ALWW++ + T +LS  R W  E IE+ SS +H V+W + +L +I +LI +K+DA ELT  C VGN N+  L  FVIVP  I + IG  F+  G+ S+ + R SF  R       +  +LEKLM K+G F  L++LP    ++  +   YK     + L    R + +C  ++G            +P  P  E+ M  +  +L  G +  +W+   K
Sbjct:   11 FIPLATGSIFDQAVKGKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQA---VTSCKSVCEQVKADCFSILEE-FGIGWPEPLNCAQFPDPPELCMKP--------------TEDEITGGFSAPRLPTKGSSSSSSKPT--GCPSDLVDVD--------PHDPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTR-----GTDTSKLEKLMVKMGFFCALFILP---NVIELVCQCYKF----MILTQWTRMTIDCKQQSG---------ACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAK 497          
BLAST of frizzled receptor-like protein vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 245.358 bits (625), Expect = 7.685e-72
Identity = 154/536 (28.73%), Postives = 252/536 (47.01%), Query Frame = 2
Query:  119 FINIINGRRFGDIYK-QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            FI +  G  F    K +C+PI    C+D+ Y+ T  PN +    Q         F PL+  KC  ++  F+CSV+ PMC      +   V  C+ +C  VK  C  +++E F + W E L+C +FP+  ++C+ P               ED     +   +L  +G+    SK       SD+V              P   CA  C +NV F+  +K     W + ++       L + + F+ +  RF +PE+ + +LS+C F  +   L    +   + +C A  +   ++     + ++C  +FL+ YFF +A+ALWW++ + T +LS  R W  E IE+ SS +H V+W + +L +I +LI +K+DA ELT  C VGN N+  L  FVIVP  I + IG  F+  G+ S+ + R SF  R       +  +LEKLM K+G F  L++LP    ++  +   YK     + L    R + +C  ++G            +P  P  E+ M  +  +L  G +  +W+   K
Sbjct:   11 FIPLATGSIFDQAVKGKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQA---VTSCKSVCEQVKADCFSILEE-FGIGWPEPLNCAQFPDPPELCMKP--------------TEDEITGGFSAPRLPTKGSSSSSSKPT--GCPSDLVDVD--------PHDPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTR-----GTDTSKLEKLMVKMGFFCALFILP---NVIELVCQCYKF----MILTQWTRMTIDCKQQSG---------ACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAK 497          
BLAST of frizzled receptor-like protein vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 245.358 bits (625), Expect = 7.685e-72
Identity = 154/536 (28.73%), Postives = 252/536 (47.01%), Query Frame = 2
Query:  119 FINIINGRRFGDIYK-QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            FI +  G  F    K +C+PI    C+D+ Y+ T  PN +    Q         F PL+  KC  ++  F+CSV+ PMC      +   V  C+ +C  VK  C  +++E F + W E L+C +FP+  ++C+ P               ED     +   +L  +G+    SK       SD+V              P   CA  C +NV F+  +K     W + ++       L + + F+ +  RF +PE+ + +LS+C F  +   L    +   + +C A  +   ++     + ++C  +FL+ YFF +A+ALWW++ + T +LS  R W  E IE+ SS +H V+W + +L +I +LI +K+DA ELT  C VGN N+  L  FVIVP  I + IG  F+  G+ S+ + R SF  R       +  +LEKLM K+G F  L++LP    ++  +   YK     + L    R + +C  ++G            +P  P  E+ M  +  +L  G +  +W+   K
Sbjct:   11 FIPLATGSIFDQAVKGKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQA---VTSCKSVCEQVKADCFSILEE-FGIGWPEPLNCAQFPDPPELCMKP--------------TEDEITGGFSAPRLPTKGSSSSSSKPT--GCPSDLVDVD--------PHDPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTR-----GTDTSKLEKLMVKMGFFCALFILP---NVIELVCQCYKF----MILTQWTRMTIDCKQQSG---------ACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAK 497          
BLAST of frizzled receptor-like protein vs. Ensembl Fly
Match: fz (gene:FBgn0001085 transcript:FBtr0075743)

HSP 1 Score: 269.626 bits (688), Expect = 1.553e-80
Identity = 168/543 (30.94%), Postives = 260/543 (47.88%), Query Frame = 2
Query:  158 YKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPS------EVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDF--------IVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSV----EMRMLRIFMNLVIGITSGIWIWGNKKTV 1732
            + +C PI    C+++ Y+ T MPNL+G   Q EA      F PL+ I CS+ L+LFLCS+Y P+C    ++    + PCR LC   +  CE LMK T+   W E L+C KFP  G           ++     N+   +         +     R  Q+ +E   +    V    L +      E+ +G      C   C A + F   ++     W+  W+ +C  SCL T++ F  +++RF YPE+ IVFL++CY       + G   G +V     F              I    R+TT C + F+ +YF   A+  WW  L   WFL+A   WG+EAIE+ S + HLV+WA+PAL++I +L L K++ D L+G CFVG  +   L  F+I+P  IYL IG +FL  G+ISL ++R          D     +LE+LM +IG FS L++LP +  +     + Y    + I              R+     SI C     P  P      ++ M++   ++++G+TS +W++ +K  V
Sbjct:   50 HNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC----TILERPIPPCRSLCESARV-CEKLMK-TYNFNWPENLECSKFPVHGG----------EDLCVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMGYELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAGDSVSCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMKT-----DGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWH-----------RDICKPFSIPCPAARAPGSPEARPIFQIFMVKYLCSMLVGVTSSVWLYSSKTMV 559          
BLAST of frizzled receptor-like protein vs. Ensembl Fly
Match: fz (gene:FBgn0001085 transcript:FBtr0330102)

HSP 1 Score: 270.011 bits (689), Expect = 2.383e-80
Identity = 168/543 (30.94%), Postives = 260/543 (47.88%), Query Frame = 2
Query:  158 YKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPS------EVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDF--------IVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSV----EMRMLRIFMNLVIGITSGIWIWGNKKTV 1732
            + +C PI    C+++ Y+ T MPNL+G   Q EA      F PL+ I CS+ L+LFLCS+Y P+C    ++    + PCR LC   +  CE LMK T+   W E L+C KFP  G           ++     N+   +         +     R  Q+ +E   +    V    L +      E+ +G      C   C A + F   ++     W+  W+ +C  SCL T++ F  +++RF YPE+ IVFL++CY       + G   G +V     F              I    R+TT C + F+ +YF   A+  WW  L   WFL+A   WG+EAIE+ S + HLV+WA+PAL++I +L L K++ D L+G CFVG  +   L  F+I+P  IYL IG +FL  G+ISL ++R          D     +LE+LM +IG FS L++LP +  +     + Y    + I              R+     SI C     P  P      ++ M++   ++++G+TS +W++ +K  V
Sbjct:   50 HNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVC----TILERPIPPCRSLCESARV-CEKLMK-TYNFNWPENLECSKFPVHGG----------EDLCVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMGYELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAGDSVSCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMK-----TDGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWH-----------RDICKPFSIPCPAARAPGSPEARPIFQIFMVKYLCSMLVGVTSSVWLYSSKTMV 559          
BLAST of frizzled receptor-like protein vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0112890)

HSP 1 Score: 234.958 bits (598), Expect = 9.356e-67
Identity = 136/356 (38.20%), Postives = 186/356 (52.25%), Query Frame = 2
Query:  698 NIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQP-VLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFW 1762
             I   PN  C   C     F+  +K FA +W+  WS LCF S L+T+  F  +T RF YPE+PIVFLS CYF  A G L    L    +AC         +  S      C + FL+ YFFG AS++WWV+L+ TWFL+A   WG EAI   S   HL +W IP ++S+ +L+L  +D D + G C+VGN N   L  FV+ P  +YL IG  FL  G++SL ++R    Q+          +LEKLM +IG+FS+LY +P    I  Y+   Y+   F+  +KAL                +  C ++  P   P   + ML+ FM L +GITSG+WIW      K+  S  RFW
Sbjct:  293 RIAGVPN--CGIPCKGPF-FSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGL-----LLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYL---YEAAYFEDWIKAL----------------ACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSG----KTLESWRRFW 617          

HSP 2 Score: 83.9593 bits (206), Expect = 2.244e-16
Identity = 43/127 (33.86%), Postives = 65/127 (51.18%), Query Frame = 2
Query:  164 QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK---ICLTPDSFSQ 535
            +C  I  P C+ + Y+ TS PN +   +Q EA      F PL+ IKCS  LK FLCS+Y P+C  D       +  CR +C   +  C P+M++ +   W E + CE  P  G    +C+   S+++
Sbjct:   63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDY---HKPLPVCRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHGDPDNLCMEQPSYTE 185          
BLAST of frizzled receptor-like protein vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0075029)

HSP 1 Score: 234.958 bits (598), Expect = 9.356e-67
Identity = 136/356 (38.20%), Postives = 186/356 (52.25%), Query Frame = 2
Query:  698 NIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQP-VLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFW 1762
             I   PN  C   C     F+  +K FA +W+  WS LCF S L+T+  F  +T RF YPE+PIVFLS CYF  A G L    L    +AC         +  S      C + FL+ YFFG AS++WWV+L+ TWFL+A   WG EAI   S   HL +W IP ++S+ +L+L  +D D + G C+VGN N   L  FV+ P  +YL IG  FL  G++SL ++R    Q+          +LEKLM +IG+FS+LY +P    I  Y+   Y+   F+  +KAL                +  C ++  P   P   + ML+ FM L +GITSG+WIW      K+  S  RFW
Sbjct:  293 RIAGVPN--CGIPCKGPF-FSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGL-----LLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYL---YEAAYFEDWIKAL----------------ACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSG----KTLESWRRFW 617          

HSP 2 Score: 83.9593 bits (206), Expect = 2.244e-16
Identity = 43/127 (33.86%), Postives = 65/127 (51.18%), Query Frame = 2
Query:  164 QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK---ICLTPDSFSQ 535
            +C  I  P C+ + Y+ TS PN +   +Q EA      F PL+ IKCS  LK FLCS+Y P+C  D       +  CR +C   +  C P+M++ +   W E + CE  P  G    +C+   S+++
Sbjct:   63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDY---HKPLPVCRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHGDPDNLCMEQPSYTE 185          
BLAST of frizzled receptor-like protein vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0332735)

HSP 1 Score: 234.958 bits (598), Expect = 9.356e-67
Identity = 136/356 (38.20%), Postives = 186/356 (52.25%), Query Frame = 2
Query:  698 NIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQP-VLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFW 1762
             I   PN  C   C     F+  +K FA +W+  WS LCF S L+T+  F  +T RF YPE+PIVFLS CYF  A G L    L    +AC         +  S      C + FL+ YFFG AS++WWV+L+ TWFL+A   WG EAI   S   HL +W IP ++S+ +L+L  +D D + G C+VGN N   L  FV+ P  +YL IG  FL  G++SL ++R    Q+          +LEKLM +IG+FS+LY +P    I  Y+   Y+   F+  +KAL                +  C ++  P   P   + ML+ FM L +GITSG+WIW      K+  S  RFW
Sbjct:  293 RIAGVPN--CGIPCKGPF-FSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGL-----LLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYL---YEAAYFEDWIKAL----------------ACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSG----KTLESWRRFW 617          

HSP 2 Score: 83.9593 bits (206), Expect = 2.244e-16
Identity = 43/127 (33.86%), Postives = 65/127 (51.18%), Query Frame = 2
Query:  164 QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK---ICLTPDSFSQ 535
            +C  I  P C+ + Y+ TS PN +   +Q EA      F PL+ IKCS  LK FLCS+Y P+C  D       +  CR +C   +  C P+M++ +   W E + CE  P  G    +C+   S+++
Sbjct:   63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDY---HKPLPVCRSVCERARSGCAPIMQQ-YSFEWPERMACEHLPLHGDPDNLCMEQPSYTE 185          
BLAST of frizzled receptor-like protein vs. Ensembl Zebrafish
Match: fzd10 (frizzled class receptor 10 [Source:ZFIN;Acc:ZDB-GENE-990415-220])

HSP 1 Score: 372.089 bits (954), Expect = 2.566e-119
Identity = 214/552 (38.77%), Postives = 318/552 (57.61%), Query Frame = 2
Query:   95 LILICISGF---INIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK---ICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSK-LEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQ--FNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            L L+C +GF   I+ I+  R G+   +C  I  P C+D+ Y+ T MPNL+G   Q EA+ +  +F PLI   C ++LK FLCS+Y PMC   T   S+ +  CR +C   +++C P+M E F   W E LDC + P +     +C+   +   DE  PP  S   S            +  R G S+ L I +++     +   P + +  Q    SCA  C +NV   ++  DK F+ +W+  WS+LCF S   T++ F  +  RF YPE+PI+FLS+ Y  Y+ G L    +G   VAC   +    +I+  G E+T C I FL++Y+FG AS+LWWV+LT+TWFL+A + WG+EAIE+ SS  HL +WAIPA+K+I IL++ K+  DELTG C+VG+ + K L GFV++P   YL IG  FL  G+++L  +R+         +  N  +LEKLM +IGVFS+LY +P  C I  Y  +   M  + I L    + + +  G++G      +CV  ++  +P+VE+ M++IFM LV+GITSG+WIW +K
Sbjct:   10 LGLLCFAGFCSAISSIDPDRPGE--GRCQEIAIPLCKDIGYNLTVMPNLMGHEDQNEAAIKLHEFAPLIEFGCHSHLKFFLCSLYAPMC---TEQVSTPIPACRVMCEQARQKCSPIM-EQFNFHWPESLDCSRLPNKNDPNYLCMEAPNNGTDE--PPKGSHTQSPDS---------RPPRPGNSQELPIKERVGKTTCSN--PGKFHYVQKSE-SCAPKCYSNVDVYWSQGDKRFSMVWIAIWSILCFISSAFTVLTFLIDPQRFKYPERPIIFLSMSYCVYSVGFLVRLFVGVENVACDR-DTGVQYIIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAIKTIMILVMRKVAGDELTGVCYVGSMDVKALTGFVLIPLSCYLIIGTSFLLSGFVALFHIRKVMKT-----EGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKI-LAGEQKCADD--GKSG-----EECV--MKSSIPAVEIFMVKIFMLLVVGITSGMWIWTSK 525          
BLAST of frizzled receptor-like protein vs. Ensembl Zebrafish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 357.836 bits (917), Expect = 7.419e-114
Identity = 196/525 (37.33%), Postives = 289/525 (55.05%), Query Frame = 2
Query:  164 QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFP---ERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQIC--SANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            +C PI  P CQ + Y+ T MPNL+   SQ EAS +  +F PL+   C  +L+ FLCS+Y PMC    S S   +  CR +C   ++RC P+M E F  +W + LDC K P   +   +C+      +++  P     E       R  Q      RI              +   C   E       + SCA  C  + +V ++  DK FA IW++ WS LCF S   T++ F  +  RF YPE+PI+FLS+CY  Y+   +  ++ G   +AC   N +  +I+  G E+T C I FL++Y+FG AS++WWV+LT+TWFL+A R WG+EAIE+ SS  H+ +W IPA+K+I IL + K+  DELTG C+VG+ ++  L GFV++P   YL +G  F+  G+++L  +R+            N ++LEKLM KIGVFSILY +P    I+ Y  +   M  +    +AL     +  GR   + S       L   +P+V + ML+IFM+LV+GITSG+W+W +K
Sbjct:   35 KCEPITIPMCQGIGYNMTRMPNLLNYESQEEASIKLNEFAPLVKYGCDIHLQFFLCSLYVPMCAEQVSAS---IPACRPMCEQARQRCSPIM-EQFSFSWPDSLDCSKLPTNNDPNALCIEA---PENDTQPETKKGEGMLPVPPRSRQPTTVSGRISS------------ISQSCENPEKFQYVDKSESCAPRCTPTVDVYWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQRFQYPERPIIFLSMCYNIYSVAFIIRSVAGAENIACDRENGEL-YIIREGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMAAWGIPAVKTIVILTMRKVAGDELTGLCYVGSMDSSALTGFVLIPLSCYLIVGTSFILTGFVALFHIRKIMKT-----GGTNTEKLEKLMVKIGVFSILYTVPATIVIICYFYERLNMEYWK--FRALENKCVSFPGRRSDDCS-------LDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSK 525          
BLAST of frizzled receptor-like protein vs. Ensembl Zebrafish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 357.451 bits (916), Expect = 1.180e-113
Identity = 196/525 (37.33%), Postives = 289/525 (55.05%), Query Frame = 2
Query:  164 QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFP---ERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQIC--SANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            +C PI  P CQ + Y+ T MPNL+   SQ EAS +  +F PL+   C  +L+ FLCS+Y PMC    S S   +  CR +C   ++RC P+M E F  +W + LDC K P   +   +C+      +++  P     E       R  Q      RI              +   C   E       + SCA  C  + +V ++  DK FA IW++ WS LCF S   T++ F  +  RF YPE+PI+FLS+CY  Y+   +  ++ G   +AC   N +  +I+  G E+T C I FL++Y+FG AS++WWV+LT+TWFL+A R WG+EAIE+ SS  H+ +W IPA+K+I IL + K+  DELTG C+VG+ ++  L GFV++P   YL +G  F+  G+++L  +R+            N ++LEKLM KIGVFSILY +P    I+ Y  +   M  +    +AL     +  GR   + S       L   +P+V + ML+IFM+LV+GITSG+W+W +K
Sbjct:   36 KCEPITIPMCQGIGYNMTRMPNLLNYESQEEASIKLNEFAPLVKYGCDIHLQFFLCSLYVPMCAEQVSAS---IPACRPMCEQARQRCSPIM-EQFSFSWPDSLDCSKLPTNNDPNALCIEA---PENDTQPETKKGEGMLPVPPRSRQPTTVSGRISS------------ISQSCENPEKFQYVDKSESCAPRCTPTVDVYWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQRFQYPERPIIFLSMCYNIYSVAFIIRSVAGAENIACDRENGEL-YIIREGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMAAWGIPAVKTIVILTMRKVAGDELTGLCYVGSMDSSALTGFVLIPLSCYLIVGTSFILTGFVALFHIRKIMKT-----GGTNTEKLEKLMVKIGVFSILYTVPATIVIICYFYERLNMEYWK--FRALENKCVSFPGRRSDDCS-------LDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSK 526          
BLAST of frizzled receptor-like protein vs. Ensembl Zebrafish
Match: BX322606.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_52:56018527:56021879:1 gene:ENSDARG00000102815.2 transcript:ENSDART00000169635.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX322606.1)

HSP 1 Score: 357.451 bits (916), Expect = 1.466e-113
Identity = 196/525 (37.33%), Postives = 289/525 (55.05%), Query Frame = 2
Query:  164 QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFP---ERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQIC--SANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            +C PI  P CQ + Y+ T MPNL+   SQ EAS +  +F PL+   C  +L+ FLCS+Y PMC    S S   +  CR +C   ++RC P+M E F  +W + LDC K P   +   +C+      +++  P     E       R  Q      RI              +   C   E       + SCA  C  + +V ++  DK FA IW++ WS LCF S   T++ F  +  RF YPE+PI+FLS+CY  Y+   +  ++ G   +AC   N +  +I+  G E+T C I FL++Y+FG AS++WWV+LT+TWFL+A R WG+EAIE+ SS  H+ +W IPA+K+I IL + K+  DELTG C+VG+ ++  L GFV++P   YL +G  F+  G+++L  +R+            N ++LEKLM KIGVFSILY +P    I+ Y  +   M  +    +AL     +  GR   + S       L   +P+V + ML+IFM+LV+GITSG+W+W +K
Sbjct:   48 KCEPITIPMCQGIGYNMTRMPNLLNYESQEEASIKLNEFAPLVKYGCDIHLQFFLCSLYVPMCAEQVSAS---IPACRPMCEQARQRCSPIM-EQFSFSWPDSLDCSKLPTNNDPNALCIEA---PENDTQPETKKGEGMLPVPPRSRQPTTVSGRISS------------ISQSCENPEKFQYVDKSESCAPRCTPTVDVYWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQRFQYPERPIIFLSMCYNIYSVAFIIRSVAGAENIACDRENGEL-YIIREGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMAAWGIPAVKTIVILTMRKVAGDELTGLCYVGSMDSSALTGFVLIPLSCYLIVGTSFILTGFVALFHIRKIMKT-----GGTNTEKLEKLMVKIGVFSILYTVPATIVIICYFYERLNMEYWK--FRALENKCVSFPGRRSDDCS-------LDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSK 538          
BLAST of frizzled receptor-like protein vs. Ensembl Zebrafish
Match: fzd9b (frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GENE-000906-4])

HSP 1 Score: 353.214 bits (905), Expect = 4.518e-112
Identity = 194/523 (37.09%), Postives = 292/523 (55.83%), Query Frame = 2
Query:  164 QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQ--FNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDI-TLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            +C PI  P CQ + Y+ T MPN +   +Q EA+ +  +F PL+   C  +L+ FLCS+Y PMC   T   S+++  CR +C   +++C P+M E F   W E L+C K P R      P++   +    P N  +   +     L +  +  + G        +    +G    P +    +    +CA  CS+ V   ++  DK FA IW+  WS LCF S   T++ F  + +RF YPE+PI+FLS+CY  Y+   +  ++ G   +AC   N +  +I+  G E+T C I FL++Y+FG AS++WWV+LT+TWFL+A + WG+EAIES SS  H+ +W IPALK+I IL + K+  DELTG C+VG+ +   L GFV+VP   YL IG  F+  G+++L  +R+         +  N ++LEKLM KIG++SILY +P  C I+ Y    Y+  N D    + L        GR   + S       L   +P+V + ML+IFM+LV+GITSG+W+W +K
Sbjct:   37 KCEPIVIPMCQGIGYNLTRMPNFMDHDNQREAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMC---TDQVSTSIPACRPMCEQARQKCSPIM-EKFNYAWPESLNCSKLPTRND----PNALCMEA---PENDTKTETKKGEGMLPVPPRPRQPGAGN----ARSGGTMGVCENPEKFQYVEKSE-TCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRENGEL-YIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSCYLVIGTSFILTGFVALFHIRKVMKT-----EGTNTEKLEKLMVKIGIYSILYTVPATCVIICYF---YERLNMDYWKFRGLQSKCTTFPGRRNEDCS-------LDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSK 527          
BLAST of frizzled receptor-like protein vs. Ensembl Xenopus
Match: FZD9 (frizzled class receptor 9 [Source:NCBI gene;Acc:100487936])

HSP 1 Score: 365.54 bits (937), Expect = 7.563e-117
Identity = 199/542 (36.72%), Postives = 298/542 (54.98%), Query Frame = 2
Query:  104 ICISGFINIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQIC--SANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            +C  G  ++  GR       +C PI+ P CQ + Y+ T MPN VG  SQ EA+ + ++F PL+   C  +L+ FLCS+Y PMC   T   S+++  C+ +C   +++C P+M E+F+  W E LDC++ P +      P +   +   P   +  D   + +  L +  +  R   S + I  + ++       P +    +   + CA  C    +V +++ DK FA +W+  WS LCF S   T+  F  +  RF YPEKPI+FLS+CY  Y++  L  A  G   +AC        +++  G E++ C + FL++Y+FG AS+LWWVVLT+TWFL+AS+ WG+EAIES  S  HL +W IPA+K+I IL + K+  DELTG C+VG S+   L GFV+VP   YL  G  FL  G+++L  +RR            N ++LEKLM KIGVFSILY +P  C IV    +   + ++D   +     +     R   N         L   +PSV + ML+IFM+L +GITSG+W+W +K
Sbjct:   12 LCPMGLYDVERGRE-----AKCEPIQIPMCQGIGYNMTRMPNYVGHESQEEAAAKLQEFAPLVEYGCHIHLRFFLCSLYAPMC---TEQVSTSIPACKPMCEAARQKCAPIM-ESFQYVWPESLDCDRLPSKND----PHALCMEA--PENATNGDPPTNGHGMLPVAPRPPRPSGSGIGISSRCAN-------PDKFMYVERSGV-CAPRCIPGVDVYWSSGDKDFALVWMAAWSGLCFISTAFTVFTFLLHPQRFQYPEKPIIFLSMCYNVYSTAFLIRAAAGAPSIACDR-EGGAPYLIREGLESSGCTLVFLILYYFGMASSLWWVVLTLTWFLAASKKWGHEAIESHGSYFHLAAWGIPAIKTIIILTMRKVGGDELTGLCYVGGSDPSALTGFVLVPLSCYLVTGTSFLLTGFVALFHIRRVMK-----TGGTNTEKLEKLMVKIGVFSILYTVPATCIIVCCFYERLNLAHWDSRAREESCRTVPGSARPDCN---------LPHSIPSVAVFMLKIFMSLAVGITSGVWVWSSK 515          
BLAST of frizzled receptor-like protein vs. Ensembl Xenopus
Match: FZD4 (frizzled class receptor 4 [Source:NCBI gene;Acc:100497693])

HSP 1 Score: 347.051 bits (889), Expect = 2.557e-110
Identity = 202/548 (36.86%), Postives = 295/548 (53.83%), Query Frame = 2
Query:   98 ILICISGFINIINGRRFGDIY-KQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQ----TPNISCAQICSANVQ-FNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            +L C+ G I       FGD   ++C PI+   CQ++ Y+ T MPNLVG   Q +A  +   F PLI   CS+ L+ FLCSVY PMC    ++    + PC  +C  VK RCEP++KE F   W E L+C KFP                   P N              + M+G   G  ++ ++ K   + G  C     N  Q      +++C   C  +   ++   K F +IW+  W+ LCF S   T++ F  +++RF YPE+PI+FLS+CY  Y+   +    +GR  ++C         ++  G + T C I FL++YFFG AS++WWV+LT+TWFL+A   WG+EAIE  SS  H+ +WAIPA+K+I ILI+  +DADELTG C+VGN N   L GFV+ P   YL IG +F+  G ++L K+ RS LQ+    D     +LE+LM KIGVFS+LY +P  C I  Y    Y+++N+++     FR++ +                       ++ + ML IFM+L++GITSG+WIW  K
Sbjct:   12 LLGCLVGHI-----AGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIP---IGPCGGMCLSVKRRCEPVLKE-FGFAWPESLNCSKFP-------------------PQNDHN----------HMCMEGP--GDDEVPVHSKTPVLPGEDCNSFGPNSDQYTWVKRSMNCVLKCGYDSGLYSRLSKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFCYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNIDALTGFVVAPLFTYLVIGTLFIAAGLVALFKI-RSNLQK----DGTKTDKLERLMVKIGVFSVLYTVPATCVIACYF---YEISNWNV-----FRYTAD---------------------DSNMAVEMLNIFMSLLVGITSGMWIWSAK 485          
BLAST of frizzled receptor-like protein vs. Ensembl Xenopus
Match: fzd8 (frizzled class receptor 8 [Source:NCBI gene;Acc:100038274])

HSP 1 Score: 321.627 bits (823), Expect = 7.533e-100
Identity = 188/535 (35.14%), Postives = 266/535 (49.72%), Query Frame = 2
Query:  167 CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFH--PPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQC-------------LPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVAC-RAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            C  I  P C+D+ Y+ T MPN     +Q EA      F PL+ I CS  LK FLCS+Y P+C  D       + PCR +C   +  C PLM++ +   W + + C++ PE+G     PD+   D ++      +     +      +   +G    +      +      G QC             L + V  GQ PN  CA  C  N  F+  ++ F   W+  WSVLCF S   T+  F  +  RF YPE+PI+FLS CY   ++G L   I G   VAC R   D    I         C + FL+IYFFG AS++WWV+L++TWFL+A   WG EAI   S   HL +W +P++KSI +L L  +D D + G CFVGN N   L GFV+ P +IYLFIG +FL  G++SL ++R    Q           +LEKLM +IG+FS+LY +P    +  +  + +    +++        + NC   N          E+ QP  P   + ML+ FM LV+GITSG+WIW  K
Sbjct:   27 CQEITVPLCKDIGYNYTYMPNQFNHDTQDEAGMEVHQFWPLVVIHCSPDLKFFLCSMYTPICLEDYK---KPLPPCRSVCERARAGCAPLMRQ-YGFAWPDRMRCDRLPEQGN----PDTLCMDYYNRTEQTTAAPSHPEPPKPPARSAPKGRTRVEPPRPRPRAPGCEPGCQCRAPMVPVTNERHPLYNRVRTGQIPN--CAMPCH-NPYFSPEERTFTEFWIGLWSVLCFASTFATVSTFLIDMERFKYPERPIIFLSACYLLVSAGYLVRLIAGHEKVACSRGELDLEHIIHYETTGPALCTLVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSIKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVIYLFIGSMFLLAGFVSLFRIRSVIKQ-----GGTKTDKLEKLMIRIGIFSVLYTVPATIVVACFFYEQHNRQGWEV--------AHNC---NSCQ------PEVAQPRRPDYAVFMLKYFMCLVVGITSGVWIWSGK 528          
BLAST of frizzled receptor-like protein vs. Ensembl Xenopus
Match: ntrk1 (neurotrophic receptor tyrosine kinase 1 [Source:Xenbase;Acc:XB-GENE-923001])

HSP 1 Score: 319.316 bits (817), Expect = 2.766e-99
Identity = 190/532 (35.71%), Postives = 272/532 (51.13%), Query Frame = 2
Query:  167 CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERG--KICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQC-----LPSEVNIGQTPNISCAQICSAN----VQFNAHDKV-FANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVL-PSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            C PI  P C D+ Y+ T MPNL+G  +Q +A      F PL+ ++CS+ L+ FLCS+Y P+C    ++    + PCR +C   +  CE LM + F   W E L CE FP  G  +IC+              N  ED    L     L       G     IY  +       C     +PS +N        CA  C  +      F + D++ FA +W+L WSVLC  S   T+  +  +  RF YPE+PI+FLS CY   +   + G +LG  VV    F++     V  G +   C I F+M+YFF  AS++WWV+L++TWFL+A   WG+EAIE+ S   HL +WA+PA+K+I IL + +ID D L+G CFVG +N   L GFV+ P  +YLFIG  FL  G++SL ++R          D    ++LE+LM +IGVFS+LY +P    I  Y  +     +++ +       S NC         +I C     P + P   + M++  M L++GITSG WIW  K
Sbjct:   40 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSSELRFFLCSMYAPVC----TVLEQAIPPCRSICERARHGCEALMNK-FGFQWPERLRCENFPRHGAEQICVG------------QNHSEDGGPTL-----LTTSPPHHGTPGPPIYATLDHPF--HCPRVLKVPSYLNYRFLGEKDCAAPCEPSKNDGFMFFSQDEIRFARVWILIWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLGDKVVCNENFSEDGYKTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNNIDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSW-----VSQNCKSL------AIPCPLQYTPRMTPDFTVYMIKYLMTLIVGITSGFWIWSGK 531          
BLAST of frizzled receptor-like protein vs. Ensembl Xenopus
Match: zdhhc9 (zinc finger DHHC-type containing 9 [Source:Xenbase;Acc:XB-GENE-1016830])

HSP 1 Score: 316.235 bits (809), Expect = 4.558e-98
Identity = 187/520 (35.96%), Postives = 262/520 (50.38%), Query Frame = 2
Query:  167 CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQK-MSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            C  I  P C+ + Y++T MPN     +Q EA      F PL+ I+CS  LK FLCS+Y P+C  D       + PCR +C   K  C PLM++ +   W E ++C++ PE G     PD+   D      N  E +          V   +       +  +  +S    +  L + +  GQ PN  CA  C     F   +K FA  W+  WS+LCF S   T+  F  +  RF YPE+PI+FLS CY F + G +   I+G   VAC       D I         C + FL+IYFFG AS++WWV+LT TWFL+A   WG EAI S S   H+ +W IP++KSI +L L  +D D + G CFVGN N   L GFV+ P ++YLF G +FL  G++SL ++R    Q     D     +LEKLM +IG+FS+LY +P    +  YI + +   +++         + NC            C    +   P   + ML+ FM LV+GITSG+WIW  K
Sbjct:   33 CQEITVPMCKGIGYNHTYMPNQFNHDTQDEAGMEVHQFWPLVVIQCSLDLKFFLCSMYTPICLPDYR---KPLPPCRSVCERAKAGCSPLMRK-YGFAWPERMNCDRLPEHGD----PDTLCMDY-----NWTETTTTPPPTHPPKVKTPSSDCDGVCKCREPFLSITRESHPLYNRIKTGQVPN--CAMPC-FQPYFTQDEKTFATFWIGLWSILCFISTFTTVATFLIDMERFRYPERPIIFLSACYLFVSIGYIVRLIVGHENVAC-----NKDHIHYETTGPALCTVVFLLIYFFGMASSIWWVILTFTWFLAAGMKWGNEAIASYSQYFHMAAWLIPSVKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVVYLFTGTMFLLAGFVSLFRIRSVIKQGGTKTD-----KLEKLMIRIGIFSVLYTVPATIVVACYIYEQHYREHWEK--------AHNC-----------SCPGDKKRYRPDYAVFMLKYFMCLVVGITSGVWIWSGK 507          
BLAST of frizzled receptor-like protein vs. Ensembl Mouse
Match: Fzd10 (frizzled class receptor 10 [Source:MGI Symbol;Acc:MGI:2136761])

HSP 1 Score: 360.147 bits (923), Expect = 1.154e-114
Identity = 205/569 (36.03%), Postives = 314/569 (55.18%), Query Frame = 2
Query:   92 VLILICISGFINIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK---ICLTPDSFSQDE-----------FHP--PANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICS--ANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYI-----VDAYKM--TNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            V+I  C +  I+ ++  R GD   +C P++ P C+D+ Y+ T MPNL+G  +Q EA+ +  +F PL+   C ++L+ FLCS+Y PMC   T   S+ +  CR +C   + +C P+M E FK  W + LDC K P +     +C+   +   DE           F P  P ++QE   +D              G++  +   K   +  ++              SCA +C+   +V ++  DK FA +WL  WSVLCFFS   T++ F  + +RF YPE+PI+FLS+CY  Y+ G +     G   +AC   + +  +++  G E+T C + FL++Y+FG AS+LWWVVLT+TWFL+A + WG+EAIE+ SS  HL +WAIPA+K+I IL++ ++  DELTG C+VG+ +   L GFV+VP   YL IG  F+  G+++L  +RR            N  +LEKLM +IGVFS+LY +P  C I  Y      +D +KM  T     +    + +P+C+    I               P+VE+ M+++ M LV+GITSG+W+W +K
Sbjct:   14 VMIGSCTA--ISSMDLERPGD--GKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMC---TEQVSTPIPACRVMCEQARLKCSPIM-EQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGSGMFPPLFRPQRPHSAQEHPLKD-----------GGPGRAGCDNPGKFHHVEKSE--------------SCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQHKCKMNNQTK-TPDCLMTTSI---------------PAVEVFMVKVSMLLVVGITSGVWVWTSK 527          
BLAST of frizzled receptor-like protein vs. Ensembl Mouse
Match: Fzd4 (frizzled class receptor 4 [Source:MGI Symbol;Acc:MGI:108520])

HSP 1 Score: 350.903 bits (899), Expect = 1.146e-111
Identity = 200/532 (37.59%), Postives = 290/532 (54.51%), Query Frame = 2
Query:  146 FGDIY-KQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQ----TPNISCAQICSANVQ-FNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            FGD   ++C PI+   CQ++ Y+ T MPNLVG   QT+A  +   F PLI   CS+ L+ FLCSVY PMC    ++    + PC  +C  VK RCEP+++E F   W + L+C KFP                   P N              + M+G   G  ++ +  K     G +C     N  Q      +++C   C  +   ++   K F +IW+  W+ LCF S   T++ F  +++RF YPE+PI+FLS+CY  Y+   +    +GR  ++C         ++  G + T C I FL++YFFG AS++WWV+LT+TWFL+A   WG+EAIE  SS  H+ +WAIPA+K+I ILI+  +DADELTG C+VGN N   L GFV+ P   YL IG +F+  G ++L K+ RS LQ+    D     +LE+LM KIGVFS+LY +P  C I  Y    Y+++N+     ALFR+S +                       ++ + ML+IFM+L++GITSG+WIW  K
Sbjct:   37 FGDEEERRCDPIRIAMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIP---IGPCGGMCLSVKRRCEPVLRE-FGFAWPDTLNCSKFP-------------------PQNDHN----------HMCMEGP--GDEEVPLPHKTPIQPGEECHSVGSNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTTFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKI-RSNLQK----DGTKTDKLERLMVKIGVFSVLYTVPATCVIACYF---YEISNW-----ALFRYSAD---------------------DSNMAVEMLKIFMSLLVGITSGMWIWSAK 499          
BLAST of frizzled receptor-like protein vs. Ensembl Mouse
Match: Fzd9 (frizzled class receptor 9 [Source:MGI Symbol;Acc:MGI:1313278])

HSP 1 Score: 352.058 bits (902), Expect = 2.217e-111
Identity = 194/522 (37.16%), Postives = 280/522 (53.64%), Query Frame = 2
Query:  167 CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQ--FNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDI-TLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            C  ++ P C+ + Y+ T MPNL+G  SQ EA+ +  +F+PL+   C ++L+ FLCS+Y PMC   T   S+ +  CR +C   + RC P+M E F   W + LDC + P R      P +   +          + ++ L             G S            G  C   E       + SCA  C   V+  ++  DK FA +W+  WS LCFFS   T+  F    +RF YPE+PI+FLS+CY  Y+   L  A+ G   VAC        +++  G E T C + FL++Y+FG AS+LWWVVLT+TWFL+A + WG+EAIE+  S  H+ +W +PALK+I +L L K+  DELTG C+V + +   L GFV+VP   YL +G  FL  G+++L  +R+            N ++LEKLM KIGVFSILY +P  C IV Y+   Y+  N D   L+A  +         G    S+    +     P+V + ML+IFM+LV+GITSG+W+W +K
Sbjct:   40 CQAMEIPMCRGIGYNLTRMPNLLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMC---TDQVSTPIPACRPMCEQARLRCAPIM-EQFNFGWPDSLDCARLPTRND----PHALCMEAPENATAGPTEPHKGLGMLPVAPRPARPPGDSA------PGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQ-EAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMK-----TGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYV---YERLNMDFWRLRATEQPCTAATVPGGRRDCSLPGGSV-----PTVAVFMLKIFMSLVVGITSGVWVWSSK 533          
BLAST of frizzled receptor-like protein vs. Ensembl Mouse
Match: Fzd7 (frizzled class receptor 7 [Source:MGI Symbol;Acc:MGI:108570])

HSP 1 Score: 323.939 bits (829), Expect = 6.111e-101
Identity = 183/540 (33.89%), Postives = 275/540 (50.93%), Query Frame = 2
Query:  167 CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERG--KICL-------------TPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDM----VGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDIT--LKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            C PI  P C D+ Y+ T +PNL+G  +Q +A      F PL+ ++CS  L+ FLCS+Y P+C    ++    + PCR LC   ++ CE LM + F   W E L CE FP  G  +IC+             +P ++    + P       S  D   +L       R  Q K+  Y     +     GA C P   N                + F   ++ FA +W+  WSVLC  S L T++ +  +  RF YPE+PI+FLS CYF  A  ++ G +L    V    F+D     V  G +   C I F+++YFFG AS++WWV+L++TWFL+A   WG+EAIE+ S   HL +WA+PA+K+I IL + ++D D L+G C+VG S+   L GFV+ P  +YLFIG  FL  G++SL ++R          D    ++LEKLM +IGVFS+LY +P    +  Y  +     +++ T  L+    ++  C   +              P+ P   + M++  M +++GIT+G WIW  K
Sbjct:   49 CQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC----TVLDQAIPPCRSLCERARQGCEALMNK-FGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGSPTAYPTAPYLPDPPFTAMSPSDGRGRLSFPFSCPR--QLKVPPYLGYRFLGERDCGAPCEPGRAN--------------GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGH------------FSPMSPDFTVFMIKYLMTMIVGITTGFWIWSGK 550          
BLAST of frizzled receptor-like protein vs. Ensembl Mouse
Match: Fzd2 (frizzled class receptor 2 [Source:MGI Symbol;Acc:MGI:1888513])

HSP 1 Score: 313.923 bits (803), Expect = 3.753e-97
Identity = 180/527 (34.16%), Postives = 269/527 (51.04%), Query Frame = 2
Query:  167 CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERG--KICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICS-----ANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVL-PSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            C PI  P C D+ Y+ T MPNL+G  +Q +A      F PL+ ++CS  L+ FLCS+Y P+C    ++    + PCR +C   ++ CE LM + F   W E L CE FP  G  +IC+   + S+D       +   S             G      +    +          +PS ++        CA  C       ++ F+  +  FA +W+L WSVLC  S   T+  +  +  RF YPE+PI+FLS CY   +   + G +L   VV    F++     V  G +   C I F+M+YFF  AS++WWV+L++TWFL+A   WG+EAIE+ S   HL +WA+PA+K+I IL + +ID D L+G CFVG ++   L GFV+ P  +YLFIG  FL  G++SL ++R          D    ++LE+LM +IGVFS+LY +P    I  Y  +     +++ +       S +C         +I C     P + P   + M++  M L++GITSG WIW  K
Sbjct:   44 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC----TVLEQAIPPCRSICERARQGCEALMNK-FGFQWPERLRCEHFPRHGAEQICVG-QNHSEDGAPALLTTAPPSGLQPGAGGTPGGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSW-----VSQHCKSL------AIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGK 548          
BLAST of frizzled receptor-like protein vs. UniProt/SwissProt
Match: sp|Q9PWH2|FZD10_CHICK (Frizzled-10 OS=Gallus gallus OX=9031 GN=FZD10 PE=1 SV=1)

HSP 1 Score: 367.851 bits (943), Expect = 9.626e-117
Identity = 205/543 (37.75%), Postives = 308/543 (56.72%), Query Frame = 2
Query:  122 INIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK---ICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNI----SCAQICS--ANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            I+ I+  R GD   +C PI+ P C+D+ Y+ T MPNL+G  +Q EA+ +  +F PL+   C  +LK FLCS+Y PMC   T   S+ +  CR +C   + +C P+M E F   W + LDC K P +     +C+   +   DE  PP  S       ++R  Q    G+ + Q K  + +   +           N G+  ++    SCA +C+   +V ++  DK FA IW+  WS+LCFFS   T++ F  +  RF YPE+PI+FLS+CY  Y+ G +     G   +AC   + +  +++  G E+T C I FL++Y+FG AS+LWWV+LT+TWFL+A + WG+EAIE+ SS  HL +WAIPA+K+I IL++ ++  DELTG C+VG+ +   L GFV++P   YL IG  F+  G+++L  +RR            N  +LEKLM +IGVFS+LY +P  C I  Y  +   M  + I           C   N     ++ C  ++   +P+VE+ M++IFM LV+GITSG+WIW +K
Sbjct:   25 ISSIDIERPGD--GRCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLKFFLCSLYAPMC---TEQVSTPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDE--PPRGS--SMLPPMFRP-QRPSTGHDLQQHKDSLSRTSCE-----------NPGKFHHVEKSASCAPLCTPGVDVYWSKDDKQFAVIWIAIWSILCFFSSAFTVLTFLIDPQRFKYPERPIIFLSMCYCVYSVGYIIRLFSGAESIACDRDSGQL-YVIQEGLESTGCTIVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGLCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKIVAS-----QQKCKMNNQTK--NLDC--MMNNSIPAVEIFMVKIFMLLVVGITSGMWIWTSK 530          
BLAST of frizzled receptor-like protein vs. UniProt/SwissProt
Match: sp|Q9DEB5|FZ10A_XENLA (Frizzled-10-A OS=Xenopus laevis OX=8355 GN=fzd10-a PE=2 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 6.381e-116
Identity = 210/544 (38.60%), Postives = 309/544 (56.80%), Query Frame = 2
Query:  122 INIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK---ICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQ--FNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKS 1738
            I+ IN  R GD   +C  I+ P C+D+ Y+ T MPNL+G  +Q EA+ +  +F PL+   C ++LK FLCS+Y PMC   T   S+ +  CR +C   + +C P+M E F   W + LDC K P +     +C+   +   DE  P  +S           L  + +  R   S  EIY K      + C  S        + SCA +CS++V   ++  DK FA IW+  WS+LCFFS   T++ F  +  RF YPE+PI+FLS+CY  Y+ G +     G + +AC   + +  +++  G E+T C I FL++Y+FG AS+LWWV+LT+TWFL+A + WG+EAIE+ SS  HL +WAIPA+K+I IL++ ++  DELTG C+VG+ +   L GFV++P   YL IG  F+  G+++L  +RR            N  +LEKLM +IGVFS+LY +P  C I  Y    Y+  N D     +      C  +      ++ C   +   +P+VE+ M++IFM LV+GITSG+WIW   KTV+S
Sbjct:   27 ISSINPDRSGD--GRCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMC---TEQVSTPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGTDE-TPRGSSM----------LPPIFRPQR-PSSGHEIYPK-DPTSRSSCENSGKFHHVEKSASCAPLCSSSVDVYWSKDDKKFAFIWIAIWSILCFFSSAFTVLTFLVDPLRFKYPERPIIFLSMCYCVYSVGYIIRLFAGADSIACDRDSGQL-YVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMKT-----GGENTDKLEKLMVRIGVFSVLYTVPATCVIACYF---YERLNMD--FWKILATQDKC--KMDSQTKTLDCT--MTSSIPAVEIFMVKIFMLLVVGITSGMWIW-TSKTVQS 535          
BLAST of frizzled receptor-like protein vs. UniProt/SwissProt
Match: sp|Q9W742|FZ10B_XENLA (Frizzled-10-B OS=Xenopus laevis OX=8355 GN=fzd10-b PE=2 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 8.609e-115
Identity = 208/545 (38.17%), Postives = 310/545 (56.88%), Query Frame = 2
Query:  122 INIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK---ICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVG-AQCLPSEVNIGQTPNISCAQICSANVQ--FNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKS 1738
            I+ IN  R G+   +C  I+ P C+D+ Y+ T MPNL+G  +Q EA+ +  +F PL+   C ++LK FLCS+Y PMC   T   S+ +  CR +C   + +C P+M E F   W + LDC K P +     +C+   +   DE    A         ++R  +          S  E+Y K  D  G + C  S        + SCA +CS++V   ++ +DK FA IW+  WS+LCFFS   T++ F  +  RF YPE+PI+FLS+CY  Y+ G +     G + +AC   + +  +++  G E+T C I FL++Y+FG AS+LWWV+LT+TWFL+A + WG+EAIE+ SS  HL +WAIPA+K+I IL++ ++  DELTG C+VG+ +   L GFV++P   YL IG  F+  G+++L  +RR            N  +LEKLM +IGVFS+LY +P  C I  Y    Y+  N D     +      C  +      ++ C   +   +P+VE+ M++IFM LV+GITSG+WIW   KTV+S
Sbjct:   21 ISSINPDRSGE--GRCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMC---TEQVSTPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGTDE----APRSSSILPPIFRPQR--------PNSGHEMYPK--DPKGRSSCENSGKFHHVEKSASCAPLCSSSVDVYWSKNDKKFAFIWIAIWSLLCFFSSAFTVLTFLVDPLRFKYPERPIIFLSMCYCVYSVGYIIRLFAGADSIACDRDSGQL-YVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMKT-----GGENTDKLEKLMVRIGVFSVLYTVPATCVIACYF---YERLNMD--FWKILATQDKC--KMDSQTKTLDCT--MTSSIPAVEIFMVKIFMLLVVGITSGMWIW-TSKTVQS 529          
BLAST of frizzled receptor-like protein vs. UniProt/SwissProt
Match: sp|Q9ULW2|FZD10_HUMAN (Frizzled-10 OS=Homo sapiens OX=9606 GN=FZD10 PE=1 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.120e-114
Identity = 204/552 (36.96%), Postives = 306/552 (55.43%), Query Frame = 2
Query:  122 INIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK---ICLTPDSFSQDE-----------FHP--PANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICS--ANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            I+ ++  R GD   +C PI+ P C+D+ Y+ T MPNL+G  +Q EA+ +  +F PL+   C  +L+ FLCS+Y PMC   T   S+ +  CR +C   + +C P+M E F   W + LDC K P +     +C+   +   DE           F P  P ++QE   +D         +G      K    +K                    + SCA +C+   +V ++  DK FA +WL  W+VLCFFS   T++ F  +  RF YPE+PI+FLS+CY  Y+ G L     G   +AC   + +  +++  G E+T C + FL++Y+FG AS+LWWVVLT+TWFL+A + WG+EAIE+ SS  HL +WAIPA+K+I IL++ ++  DELTG C+VG+ +   L GFV++P   YL IG  F+  G+++L  +RR            N  +LEKLM +IG+FS+LY +P  C I  Y  +   M  + I L A  +    C   N     ++ C  ++   +P+VE+ M++IFM LV+GITSG+WIW +K
Sbjct:   21 ISSMDMERPGD--GKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMC---TEQVSTPIPACRVMCEQARLKCSPIM-EQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPG-----RGGCDNPGKFHHVEK--------------------SASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKI-LAAQHK----CKMNNQTK--TLDC--LMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSK 526          
BLAST of frizzled receptor-like protein vs. UniProt/SwissProt
Match: sp|Q8BKG4|FZD10_MOUSE (Frizzled-10 OS=Mus musculus OX=10090 GN=Fzd10 PE=1 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 8.069e-114
Identity = 205/569 (36.03%), Postives = 314/569 (55.18%), Query Frame = 2
Query:   92 VLILICISGFINIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK---ICLTPDSFSQDE-----------FHP--PANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICS--ANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYI-----VDAYKM--TNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            V+I  C +  I+ ++  R GD   +C P++ P C+D+ Y+ T MPNL+G  +Q EA+ +  +F PL+   C ++L+ FLCS+Y PMC   T   S+ +  CR +C   + +C P+M E FK  W + LDC K P +     +C+   +   DE           F P  P ++QE   +D              G++  +   K   +  ++              SCA +C+   +V ++  DK FA +WL  WSVLCFFS   T++ F  + +RF YPE+PI+FLS+CY  Y+ G +     G   +AC   + +  +++  G E+T C + FL++Y+FG AS+LWWVVLT+TWFL+A + WG+EAIE+ SS  HL +WAIPA+K+I IL++ ++  DELTG C+VG+ +   L GFV+VP   YL IG  F+  G+++L  +RR            N  +LEKLM +IGVFS+LY +P  C I  Y      +D +KM  T     +    + +P+C+    I               P+VE+ M+++ M LV+GITSG+W+W +K
Sbjct:   14 VMIGSCTA--ISSMDLERPGD--GKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMC---TEQVSTPIPACRVMCEQARLKCSPIM-EQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGSGMFPPLFRPQRPHSAQEHPLKD-----------GGPGRAGCDNPGKFHHVEKSE--------------SCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQL-YVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALFHIRRVMK-----TGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQHKCKMNNQTK-TPDCLMTTSI---------------PAVEVFMVKVSMLLVVGITSGVWVWTSK 527          
BLAST of frizzled receptor-like protein vs. TrEMBL
Match: B1NWW0 (Frizzled receptor-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=Frz-d PE=2 SV=1)

HSP 1 Score: 1188.71 bits (3074), Expect = 0.000e+0
Identity = 582/583 (99.83%), Postives = 583/583 (100.00%), Query Frame = 2
Query:  182 EPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFWXXXXXXXPTPTNQCDSSTIQNNIPLSQTKQKETLLPYHDWKLNSSYPVVVEYGLPT 1930
            EPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCV+ILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTIQNNIPLSQTKQKETLLPYHDWKLNSSYPVVVEYGLPT
Sbjct:    1 EPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVKILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTIQNNIPLSQTKQKETLLPYHDWKLNSSYPVVVEYGLPT 583          
BLAST of frizzled receptor-like protein vs. TrEMBL
Match: T1DF93 (Fzd-4-1b OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 343/554 (61.91%), Postives = 438/554 (79.06%), Query Frame = 2
Query:   92 VLILICISGFINIINGRRFG----DIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSC 1741
            +++LI    FI  I+ RR      D+Y QC  I EP CQD+ Y++T MPNL+G  SQ EASKR RD+  LIN++CS YLKL+LCSVYFP+C+  T +S + ++PCR LC+HVK RCEP M+ T++LTW +EL+CEK PE  K+C+ PDSFS D+ H   ++  +  + L+ +L++ M  +     K+E+ +K++ +   +CLPS+  IG+TPNISCAQ C A+V+FN +DK FANIWL+ WS+LC  S L TII FSCNTNRF+YPEKPIVFLSICYFF++ GNL G ILGR  V CR F+++ DFIVG+G ETTWCKI FLM+YFF SASALWWVVLT+TWFLSASRHWG EAIESISS+LHL+SW IPALKSIF+LILHKIDADELTGQCFVGN++ + L GFV++P +IYL IG++FL +GY S+LKVR+SFLQ+P+CIDTNN+KRLEKLMAKIGVFSILY++PV CTI SY++D  K + FD+ L  ++ FSP+C+   G++WS  KC++++Q  LPSVEMRMLRIFM LVIGITSGIWIWGNKKT ++C
Sbjct:    6 LIVLIWYGIFILRIDSRRNDKMSIDVYGQCSLITEPVCQDIQYTHTKMPNLIGILSQEEASKRIRDYYALINLQCSQYLKLYLCSVYFPVCDKVTPISEN-IQPCRRLCHHVKSRCEPFMQNTYQLTWPDELNCEKLPESTKLCVAPDSFSLDKDHNKMSNYVEMKKKLFEQLKVSMDKSGNDFPKIEMLKKVNLLSDLKCLPSQFIIGETPNISCAQNCDADVKFNDNDKTFANIWLIIWSLLCLLSSLFTIITFSCNTNRFMYPEKPIVFLSICYFFHSCGNLLGVILGRRNVICRPFSEQFDFIVGNGNETTWCKIIFLMVYFFSSASALWWVVLTVTWFLSASRHWGNEAIESISSILHLLSWGIPALKSIFVLILHKIDADELTGQCFVGNNDKEALIGFVLIPQIIYLLIGMIFLGLGYYSILKVRKSFLQQPNCIDTNNIKRLEKLMAKIGVFSILYIIPVTCTIASYVIDVLKTSYFDLILNVVYTFSPDCVTAKGLSWSQTKCLKLIQSALPSVEMRMLRIFMTLVIGITSGIWIWGNKKTFRNC 558          
BLAST of frizzled receptor-like protein vs. TrEMBL
Match: T1E1F0 (Fzd-4-1a (Fragment) OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 510.76 bits (1314), Expect = 2.266e-172
Identity = 232/376 (61.70%), Postives = 290/376 (77.13%), Query Frame = 2
Query:  152 DIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNK 1279
            D+YKQC  I EP CQDV Y++T MPNLVG +SQ EASKR RD+ PLIN++CS YLKLFLCS+YFP+C+ D++  +  ++PCR LC HVK RCEP MKE ++L+W  EL+CEK P  GK+CL+PDSF+ D+     +   +  + L  + QL+++ +     K+E          ++CLPS +NI   PNISCAQ C A+V+FN  DK FANIWL+GWS+LC FS   TI+ FSCNTNRF+YPEKPIVFLSICYFF++ GNL GAILGR+ V CR  ND  DF+VG+G E TWCK+ FL++YFF SAS+LWWVVLTITW+LSASRHWGYEAIESISS+LHL+SW IPALKSI +LILHKIDADELTGQC+VG++N +
Sbjct:   30 DVYKQCSVITEPVCQDVRYTHTRMPNLVGIFSQNEASKRIRDYYPLINLQCSQYLKLFLCSIYFPICDKDSAAIAPVIQPCRRLCEHVKSRCEPFMKEAYQLSWPNELNCEKLPSTGKMCLSPDSFTLDKEIDKKSKLSEMKKRLLDEFQLLLKKSGKKAPKIETLNNADLFSNSKCLPSHINIVDRPNISCAQRCDADVKFNEGDKTFANIWLIGWSLLCLFSSFFTILTFSCNTNRFMYPEKPIVFLSICYFFHSCGNLLGAILGRSNVICRPTNDDVDFLVGNGNENTWCKVIFLIVYFFSSASSLWWVVLTITWYLSASRHWGYEAIESISSVLHLISWGIPALKSILVLILHKIDADELTGQCYVGDTNRE 405          
BLAST of frizzled receptor-like protein vs. TrEMBL
Match: A0A183SYX6 (Frizzled-10-A OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS9423 PE=3 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 1.171e-136
Identity = 223/580 (38.45%), Postives = 331/580 (57.07%), Query Frame = 2
Query:  152 DIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHP----------------PANSQEDSYQDLYRKLQLVM-QGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTP---------NISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFN---------------------DKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCI---DTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVL-PSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKS 1738
            D    CVPI+EP CQ + YS T MPN V   SQ EA+KR  D+  L+NI CS+YL LFLC++YFPMC     +  S +KPC+ LC HV+ RCEP+M++ F+  W  EL C+  PE   +C+ PD ++ D   P                  N    S Q LY +L+ ++ Q N+   +   + Q     V    L ++ ++  T          N +C   C A++ + A DK FA  WLL WS LC  S +LT + F  +T+R  YPE+P+++L+ CYF  A G +    LG   V C++ N                     +   +++ SG+E TWC + FL++Y+FG+AS LWWV+L++ W+LS +R WG+E +ES+S + H+ +WA+PA+++I +LILHKIDADELTG C+ G  N   L   V++P  IYL +G++ L++G+ ++ +VR+  L+ P  I   + ++ +RLEK +AK+GVF++LY  P+ C +   + +      +   L  L R  P C+   GI W   KC    QP   PS E  +LRIFM+LV+GITSG+W+W NKK+  S
Sbjct:   41 DDLSHCVPIREPVCQGLQYSETRMPNWVKMTSQEEAAKRMIDYRSLLNINCSHYLNLFLCTIYFPMCTR--VLVKSALKPCKPLCVHVRNRCEPIMQQ-FQFNWPTELACDDLPEPPALCIEPDGYALDSKRPVLPNLSAMAVSESESGTGNPNLRSLQRLYPQLEEILRQRNQDSGNLNSLIQAAVAAVDNGALTADQDVACTGTEFTANHFFNSTCLVYCGADLHYRAADKTFARNWLLTWSCLCLASTVLTFLTFLTDTSRLRYPERPVIYLAACYFALAFGYVLQYCLGAETVTCKSVNPAEAGNAVAVGTRSETEIVVENMQKYLLKSGQEGTWCTVGFLILYYFGTASNLWWVMLSLAWYLSTARKWGHEGVESVSCVFHMFAWALPAIQAILLLILHKIDADELTGTCYTGFHNENALIFGVLLPQTIYLTLGLILLSVGFAAVFQVRQK-LKVPSGIGDRERDSRRRLEKSIAKLGVFAVLYTFPMACLLAGNLYEYIGQPKWRSALADLHRDHPQCLSPRGIAWGIDKC----QPKHSPSPEAALLRIFMSLVVGITSGMWVWANKKSFHS 612          
BLAST of frizzled receptor-like protein vs. TrEMBL
Match: A0A0V0J3C8 (Frizzled-10-A OS=Schistocephalus solidus OX=70667 GN=FZ10A PE=3 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 1.585e-136
Identity = 223/580 (38.45%), Postives = 331/580 (57.07%), Query Frame = 2
Query:  152 DIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHP----------------PANSQEDSYQDLYRKLQLVM-QGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTP---------NISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFN---------------------DKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCI---DTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVL-PSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKS 1738
            D    CVPI+EP CQ + YS T MPN V   SQ EA+KR  D+  L+NI CS+YL LFLC++YFPMC     +  S +KPC+ LC HV+ RCEP+M++ F+  W  EL C+  PE   +C+ PD ++ D   P                  N    S Q LY +L+ ++ Q N+   +   + Q     V    L ++ ++  T          N +C   C A++ + A DK FA  WLL WS LC  S +LT + F  +T+R  YPE+P+++L+ CYF  A G +    LG   V C++ N                     +   +++ SG+E TWC + FL++Y+FG+AS LWWV+L++ W+LS +R WG+E +ES+S + H+ +WA+PA+++I +LILHKIDADELTG C+ G  N   L   V++P  IYL +G++ L++G+ ++ +VR+  L+ P  I   + ++ +RLEK +AK+GVF++LY  P+ C +   + +      +   L  L R  P C+   GI W   KC    QP   PS E  +LRIFM+LV+GITSG+W+W NKK+  S
Sbjct:   55 DDLSHCVPIREPVCQGLQYSETRMPNWVKMTSQEEAAKRMIDYRSLLNINCSHYLNLFLCTIYFPMCTR--VLVKSALKPCKPLCVHVRNRCEPIMQQ-FQFNWPTELACDDLPEPPALCIEPDGYALDSKRPVLPNLSAIAVSESESGTGNPNLRSLQRLYPQLEEILRQRNQDSGNLNSLIQAAVAAVDNGALTADQDVACTGTEFTANHFFNSTCLVYCGADLHYRAADKTFARNWLLTWSCLCLASTVLTFLTFLTDTSRLRYPERPVIYLAACYFALAFGYVLQYCLGAETVTCKSVNPAEAGNAVAVGTRSETEIVVENMQKYLLKSGQEGTWCTVGFLILYYFGTASNLWWVMLSLAWYLSTARKWGHEGVESVSCVFHMFAWALPAIQAILLLILHKIDADELTGTCYTGFHNENALIFGVLLPQTIYLTLGLILLSVGFAAVFQVRQK-LKVPSGIGDRERDSRRRLEKSIAKLGVFAVLYTFPMACLLAGNLYEYIGQPKWRSALADLHRDHPQCLSPRGIAWGIDKC----QPKHSPSPEAALLRIFMSLVVGITSGMWVWANKKSFHS 626          
BLAST of frizzled receptor-like protein vs. Ensembl Cavefish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 361.303 bits (926), Expect = 4.992e-115
Identity = 217/625 (34.72%), Postives = 324/625 (51.84%), Query Frame = 2
Query:   59 IRFCHISMTKTVLILICISGFINIINGRRFGDIYK---------QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFP---ERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRI--GQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQ--FNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPN-CIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFWXXXXXXXPTPTNQCDSSTIQNNIPLSQTKQKETLLPYHDW 1882
            +R  HI+M   +  L+ I  +  +++     DI           +C PI  P CQ + Y+ T MPN +   SQ EAS +  +F PL+   C  +L+ FLCS+Y PMC   T   S+T+  CR +C   +++C P+M E F   W + LDC K P   +   +C+      +++  PP    E       R         R   G    E ++K   +  ++              SCA  CS  V   ++  DK FA IW++ WS LCF S   T++ F  +  RF YPE+PI+FLS+CY  Y+   +  ++ G   +AC   N +  +I+  G E+T C I FL++Y+FG AS++WWV+LT+TWFL+A R WG+EAIE+ SS  H+V+W IPA+K+I IL + K+  DELTG C+VG+ +   L GF+I+P   YL IG  F+  G+++L  +R+            N ++LEKLM KIGVFSILY +P  C I+ Y  +   M  +       FR S + C+   G    +  C   L   +P+V + ML+IFM+LV+GITSG+W+W +K          R    +   +P P+  C  S        +     +T  PY D+
Sbjct:    6 LRCVHITMAYHLKTLVWIFLWCQLVSDGSSLDIGAYDGERGRPAKCEPITIPMCQGIGYNMTRMPNFMKYESQEEASIKLNEFAPLVEYGCDVHLRFFLCSLYVPMC---TDQVSTTIPACRAMCVQARQKCSPIM-EQFSFGWPDSLDCSKLPTNNDPNALCIEA---PENDTVPPTKKGEGMLPVPARPRPPGTGAGRPSGGSGSCENHEKFQYVEKSE--------------SCAPRCSPTVDVFWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRENGQL-YIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMVAWGIPAMKTIVILTMRKVAGDELTGLCYVGSMDTNALTGFIIIPLSCYLIIGTSFILTGFVALFHIRKIMKT-----GGTNTEKLEKLMVKIGVFSILYTVPATCVIICYFYERLNMDYWK------FRASESKCVSFPGRR--TEDCT--LDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCARKLAMRTTRKPCPSVNCGGSHCHYKSAAATLHSSKT-DPYTDF 592          
BLAST of frizzled receptor-like protein vs. Ensembl Cavefish
Match: fzd9b (frizzled-9 [Source:NCBI gene;Acc:103027133])

HSP 1 Score: 355.14 bits (910), Expect = 8.690e-113
Identity = 198/523 (37.86%), Postives = 293/523 (56.02%), Query Frame = 2
Query:  164 QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQ--FNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDI-TLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            +C PI  P CQ + Y+ T MPN +   SQ EA+ +  +F PL+   C  +L+ FLCS+Y PMC   T   S+++  CR +C   ++RC P+M E F   W E LDC K P R      P++   +    P N   D+  +  +   ++    R  Q      +    +   +  P +    +    SCA  CS+ V   ++  DK FA IW+  WS LCF S   T++ F  + +RF YPE+PI+FLS+CY  Y+   +  ++ G   +AC   N +  +I+  G E+T C I FL++Y+FG AS++WWV+LT+TWFL+A + WG+EAIES SS  H+ +W IPALK+I IL + K+  DELTG C+VG+ +   L GFV+VP   YL +G  F+  G+++L  +R+         +  N ++LEKLM KIG++SILY +P  C IV Y    Y+  N D    + L        GR   + S       L   +P+V + ML+IFM+LV+GITSG+W+W +K
Sbjct:   41 KCEPIVIPMCQGIGYNLTRMPNFMDHDSQKEAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMC---TDQVSTSIPACRPMCEQARQRCSPIM-EKFNYAWPESLDCSKLPTRND----PNALCMEA---PEN---DTKPEPKKGEGMLPVPPRPRQPGSGGGRPGGSVGACE-NPEKFQYVEKSE-SCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRENGEL-YIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSFYLVVGTSFVLTGFVALFHIRKVMK-----TEGTNTEKLEKLMVKIGIYSILYTVPATCVIVCYF---YERLNMDYWKFRGLESKCVTFPGRRNEDCS-------LDASMPAVAVFMLKIFMSLVVGITSGVWVWSSK 531          
BLAST of frizzled receptor-like protein vs. Ensembl Cavefish
Match: fzd10 (frizzled class receptor 10 [Source:ZFIN;Acc:ZDB-GENE-990415-220])

HSP 1 Score: 345.125 bits (884), Expect = 1.065e-109
Identity = 186/504 (36.90%), Postives = 285/504 (56.55%), Query Frame = 2
Query:  221 MPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMS-DMVGAQCLPSEVNIGQTPNISCAQIC--SANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            MPNL+G   Q EA+ +  +F PLI   C ++L+ FLCS+Y PMC   T   S+ +  CR +C   +++C P+M E F   W + LDC + P +      P+    +    P N  +D+ +  + +             +L + ++M  D  G    P + +  Q    SCA  C    +V ++  DK F+ +W+  WS+LCF S   T++ F  +  RF YPE+PI+FLS+ Y  Y+ G L    +G   VAC   +    +++  G E+T C I FL++Y+FG AS+LWWV+LT+TWFL+A + WG+EAIE+ SS  HL +WAIPA+K+I IL++ ++  DELTG C+VG+ + K L GFV++P   YL IG  FL  G+++L  +R+         +  N  +LEKLM +IGVFS+LY +P  C I  Y  +   M  + +           C+   G      +C  +++  +P+VE+ M++IFM LV+GITSG+WIW +K
Sbjct:    1 MPNLMGHEDQGEAAIKLHEFAPLIEFGCHSHLRFFLCSLYAPMC---TEQVSTPIPACRVMCEQARQKCSPIM-EQFNFHWPDSLDCSRLPNKND----PNFLCMEA---PNNGSDDTSKGSHTQPPDSRPPRSGNSQELPVKERMGKDTCGN---PGKFHFVQKSE-SCAPKCYSKVDVYWSHADKRFSLVWIAIWSILCFISSAFTVLTFLIDPQRFKYPERPIIFLSMSYCVYSVGYLIRLFVGAENVACDR-DSGVQYVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAIKTILILVMRRVAGDELTGVCYVGSMDVKALTGFVLIPLSCYLIIGTSFLLSGFVALFHIRKVMK-----TEGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKVLAG-----EQRCLEGGGGE----EC--MMKSSIPAVEIFMVKIFMLLVVGITSGMWIWTSK 472          
BLAST of frizzled receptor-like protein vs. Ensembl Cavefish
Match: fzd4 (frizzled class receptor 4 [Source:NCBI gene;Acc:103039803])

HSP 1 Score: 339.732 bits (870), Expect = 1.083e-107
Identity = 196/536 (36.57%), Postives = 277/536 (51.68%), Query Frame = 2
Query:  134 NGRRFG-DIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFP---ERGKICLTPDSFSQDEFHP--PANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
              R FG D   +C PI+   C D+ Y+ T MPNLVG+  Q +A  + + F PLI   CS+ LK FLC+VY PMC   T     T+ PC  +C  VK +C P+++E F   W E L+C  FP   ++  +C+   +   D FHP  P    E+         + V  G   G  +   + K S     QC       G    +           +    K+F ++W+  W+VLCF S   T++ F  ++ RF YPE+PI+FLS+CY  Y+   L     GR  ++C         +   G + T C + FL+ YFFG AS++WWV+LT+TWFL+A   WG+EAIE  SS  H+ +WAIPA+K+I ILI+  +DAD+LTG C+VGN N   L GFV+ P   YL IG +F+  G ++L K+ RS LQ+    D     +LE+LM KIGVFS+LY +P  C I  Y        +F  T +  +                             +   MLRIFM+L++GIT G+W+W  K
Sbjct:   20 RARAFGVDEDARCEPIRMAMCLDLGYNQTRMPNLVGNVLQADAELQLQTFTPLIQYGCSSQLKFFLCAVYAPMC---TEKVPVTIGPCGSMCLAVKRKCLPVLQE-FGFVWPELLNCSLFPPTNDQNHMCMEGPA-EDDLFHPNKPVAPHEE---------ECVTMGG--GGPEQYAWAKRSGSCVLQC-------GYESGL-----------YRRQAKMFTDVWMAVWAVLCFISTSFTVLTFLLDSARFSYPERPIMFLSMCYNVYSVAFLVRLTAGRERISCDLDEAAVPVLAQEGLKNTGCAVVFLLAYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADDLTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKI-RSNLQK----DGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYQISNWADFHQTARDSY-----------------------------MAAEMLRIFMSLLVGITCGMWVWSAK 487          
BLAST of frizzled receptor-like protein vs. Ensembl Cavefish
Match: fzd7b (frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GENE-990415-229])

HSP 1 Score: 330.872 bits (847), Expect = 7.791e-104
Identity = 195/557 (35.01%), Postives = 280/557 (50.27%), Query Frame = 2
Query:  113 SGFINIINGRRFGDIYKQ----------CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERG--KICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQG-NRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSAN-----VQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDIT--LKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            S F+N++     G  + +          C PI  P C D+ Y+ T MPNL+G  +Q +A      F PL+ ++CS  LK FLCS+Y P+C    ++    + PCR LC   +  CE LM + F   W E L CE FP  G  +IC+      Q+   P + + E +   LY        G  R GQ      Q          +PS +N        C   C  +     + F   +  F  +W+  W++LC  S L T++ +  +  RF YPE+PI+FLS CYF  A   + G +L   VV    F +     V  G +   C I F+++YFFG AS++WWV+L++TWFLSA   WG+EAIE+ S   HL +WA+PA+K+I IL L ++D D LTG CFVG  N   L GFV+ P  +YLFIG  FL  G++SL ++R          D    ++LEKLM +IGVFS+LY +P    I  Y  +      ++ T  ++   RF+  C   N              P+ P   + M++  M +++GITSG WIW  K
Sbjct:   22 SSFLNVLRNYSAGQHHGEKGISVPEHGFCQPISIPLCTDIQYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSADLKFFLCSMYAPVC----TVLEQAIPPCRSLCERARHGCEALMNK-FGFQWPERLRCEAFPVHGAGEICV-----GQNTSDPGSPTSEPT---LYAPGLTPPPGPERSGQPFTCPLQ--------LAVPSYLNYKFLGAKDCGAPCEHSQPHGLMYFREEEMKFGRLWVGIWAILCCVSTLFTVLTYLVDMRRFRYPERPIIFLSGCYFMVAVAYVTGFLLEDKVVCIDKFREDAYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILALGQVDGDLLTGVCFVGIYNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFREQWEKTWHMQTCKRFAVPCPSSN------------FAPMSPDFTVFMIKYLMTMIVGITSGFWIWSGK 540          
BLAST of frizzled receptor-like protein vs. Ensembl Sea Lamprey
Match: fzd2 (frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GENE-990415-224])

HSP 1 Score: 314.309 bits (804), Expect = 1.554e-98
Identity = 188/532 (35.34%), Postives = 270/532 (50.75%), Query Frame = 2
Query:  167 CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERG--KICLTPDSFSQD-----EFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSAN-----VQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVL-PSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            C PI  P C D+ Y+ T MPNL+G  +Q +A      F PL+ ++CS  LK FLCS+Y P+C    ++    + PCR LC+  ++ CE LM + F   W E L CE FP +G  +IC+  +   +         PP                 V    R    +   +  M   V    +P  +N       +CA  C        + F+  +  F+ +W+  WSVLC  S L T+  +  +  RF YPE+PI+FLS CYF  A   + G +L   VV    F++     V  G +   C I F++IYFF  AS++WWVVL +TWFL+A   WG+EAIE+ S   HL +WAIPA+K+I IL +  +D D L+G CFVG S+   L GFV+ P  +YLF+G  FL  G++SL ++R          D    ++LEKLM +IG+FS+LY +P    I  Y  +      ++ T       S +C G       +I C     P + P   + M++  M L++GITSG WIW  K
Sbjct:   13 CQPISIPLCTDIPYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVC----TVLEKAIPPCRSLCDRARQGCEALMNK-FGFQWPERLRCENFPVQGSDEICVGQNHTDKAGPTALPPTPPGGGGGVIGGIGGGAGDFVTIHTRRPPGRTHPF--MCPRVLK--VPPYLNAQLFRERNCAAPCEPKKPNGLMYFSEEELRFSRLWVGIWSVLCCASTLFTVTTYLVDMQRFRYPERPIIFLSGCYFMVAVAYVAGFLLDDKVVCNEQFSEDIYRTVTQGTKKEGCTILFMLIYFFSMASSIWWVVLALTWFLAAGMKWGHEAIEANSQYFHLAAWAIPAVKTITILAMGLVDGDMLSGVCFVGISSVAALRGFVLAPLFVYLFLGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLEKLMVRIGIFSVLYTVPATIVIACYFYEQAFREQWEKTW-----VSQSCKG------FAIPCPLNHYPNMKPDFTVFMIKYLMTLIVGITSGFWIWSGK 519          
BLAST of frizzled receptor-like protein vs. Ensembl Sea Lamprey
Match: fzd7a (frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GENE-990415-223])

HSP 1 Score: 308.916 bits (790), Expect = 9.326e-96
Identity = 185/539 (34.32%), Postives = 272/539 (50.46%), Query Frame = 2
Query:  167 CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK--ICLTPDSFSQD-----EFHPPANSQEDSYQ--DLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQC-----LPSEVNIGQTPNISCAQICSAN-----VQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVL-PSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            C PI  P C D+ Y+ T MPNL+G  +Q +A      F PL+ ++CS  LK FLCS+Y P+C    ++    + PCR LC   ++ CE LM + F   W E L CE FP +G   IC+  +   +         P      DS+     YR       G   G          S      C     +PS +N        C   C  +     + F+A +  FA +W+  WS+LC  S L T++ +  +  RF YPE+PI+FLS CY   +   + G      +V  + F D    +V  G +   C I F+M+YFF  AS++WWV+L++TWFLSA   WG+EAIE+ S   HL +WA+PA+K+I IL + ++D D LTG CFVG ++   L GFV+ P  +YLFIG  FL  G++SL ++R          D    ++LEKLM +IG+FS+LY +P    I  Y  +      ++ +  A           +     +++C +   P + P   + M++  M L++GITSG WIW  K
Sbjct:   57 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVC----TVLEEAIPPCRSLCERARQGCETLMNK-FGFQWPERLRCENFPVQGSENICVGQNHTDEKGGHPTPPDPHPIPHGDSFTLPPHYRPGGPSSGGGIGGGGGGGASGGDSSSYQLTCPHVLRVPSYLNYQFLGKKECGSPCEPSKSNGLMYFDADELWFARMWVGVWSILCCASTLFTVLTYLVDMERFRYPERPIIFLSGCYAVVSIAYIVGFFFEEKIVCNKFFEDSYSTVV-QGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILAMGQVDGDVLTGVCFVGLNSIDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLEKLMVRIGIFSVLYTVPATIVIACYFYEQAFRAQWEKSWVA-----------HTCKSFAVQCPQGHYPNMKPDFTVFMIKYLMTLIVGITSGFWIWSGK 573          
BLAST of frizzled receptor-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011009.1 (pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gene:ENSPMAG00000009982.1 transcript:ENSPMAT00000011009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 294.664 bits (753), Expect = 2.579e-90
Identity = 178/539 (33.02%), Postives = 268/539 (49.72%), Query Frame = 2
Query:  167 CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFP---ERGKICL---TPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPN-----------ISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTW---CKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            C  I  P C+ + Y++T MPN     SQ EA      F PL+ IKCS  L+ FLCS+Y P+C  D       + PCR +C   +  C PLM++ +   W + + C++ P   ++ ++C+     D+  Q     P            R    V  G   G    E  +      G  C    V IG   +           ++CA  C  +  F   ++ FA+ W+  WS+LCF S   T++ F  +  RF YPE+PI+FLS CY F + G +   ++G + V C   +    +      ETT    C + FL+ YFFG AS++WWV+L++TWF++A   W  EAI   S   HL +W +P+++S+ +L    +DAD L G C VG  + + L GFV+VP  +YL +G VFL  G+ SL+++R +  Q+          +LEKLM +IG+FS+LY +P +  +  Y    Y+  + D   +AL    P+C G         +         P   + ML+ FM LV+GITSG+WIW  K
Sbjct:    9 CQNITVPMCRGIGYNHTYMPNDFNHDSQDEAGLEVHQFWPLVEIKCSPDLRFFLCSMYTPICLEDYKQP---LPPCRSVCERARAGCAPLMRQ-YGFAWPDRMRCDRLPVLGDQNRLCMDYNKSDTTPQPPEVKPTAPVRSFNPSKNRATTRVGGGGGGGGGSGEACES-----GCACRAPMVAIGSDRHPLYNRVRTGSVLNCAMPCH-DPYFTQDERTFASFWIGLWSILCFVSTFTTVVTFLIDMERFKYPERPIIFLSACYAFVSMGYIVRLVVGHDGVICNQEHRHVHY------ETTGPALCTVVFLLTYFFGMASSIWWVILSLTWFMAAGMKWSSEAIAGYSQYYHLAAWLLPSVQSVAVLATSSVDADPLAGICSVGAQSLENLRGFVLVPLTVYLCVGAVFLLAGFTSLVRIRNAIKQQ----GGTKTDKLEKLMVRIGIFSMLYTVPAIAVVACYF---YEERSRDGWARAL--ICPSCQGDEEPGSQQQQQQR------PDYGIFMLKYFMCLVVGITSGVWIWSGK 516          
BLAST of frizzled receptor-like protein vs. Ensembl Sea Lamprey
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 206.068 bits (523), Expect = 1.140e-59
Identity = 119/350 (34.00%), Postives = 176/350 (50.29%), Query Frame = 2
Query:  683 LPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLK-ALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKT 1729
            L   V  GQ  N  CA  C +        + FA+ W+  WS LCF +   T+  F  +  RF YPE+PI+FLS+C    + G +   + G   VAC A  D    +  S      C   FL+ YFFG A  +WWV+L++TWF++A   WG EAI   S   HL +W +P++K+I  L ++ +D D + G C VGN +   L GFV+ P + YL +G  FL  G ++L ++R +    P    T   ++LE+LM +IGVF++LY +P    +V ++ +     +++ TL        P  +   G                P   + ML+ F+ LV GITSG WIW  K  
Sbjct:   21 LYDRVRTGQVRN--CATPCHSPF-LGREQRTFASFWIGLWSSLCFAATFATVSTFLIDMERFKYPERPIIFLSLCCMLASLGYIVRMVAGHEAVACSA--DWHHVLYASSGPAL-CTAVFLLTYFFGMAGCVWWVILSLTWFMAAGLKWGSEAIAGYSQYYHLAAWLLPSIKAIAALAMNAVDGDPVAGICSVGNQSLDNLRGFVLAPLVAYLLVGTAFLLAGLVALFRIRNAISANPGGAKT---EKLERLMVRIGVFAVLYTVPAAVAVVCHLYEQQHRDSWERTLVCGACGPGPGHLPEPGAR--------------PDFAVFMLKYFVCLVGGITSGAWIWSGKTA 347          
BLAST of frizzled receptor-like protein vs. Ensembl Sea Lamprey
Match: fzd3b (frizzled class receptor 3b [Source:ZFIN;Acc:ZDB-GENE-070122-1])

HSP 1 Score: 147.902 bits (372), Expect = 2.650e-38
Identity = 99/321 (30.84%), Postives = 152/321 (47.35%), Query Frame = 2
Query:  803 SVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFN---DKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPV---------LPSVEMRMLRIFMNLVIGITSGIWIWGNKKT 1729
            SV+C  +   T + F  +  RF YPE+PI+F + CY   +   L G +L  +  AC A          +    R    C   F+++YF   A ALWWVVLTITWFL+A   WG EAIE  ++  H ++W  PA  ++ +L L+K++ D L+G C+ G  +   L  FV+ P       G+  L  G +SL +VR          D  N  +L K M +IGVFS+LY++P L  +   + +      ++ T                  W   +C E   P           P++ + +++ F  LV+GI    W+ G++KT
Sbjct:   55 SVVCLVATTFTFLTFLLDRKRFRYPERPIIFYATCYVAVSLSFLVGFLLDDSAAACNAPGLAPGAAGTVTQGSRNNKACTAVFMLLYFSAMAGALWWVVLTITWFLAAGLKWGREAIEKRAAAFHALAWGPPAALTVALLALNKVEGDNLSGVCYAGLYDVTTLRYFVLAPLGACAAAGLSLLLAGIVSLNRVRLEMRH-----DGRNQTKLVKFMVRIGVFSVLYLVPQLALVACLVYEQASRAAWEAT------------------WLRDRCTEYRIPCPYQANQPKQRPALVLFLVKYFTTLVVGIPPAFWV-GSRKT 351          
BLAST of frizzled receptor-like protein vs. Ensembl Nematostella
Match: EDO38567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCF4])

HSP 1 Score: 347.821 bits (891), Expect = 3.655e-110
Identity = 195/562 (34.70%), Postives = 308/562 (54.80%), Query Frame = 2
Query:   86 KTVLILICISGFINIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERG---------KICLTPDSFSQDEFHPPANSQE--DSYQDLYRKLQLVMQGNRIGQSKLE-IYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSG---RETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDI-TLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            +  LIL+       ++ G+R      +C PI  P C  + Y+ T  PN +   SQ EA+KR  +F PLI + C+  L+ FLCSV+ PMC  + ++    +  CR +C   ++ C P+M+  F   W + LDC++ P++G         K+C+   +  Q     P N  +   +++ L  + + +   N  G  + +  Y +  D    QC+P                C +++ F++++K FAN+W+  WSVLCF S  +T++ F  +T+RF YPE+PI+FLS+CY  Y+ G +     GRN V C   ++   F++ +G    +   C + FL++Y+FG ASA+WWVVLT  WFL+A R WG EAIE  ++  H V+W +PA+++I  LI+ K+DADELTG C+VGN + + L  +V+ P  +YL +G  FL  G++SL ++R     +       N  +LEKL+ +IGVFS+LY +PV   I       Y+  N D+  ++A F  +  C G          C+E      PS+E+ +++ FM L+IGITS +WIW  K
Sbjct:    5 RLALILLLFITVSAMVYGQRSEVPNSKCTPITIPLCMGIGYNATRFPNFLAQESQEEAAKRIHEFKPLIAVNCAPLLRFFLCSVFVPMCTKEVNVP---IYACRSMCESARDGCSPMMQR-FGFNWPDTLDCDRLPKKGDPQAKSDPTKLCMAAPNIKQTA---PLNESDIWSNFESLGPEFKKI---NNTGPLRYKYTYVEKYD----QCVPQ---------------CKSDLMFSSNNKRFANVWISVWSVLCFISTAVTVLTFVIDTSRFKYPERPIIFLSLCYNLYSLGYIVRVTAGRNEVIC---DETESFVIRAGMNIADHACCSVVFLLLYYFGMASAVWWVVLTFAWFLAAGRKWGQEAIERKATYFHAVAWTVPAIQTIMALIMRKVDADELTGLCYVGNMDYENLANYVLTPLCLYLLVGTFFLLAGFVSLFRIRTVLKNK-----ETNTDKLEKLIVRIGVFSVLYTIPVSAVIA---CSFYEYNNMDVWKVRAPFN-TYICRGDQA-------CLENYG---PSIEVFIVKYFMLLIIGITSNMWIWSTK 515          
BLAST of frizzled receptor-like protein vs. Ensembl Nematostella
Match: EDO35751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM6])

HSP 1 Score: 310.842 bits (795), Expect = 6.715e-97
Identity = 182/523 (34.80%), Postives = 271/523 (51.82%), Query Frame = 2
Query:  161 KQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERG-KICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVL-PSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            K+C P+  P C  + Y+ T  PN +   +Q EA+     F PL+ + CS  L  FLCSVY P+C    ++  + + PCR LC  V+  CE LMK  F  TW + L CE+FP+ G +IC+      ++   P ++       + Y  + +     R  +S              Q +P++          CA  C  NV F   ++  A +W   W++LC  S L TI+ F  +  RF YPE+PI+FLS CYF  +   + G + G  +             +  G +   C + F+M+YFF  AS++WWV+LT+TWFL+A   WG EAIE+ S   HL +WAIPA+K+I IL++ K+D DEL+G C+VG S+   L G+V+ P  +Y  IG  FL  G+ISL +V RS L+     D +  +++EKLM +IGVFSILY +P L  I     +      +D +    ++    C          + C     P+  P   + M++  M L++GITSG WIW +K
Sbjct:   27 KRCEPVTIPLCTGLQYNMTIFPNTLKHRTQEEAALEVHQFFPLVKVDCSKDLAFFLCSVYAPVC----TVLETPLPPCRSLCLTVRSGCEGLMKR-FGFTWPDSLSCERFPKLGDEICV-----GENTTTPTSDQDGGINNNTYPDVDMSTMRYRCPES--------------QKIPNDQYTFHGEK-RCAATCR-NVFFTKREREIARMWTGIWAILCAVSTLFTILTFLIDMRRFRYPERPIIFLSGCYFMVSIAFITGYVAGDKIACNEPIKKGFPKTLVQGTKHEGCTVIFMMLYFFSMASSIWWVILTVTWFLAAGLKWGQEAIEANSQFFHLAAWAIPAVKTIAILLMTKVDGDELSGVCYVGLSDVSALRGYVLAPLFVYFIIGATFLLAGFISLFRV-RSVLKD----DYSKREKIEKLMIRIGVFSILYTVPALVVIGCLYYEQSNRELWDNSWIEGWKRQKKCTEVETKLKGEVSCPPYPVPLQKPDFMVFMVKYLMFLIVGITSGFWIWSSK 518          
BLAST of frizzled receptor-like protein vs. Ensembl Nematostella
Match: EDO42932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S003])

HSP 1 Score: 296.59 bits (758), Expect = 1.419e-91
Identity = 178/525 (33.90%), Postives = 265/525 (50.48%), Query Frame = 2
Query:  164 QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK---ICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSE-VNIGQTPNISCAQICSANVQFNAHDK-VFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            +C  I  P C+ + Y+ T MPN+    +Q EA+     F PL+ I+CS  L+ FLCS+Y P+CE         + PCR +C   +  C PLM++ +  +W E + CE FPE G    +C+  +S  +    P  + Q     D             I  +          + G    P+  +++G  P   CA  C  N  +  HD+  FA+ W+  W++LCF S L+T + F  + +RF YPE+PI+FLS CY   + G +   I G   +AC    D    +         C I FL++YFFG AS++WWV+L  TWFLSA   W  EAI + S   H V+W +PA+++I +L +  ID D ++G C+VGN N + L  FVIVP ++YL  G  FL  G+ SL+++R+   Q      +    +LEKLM +IGVFS+LY +P    +  Y  +      ++ T+        NC G              +  V P   + +++ FM LV+GITSG WIW  K
Sbjct:   28 KCEEITIPMCRGIGYNLTYMPNMFNHDTQAEAALEVHQFWPLVEIQCSPDLRFFLCSMYAPLCEKHYD---KDLPPCRSVCERARTGCAPLMRK-YGFSWPERMKCENFPELGDENTLCMGRNSSGESTPKPSQSPQPAPSPDT----------AAISANCCSCRPPFVSIAGKNIKPTRAISVGGVPQ--CAMAC--NRTYFTHDQDSFASFWIGLWAILCFISTLVTTLTFLVDMHRFKYPERPIIFLSGCYLMVSVGYIIRLIAGHKQIAC----DSNGLMRYDTSGPASCTIVFLLVYFFGMASSVWWVILAFTWFLSAGMKWSSEAITNYSQYFHAVAWLVPAIQAIAVLAMSTIDGDPVSGICYVGNHNLQSLVVFVIVPLVVYLVFGTSFLMAGFYSLVRIRKLLRQH----GSTKTDKLEKLMIRIGVFSVLYTVPATIVVACYYYELVNRETWERTI--------NCSGCG------------VTRVKPDHSVFIIKYFMALVVGITSGFWIWSGK 506          
BLAST of frizzled receptor-like protein vs. Ensembl Nematostella
Match: EDO30865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZJ6])

HSP 1 Score: 277.33 bits (708), Expect = 1.205e-84
Identity = 174/525 (33.14%), Postives = 264/525 (50.29%), Query Frame = 2
Query:  164 QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCS-NYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERG---KICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAF-NDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            +C  I    C+ V Y+ T MPNL+G  +Q EA  + + F PLI   C+   L  FLCS Y PMC   T      +  CR LC +V++ C P++ E F + W   L+C +F  R     +C+   +F++    P  + +  +            Q  R   SK   Y + ++                   SCA  C+ +  F   DK   +IW+  WS+ CF S  +T+  F   T RF YPE+ I++L++CY FY+   +     GR  ++C         F +  G   T C I FL+ YFF  A+ +WWVVL +TWFL+A   WG EAI S + + H+++W +P +K+IFILI  K+D DELTG CFVGN +   L  FV+ P   YL IG +FL  G+++L ++R + +QR     T+   +LE+L+ +IG+FS+L  +P    I  Y    Y+  N     K  + +      R+G                P+  + ML++FM+L  G+ +G+WIW +K
Sbjct:    3 KCEKISIDLCRSVGYNVTRMPNLIGHETQKEAESQLKQFLPLIQYGCAREQLVFFLCSAYAPMC---TDKVDVVITSCRPLCEYVRKSCLPVLTE-FGIPWPNPLNCTRFLVRNNERNMCMPGPNFTESPEKPRPDFKPINDTTEKPPSTGSEQCRRFKNSKNYFYVQSTE-------------------SCAVRCNEDGIFKTSDKETMDIWITIWSIFCFISTTITLTTFLIETGRFKYPERSIIWLALCYNFYSLSYIIRLGAGRQAISCDTDPTTHVKFHIQDGLRNTGCAIVFLIQYFFCMAATIWWVVLALTWFLAAGMKWGCEAIGSYAKLFHIIAWILPCIKTIFILITRKVDGDELTGLCFVGNQDLIALAAFVLGPQFTYLIIGTLFLIAGFVALFRIRTT-VQRGGQAKTD---KLERLIVRIGIFSVLSTVPATAVIACYF---YEYAN-----KEYWYYGQ----RDG------------AVAEPNFSIFMLKVFMSLFTGVITGMWIWSHK 476          
BLAST of frizzled receptor-like protein vs. Ensembl Nematostella
Match: EDO40119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S829])

HSP 1 Score: 118.627 bits (296), Expect = 5.748e-28
Identity = 123/521 (23.61%), Postives = 224/521 (42.99%), Query Frame = 2
Query:   98 ILICISGFINIINGRRFGDIYKQCVPIKEPECQ----DVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINI-KCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSC---NTNRFLYPEKPIVFLSICYFFYASGNL--FGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITW-----FLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKC 1615
            +LI   G I   +       YK C P+KE  C     D HY+ T +  +  S SQ +  K    +  L  + KC   L+ FLC +Y P C+     + S   PCR  C   ++ C  +  E+++  W E L C+K PE G    T      +E    A   E +Y+  +                   Y+ + +  G QC+                    N  F+  +    + ++  +  L     L T++ F     + NR  YP   + F++ C+   + G L  F +   R VV CR  +D       +  ++  C + F+++Y+F  A   W+V+L  +W      L ++R    +     +   H++SW++PA+ +  +L++ ++DA+ ++G CFVG  N  +  GF++ P  + L IG +FL  G  +L K+R+S    P+ +      ++++ + ++G F+ +    V  T   ++ + Y    ++ + +A       CI  + +   S  C
Sbjct:    4 VLITFCGIITSYSSAYSQGSYK-CEPLKEQTCLGEKLDYHYTTTEL--VTDSSSQDQVKKNLEKWEGLKFLPKCWEVLQPFLCQIYKPKCK-----NGSVELPCREQCFATRKPCSVV--ESYR-RWPEFLRCDKLPE-GNCNGTLKKLHLNESACKAPLVETAYKPSW-------------------YEGI-EGCGIQCM--------------------NPIFSEEEHTRIHRFVAAFGTLTTVCTLFTVVTFLVGWKSQNR--YPSVILFFMNACFCVASVGFLIQFSSDARRKVV-CRR-DDTMRLGEPTESDSFLCVLTFVLVYYFSLAGMTWFVMLAYSWCICFKTLGSTR----DNFAGKTGYFHIISWSLPAVLTGCVLLVKQVDANSISGICFVGYKNPSMRAGFLLAPLGLDLVIGGMFLAKGLFTLFKLRKS---NPNFLSNRASIKIKETIMRVGFFAFVAFAFVFITFACHVYEYYNQERWERSYRAFLM----CIANHEVKGVSNTC 457          
BLAST of frizzled receptor-like protein vs. Ensembl Medaka
Match: fzd10 (frizzled class receptor 10 [Source:NCBI gene;Acc:101161314])

HSP 1 Score: 360.918 bits (925), Expect = 3.461e-115
Identity = 197/525 (37.52%), Postives = 303/525 (57.71%), Query Frame = 2
Query:  164 QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGK---ICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQIC--SANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            +C  I  P C+D+ Y+ T MPNL+G   Q EA+ + ++F  LI   C ++LK FLCS+Y PMC   T   S+ +  CR +C  VK +C P++ E F+  W + LDC + P +     +C+   + S DE     ++Q   ++      Q  + G  +    +   Q  S+       P + +  +    SCA  C    +V ++  DK F+ +W+  WS+LCF S   T++ F  +  RF YPE+PI+FLS+ Y  Y+ G L    +G + +AC   ++   +I+  G E+T C I FL++Y+FG AS+LWWV+LT+TWFL+A + WG+EAIE+ SS  HL +WAIPA+K+I IL++ K+  DELTG C+VG+ + K L GFV++P   YL IG  FL  G+++L  +R+         +  N  +LEKLM +IGVFS+LY +P  C I  Y  +   M  + I       +   C+  +G    S +CV  ++  +P++E+ M++IFM LV+GITSG+WIW +K
Sbjct:   31 RCQHITIPLCKDIGYNMTRMPNLMGHDDQLEAAIKLQEFASLIQCGCHSHLKFFLCSLYAPMC---TEQVSNPIPACRVMCEQVKVKCSPIL-EKFQFPWPDSLDCSRLPTKNDPNNLCMEAPNNSSDEPPKVPHTQPPDFRP-----QQPLSGQDLHPKDIGEKQTCSN-------PGKFHFVEKSE-SCAPKCYPKVDVFWSQGDKQFSLVWMAIWSILCFVSSAFTVLTFLIDPQRFKYPERPIIFLSMSYCVYSVGYLIRLFVGADGIACDR-DNGVQYIIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRKVAGDELTGVCYVGSMDVKALTGFVLIPLSCYLIIGTSFLLSGFVALFHIRKVMK-----TEGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWRI-----LAWKQKCV--DGSRPESDECV--MKASIPAIEIFMVKIFMLLVVGITSGMWIWTSK 523          
BLAST of frizzled receptor-like protein vs. Ensembl Medaka
Match: fzd9b (frizzled class receptor 9 [Source:NCBI gene;Acc:101174936])

HSP 1 Score: 352.829 bits (904), Expect = 7.144e-112
Identity = 197/535 (36.82%), Postives = 299/535 (55.89%), Query Frame = 2
Query:  152 DIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNI--------SCAQICS--ANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDI-TLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            D   +C PI  P C  + Y+ T MPN +    Q EA+ + ++F PL++  C  +L+ FLCS+Y PMC   T   S+++  CR +C   +++C P+MK+ F  TW + LDC K P R      P++   +    P N          R      +    G   +    +  D   ++ LP   N  + P+         SCA  CS   +V ++  DK FA IW+  WS+LCF S   T++ F    +RF YPE+PI+FLS+CY  Y+   +  ++ G   +AC   + +  +I+  G E+T C I FL++Y+FG AS++WWV+LT+TWFL+A + WG+EAIE+ S+  H+ +W IPALK+I IL + K+  DELTG C+VG+ ++  L GFV++P   YL IG  F+  G+++L  +R+         +  N ++LEKLM KIG++SILY +P  C IV Y    Y+  N D   L+ L     +    N       KC   L+  +P+V + ML+IFM+LV+GITSG+W+W +K
Sbjct:   36 DRPAKCEPIVIPMCVGIGYNLTRMPNFMDHDDQAEAAIKLQEFAPLVDYGCDVHLRFFLCSLYAPMC---TDKVSTSIPACRPMCEQARDKCAPIMKK-FSYTWPDSLDCSKLPTRND----PNALCMEA---PENET--------RTEGKKDKKKGEGMLPVPPRPRQPDTPSSR-LPGSGNSCENPDKFQFVEKSQSCAPRCSPAVDVYWSRQDKDFAFIWMTVWSILCFVSTAFTVLTFLLEPHRFQYPERPIIFLSMCYMVYSLAFIIRSVAGAENIACDREHGEL-YIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIEAHSNYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDSGALTGFVLIPLSCYLIIGTSFILTGFVALFHIRKVMK-----TEGTNTEKLEKLMVKIGIYSILYTVPATCVIVCYF---YERLNMDYWKLRGLQEECDSFSSHNS------KCS--LETSVPTVAVFMLKIFMSLVVGITSGVWVWSSK 533          
BLAST of frizzled receptor-like protein vs. Ensembl Medaka
Match: fzd7b (frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GENE-990415-229])

HSP 1 Score: 328.561 bits (841), Expect = 4.957e-103
Identity = 188/541 (34.75%), Postives = 273/541 (50.46%), Query Frame = 2
Query:  167 CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERG--KICLTPDSFSQ------------------DEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDIT--LKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            C PI  P C D+ Y+ T MPNL+G  +Q +A      F PL+ ++CS  LK FLCS+Y P+C    ++    + PCR LC   ++ CE LM + F   W E L CE FP  G  +IC+  ++                     + F  P     +SY      LQL +  + +G   + +        GA C P++               S  + F   +  F  +W+  WS+LC  S L T++ +  +  RF YPE+PI+FLS CYF  A     G  L   VV    F  +    V  G +   C I F+++YFFG AS++WWV+L++TWFLSA   WG+EAIE+ S   HL +WA+PA+K+I IL + ++D D LTG CFVG  N   L GFV+ P  +YLFIG  FL  G++SL ++R          D    ++LEKLM +IGVFS+LY +P    I  Y  +     +++ T  ++   RF+  C   N              P+ P   + M++  M +++GITSG W+W  K
Sbjct:   30 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSTELKFFLCSMYAPVC----TVLEQAIPPCRSLCERARQGCEALMNK-FGFQWPERLHCEAFPVNGGSEICVGQNTSEPGSPSSSSPHVPELVTVPPNRFPNPPQPPHNSYHQFSCPLQLEVP-SYLGYRFMGVKD-----CGAPCEPTKP--------------SGIMYFREDEVKFGRLWVGIWSILCCVSTLFTVLTYLVDMRRFRYPERPIIFLSGCYFMVAVAYAAGFFLEDKVVCVDKFKGEGFRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILAMGQVDGDVLTGVCFVGIFNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERTWHMQTCKRFAVPCPVHN------------FAPMTPDFTVFMIKYLMTMIVGITSGFWVWSGK 528          
BLAST of frizzled receptor-like protein vs. Ensembl Medaka
Match: fzd4 (frizzled class receptor 4 [Source:NCBI gene;Acc:101169962])

HSP 1 Score: 321.242 bits (822), Expect = 1.268e-100
Identity = 203/544 (37.32%), Postives = 278/544 (51.10%), Query Frame = 2
Query:  146 FGDIYKQ--CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFP---ERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICS-ANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNK--KTVKSCISTL 1753
            FGD  ++  C PI+   CQ + Y+ T MPNLVG+  Q++A  +   F PLI   CS+ LK FLCSVY PMC     +    + PC  +C  VK +C P++ E F  TW E L+C +FP   +   +C+       DE  P  +    S QD         Q   + Q++                            SC   C   N  +    KVF + W+  W+VLCF S  LT++ F  ++ RF YPE+PI+FLS+C   Y+   L    LGR  V+C         +V  G ++T C I FL++YFFG AS+LWWV+LT+TWFL+A   WG+EAIE  SS  H+ +WAIPA K+I ILI+  +DAD+LTG C+VGN   + L GFV+ P   YL +G +F+  G ++L K+ RS LQ+    D     +LE+LM KIGVFSILY +P    I  Y+        F  +    +                             V   MLRIFM+L++GITSG+WIW  K   T + C S L
Sbjct:   26 FGDEMEEMTCDPIRISMCQGLGYNVTKMPNLVGNMLQSDAELQLTTFTPLIQCGCSSQLKFFLCSVYVPMCTDKVPIP---IGPCGSMCLSVKRKCLPVLLE-FGYTWPEALNCSRFPPQNDHNHMCMEGPG---DEDPPYQSVHHPSDQDCQALDSTPDQYTWLKQTE----------------------------SCVLQCGYDNGLYRRGAKVFTDAWMAVWAVLCFLSTTLTVLTFLLDSQRFSYPERPIIFLSMCCNLYSVAYLVRLTLGRERVSCDLDAVGVPVLVQEGLKSTGCAIVFLLLYFFGMASSLWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAAKTIVILIMRLVDADDLTGLCYVGNQQQEALTGFVVAPLATYLLVGTLFICAGLMALFKI-RSNLQK----DGTKTDKLERLMVKIGVFSILYTVPASTVIGCYLYQLSHWGEFKTSTHDSY-----------------------------VTSEMLRIFMSLLVGITSGMWIWSAKTLHTWQRCSSRL 500          
BLAST of frizzled receptor-like protein vs. Ensembl Medaka
Match: fzd2 (frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GENE-990415-224])

HSP 1 Score: 310.071 bits (793), Expect = 4.205e-96
Identity = 182/528 (34.47%), Postives = 270/528 (51.14%), Query Frame = 2
Query:  167 CVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFP---ERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQIC-----SANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVL-PSVEMRMLRIFMNLVIGITSGIWIWGNK 1723
            C  I  P C D+ Y+ T MPNL+G+++Q +A      F PL+ ++CS  LK FLCS+Y P+C    ++    + PCR +C   ++ CE LM + F   W E+L CE FP   + G+IC+                Q +S             G R    ++  +++         +P  +N        C   C       N+ F+  +  FA +W+L WSVLC  S   T+  +  +  RF YPE+PI+FLS CY   +   + G  LG  V    +FN      V  G +   C I F+M+YFF  AS++WWV+L++TWFL+A   WG+EAIE+ S   HL +WA+PA+K+I IL + +I+ D L+G CFV  SN   L GFV+ P  IYLFIG  FL  G++SL ++R          D    ++LE+LM +IGVFS+LY +P    I  +  +     +++ +       S NC         +I C    +P + P   + M++  M L++GITSG WIW  K
Sbjct:   35 CQQISIPLCTDIAYNQTIMPNLMGNHNQEDAGLEVHQFFPLVKVQCSPELKFFLCSMYAPVC----TVLEKPIPPCRPICEKARQGCEALMNK-FGFQWPEKLRCENFPLLGDHGQICV---------------GQNESSSPTAPPPLPPAPGTR-ELPRVSTHERPFTCPSVLRVPPYLNYHFLEEKDCGAPCESPRNGGNMFFSDKEIHFARMWVLIWSVLCCTSTFFTVTTYLIDMQRFRYPERPIIFLSGCYTMVSIAFIAGYFLGDKVACNDSFNPDGYKTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTISILAMGQIEGDVLSGVCFVSLSNLDPLRGFVLAPLFIYLFIGTSFLLAGFVSLFRIRTIMKH-----DGTKTEKLEQLMVRIGVFSVLYTVPATIVIACFFYEQAFRPHWERSW-----VSRNCRSL------AIPCPAQSRPHMTPDFTVYMIKYLMTLIVGITSGFWIWSGK 525          
BLAST of frizzled receptor-like protein vs. Planmine SMEST
Match: SMESG000004519.1 (SMESG000004519.1)

HSP 1 Score: 1257.66 bits (3253), Expect = 0.000e+0
Identity = 617/617 (100.00%), Postives = 617/617 (100.00%), Query Frame = 2
Query:   80 MTKTVLILICISGFINIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFWXXXXXXXPTPTNQCDSSTIQNNIPLSQTKQKETLLPYHDWKLNSSYPVVVEYGLPT 1930
            MTKTVLILICISGFINIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTIQNNIPLSQTKQKETLLPYHDWKLNSSYPVVVEYGLPT
Sbjct:    1 MTKTVLILICISGFINIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTIQNNIPLSQTKQKETLLPYHDWKLNSSYPVVVEYGLPT 617          
BLAST of frizzled receptor-like protein vs. Planmine SMEST
Match: SMESG000038967.1 (SMESG000038967.1)

HSP 1 Score: 357.066 bits (915), Expect = 5.522e-113
Identity = 197/574 (34.32%), Postives = 311/574 (54.18%), Query Frame = 2
Query:   56 IIRFCHISMTKTVLILICISGFINIINGRRFGDIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIG-------QTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTN-RFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTD--FIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRP-----DCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTV 1732
            ++ FC + + K   IL          +     D+Y +C  I +  CQ + Y  T MPN VG  +Q +++KR  D+ PLIN +CS Y + FLC+ YFPMC TD    + T+ PCR +C  V+ RCEP MK  FKL W  EL+C+KFP   +IC+ P ++  D       +  D  +  Y K + +   +  G  K    +     +  +CL S V++        ++ + SC   C +N+ +++ DK  A IW   W++LC  S ++ I  F  +   RFLYPE+PI+F+ +CY      NLF   L R  + C+  +   +   ++  G E+  C + FL +Y+F   +ALWW++L I+ +L++ R W  E +E IS+ +H+VSW +PA+ +  +LILHKID DEL G C+VG  N++    F+++P ++   +G V L + + SL+ +R++          D I   N + LEK +AK G+F  +Y +P+ C I   +     +  ++            C+ + G+ WS   C++ L   LP VE+R+L IF  LVIGITSG+W+W NKKT+
Sbjct:    9 VVLFCFLKLHKLSAILF--------KSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMC-TDMLGETKTLLPCREMCEKVQIRCEPFMK-AFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVD--GNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQ--NQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGLP--LPLVEVRLLEIFSTLVIGITSGMWMWCNKKTL 566          
BLAST of frizzled receptor-like protein vs. Planmine SMEST
Match: SMESG000038967.1 (SMESG000038967.1)

HSP 1 Score: 338.191 bits (866), Expect = 2.125e-106
Identity = 184/519 (35.45%), Postives = 289/519 (55.68%), Query Frame = 2
Query:  221 MPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIG-------QTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTN-RFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTD--FIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRP-----DCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTV 1732
            MPN VG  +Q +++KR  D+ PLIN +CS Y + FLC+ YFPMC TD    + T+ PCR +C  V+ RCEP MK  FKL W  EL+C+KFP   +IC+ P ++  D       +  D  +  Y K + +   +  G  K    +     +  +CL S V++        ++ + SC   C +N+ +++ DK  A IW   W++LC  S ++ I  F  +   RFLYPE+PI+F+ +CY      NLF   L R  + C+  +   +   ++  G E+  C + FL +Y+F   +ALWW++L I+ +L++ R W  E +E IS+ +H+VSW +PA+ +  +LILHKID DEL G C+VG  N++    F+++P ++   +G V L + + SL+ +R++          D I   N + LEK +AK G+F  +Y +P+ C I   +     +  ++            C+ + G+ WS   C++ L   LP VE+R+L IF  LVIGITSG+W+W NKKT+
Sbjct:    1 MPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMC-TDMLGETKTLLPCREMCEKVQIRCEPFMK-AFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVD--GNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQ--NQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGLP--LPLVEVRLLEIFSTLVIGITSGMWMWCNKKTL 511          
BLAST of frizzled receptor-like protein vs. Planmine SMEST
Match: SMESG000005043.1 (SMESG000005043.1)

HSP 1 Score: 294.664 bits (753), Expect = 1.483e-89
Identity = 201/599 (33.56%), Postives = 296/599 (49.42%), Query Frame = 2
Query:  164 QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTDF-IVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCI-GRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKSCISTLRFWXXX-------------XXXXPTPTNQCDSSTIQNNIPLSQTKQKETLL---PYHDWKLNSSYPV 1906
            +CVPI  P C+++ Y+ T MPN     +Q EA      F PL+ I CS+ L+LFLCS+Y P+C  +       ++ CR +C   ++ C P+M  T+   W + +DC+K  E  + CL  D+  ++   PP+   E   +  Y                  IY             + V  G   N  C Q C +   F + DK F   WL  W+VLC  S   T++ F  + +RF YPE+PIVFLS CY   + G +    +G  ++AC    DK  +   G  R    C I FL+IYFFG A+++WWV+LTITWFLSA   WG EAI   S + H ++W +  +KSI  L L  ID D + G C++GN+N+  L  F+IVP  +YL IG  FL  G+I+L+ +R++   + +    +   +LEKLM +IG+F +LY +P    I  ++        +++  +  +  S NC   RN      IK  E      P   + ML+ FM LV+GITSG WIW   KT+ S  +  R   +                E+ TP  Q +S+ I N  P+ Q    +T L     H   L + +P+
Sbjct:   58 KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWP---KPIQACRSVCESARDGCAPVM-NTYGFKWPKSMDCDKLTEN-QACLKKDT--KNVTKPPSKGCECKCRSPY------------------IYDNKPQF-------NSVITGGVAN--CFQSCHS-ANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDG--DKLRYGTTGPAR----CSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGE----SKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHL--------YEVKNREFWEKSNNCYCNRN------IKSQENFSK--PEYSVFMLKYFMCLVVGITSGFWIW-TSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQETPLCQINSNQITNGKPIEQCLVNQTALINPATHTGNLYTQHPM 594          
BLAST of frizzled receptor-like protein vs. Planmine SMEST
Match: SMESG000035834.1 (SMESG000035834.1)

HSP 1 Score: 295.819 bits (756), Expect = 1.116e-88
Identity = 188/547 (34.37%), Postives = 288/547 (52.65%), Query Frame = 2
Query:  164 QCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLM-KETFKLTWSEELDCEKFPERGK----ICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQC---LP----SEVNIGQTPNIS------CAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKT----DFIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTVKS 1738
            +C  IK P C+D+HY+ T MPN+    +Q EA      F PL+ IKCS  L+ FLCS+Y P+C      S   + PCR +C  VK+ C+PL+ K TFK  W E+++C++FP        +C+  +  +         +     Q+     Q+  Q N + +   ++ ++ +  V  QC    P    +E+N      +S      CAQ C +    +  D+ F   WL  W+++C  S    +  FS +  R+ YPE+PI+F+SICYF  + G L   ++G   +AC +   K       +   G     C I FL+IY+FG A++LWWV+LTITWFL+A   WG EAI   S + H ++W +P +KSI  L +  +D D ++G C+VGN+++  L  FV+ P ++YL IG + L  G+ SL ++ RS ++      T   ++LEKLM +IGVFS+LY  P    IV+ I+  Y++ N     + L   S +C   N            L    PS  + M + FM + +G+TSG WIW +KKT+ S
Sbjct:   42 KCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKS---LPPCRSVCERVKKGCDPLLQKYTFK--WPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVVTLAPKEQNDANSRQVAEQ-NLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDSIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRI-RSIIKLQTGGKT---EKLEKLMIRIGVFSVLYTAPA-AVIVACII--YELQNRAEWYQNL---SCDCFDSNR---------HQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIW-SKKTILS 562          
The following BLAST results are available for this feature:
BLAST of frizzled receptor-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FZD102.332e-11536.96frizzled class receptor 10 [Source:HGNC Symbol;Acc... [more]
FZD42.580e-11337.94frizzled class receptor 4 [Source:HGNC Symbol;Acc:... [more]
FZD93.976e-10837.31frizzled class receptor 9 [Source:HGNC Symbol;Acc:... [more]
FZD71.139e-9833.76frizzled class receptor 7 [Source:HGNC Symbol;Acc:... [more]
FZD12.114e-9734.87frizzled class receptor 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of frizzled receptor-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mom-51.210e-7830.89pep chromosome:WBcel235:I:9965580:9970037:1 gene:W... [more]
mom-58.204e-7831.07pep chromosome:WBcel235:I:9965580:9969413:1 gene:W... [more]
lin-177.685e-7228.73Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-177.685e-7228.73Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-177.685e-7228.73Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
back to top
BLAST of frizzled receptor-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fz1.553e-8030.94gene:FBgn0001085 transcript:FBtr0075743[more]
fz2.383e-8030.94gene:FBgn0001085 transcript:FBtr0330102[more]
fz29.356e-6738.20gene:FBgn0016797 transcript:FBtr0112890[more]
fz29.356e-6738.20gene:FBgn0016797 transcript:FBtr0075029[more]
fz29.356e-6738.20gene:FBgn0016797 transcript:FBtr0332735[more]
back to top
BLAST of frizzled receptor-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd102.566e-11938.77frizzled class receptor 10 [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9a7.419e-11437.33frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9a1.180e-11337.33frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
BX322606.11.466e-11337.33pep chromosome:GRCz11:CHR_ALT_CTG5_1_52:56018527:5... [more]
fzd9b4.518e-11237.09frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of frizzled receptor-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FZD97.563e-11736.72frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
FZD42.557e-11036.86frizzled class receptor 4 [Source:NCBI gene;Acc:10... [more]
fzd87.533e-10035.14frizzled class receptor 8 [Source:NCBI gene;Acc:10... [more]
ntrk12.766e-9935.71neurotrophic receptor tyrosine kinase 1 [Source:Xe... [more]
zdhhc94.558e-9835.96zinc finger DHHC-type containing 9 [Source:Xenbase... [more]
back to top
BLAST of frizzled receptor-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fzd101.154e-11436.03frizzled class receptor 10 [Source:MGI Symbol;Acc:... [more]
Fzd41.146e-11137.59frizzled class receptor 4 [Source:MGI Symbol;Acc:M... [more]
Fzd92.217e-11137.16frizzled class receptor 9 [Source:MGI Symbol;Acc:M... [more]
Fzd76.111e-10133.89frizzled class receptor 7 [Source:MGI Symbol;Acc:M... [more]
Fzd23.753e-9734.16frizzled class receptor 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of frizzled receptor-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9PWH2|FZD10_CHICK9.626e-11737.75Frizzled-10 OS=Gallus gallus OX=9031 GN=FZD10 PE=1... [more]
sp|Q9DEB5|FZ10A_XENLA6.381e-11638.60Frizzled-10-A OS=Xenopus laevis OX=8355 GN=fzd10-a... [more]
sp|Q9W742|FZ10B_XENLA8.609e-11538.17Frizzled-10-B OS=Xenopus laevis OX=8355 GN=fzd10-b... [more]
sp|Q9ULW2|FZD10_HUMAN1.120e-11436.96Frizzled-10 OS=Homo sapiens OX=9606 GN=FZD10 PE=1 ... [more]
sp|Q8BKG4|FZD10_MOUSE8.069e-11436.03Frizzled-10 OS=Mus musculus OX=10090 GN=Fzd10 PE=1... [more]
back to top
BLAST of frizzled receptor-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B1NWW00.000e+099.83Frizzled receptor-like protein (Fragment) OS=Schmi... [more]
T1DF930.000e+061.91Fzd-4-1b OS=Dendrocoelum lacteum OX=27895 PE=2 SV=... [more]
T1E1F02.266e-17261.70Fzd-4-1a (Fragment) OS=Dendrocoelum lacteum OX=278... [more]
A0A183SYX61.171e-13638.45Frizzled-10-A OS=Schistocephalus solidus OX=70667 ... [more]
A0A0V0J3C81.585e-13638.45Frizzled-10-A OS=Schistocephalus solidus OX=70667 ... [more]
back to top
BLAST of frizzled receptor-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd9a4.992e-11534.72frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9b8.690e-11337.86frizzled-9 [Source:NCBI gene;Acc:103027133][more]
fzd101.065e-10936.90frizzled class receptor 10 [Source:ZFIN;Acc:ZDB-GE... [more]
fzd41.083e-10736.57frizzled class receptor 4 [Source:NCBI gene;Acc:10... [more]
fzd7b7.791e-10435.01frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of frizzled receptor-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd21.554e-9835.34frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
fzd7a9.326e-9634.32frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000011009.12.579e-9033.02pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gen... [more]
fzd8a1.140e-5934.00frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd3b2.650e-3830.84frizzled class receptor 3b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of frizzled receptor-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of frizzled receptor-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO385673.655e-11034.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357516.715e-9734.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429321.419e-9133.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308651.205e-8433.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401195.748e-2823.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of frizzled receptor-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd103.461e-11537.52frizzled class receptor 10 [Source:NCBI gene;Acc:1... [more]
fzd9b7.144e-11236.82frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
fzd7b4.957e-10334.75frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd41.268e-10037.32frizzled class receptor 4 [Source:NCBI gene;Acc:10... [more]
fzd24.205e-9634.47frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of frizzled receptor-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004519.10.000e+0100.00SMESG000004519.1[more]
SMESG000038967.15.522e-11334.32SMESG000038967.1[more]
SMESG000038967.12.125e-10635.45SMESG000038967.1[more]
SMESG000005043.11.483e-8933.56SMESG000005043.1[more]
SMESG000035834.11.116e-8834.37SMESG000035834.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006583
GenBankABW97516.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006583 ID=SMED30006583|Name=frizzled receptor-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2308bp
TATAAATAAATGAAATTGTATGTGTATTAATTTATATTTATACATATATA
AAACAATTATCAGATTCTGTCACATAAGTATGACGAAAACTGTCCTTATT
TTAATTTGTATTTCTGGATTCATTAACATTATCAATGGAAGAAGATTTGG
GGATATTTACAAACAATGTGTCCCAATTAAAGAGCCGGAATGTCAAGATG
TTCATTATTCAAACACGAGTATGCCGAATTTAGTTGGAAGCTATTCACAG
ACCGAAGCGAGCAAACGGTTCAGAGATTTCAATCCGTTGATCAACATCAA
ATGCAGCAATTATTTGAAACTTTTTCTCTGTTCTGTCTATTTTCCCATGT
GTGAAACCGACACCTCAATGTCGTCATCGACAGTGAAACCTTGCCGACAT
CTATGCAATCATGTTAAAGAACGATGCGAACCGTTGATGAAAGAAACATT
CAAGTTGACATGGTCCGAAGAATTGGACTGTGAAAAATTTCCGGAACGAG
GAAAAATCTGCCTGACTCCGGATTCCTTTTCCCAAGACGAATTCCATCCG
CCGGCAAACAGTCAGGAGGACAGCTATCAAGACCTATATAGAAAGCTCCA
GCTCGTTATGCAAGGAAATCGAATTGGTCAATCAAAACTCGAGATTTATC
AAAAAATGAGCGACATGGTTGGAGCGCAGTGCTTGCCGTCAGAGGTCAAC
ATTGGACAAACTCCGAACATTTCTTGCGCTCAAATCTGCTCGGCAAATGT
CCAGTTCAATGCCCATGATAAAGTCTTTGCGAATATTTGGCTGCTAGGTT
GGTCGGTACTTTGTTTCTTTTCTTGTTTGTTGACTATCATTGTATTCTCT
TGCAACACGAATCGGTTTCTTTATCCGGAAAAGCCGATTGTTTTTCTTTC
TATTTGCTATTTTTTTTATGCCAGTGGAAACCTGTTTGGGGCGATTTTGG
GTCGAAATGTCGTTGCTTGTCGAGCCTTTAATGATAAAACAGATTTCATT
GTCGGCTCCGGTAGAGAGACCACTTGGTGTAAGATTAACTTTTTGATGAT
TTACTTTTTCGGTTCCGCCAGTGCCTTATGGTGGGTCGTACTGACGATTA
CTTGGTTTCTTTCGGCCTCTCGACATTGGGGATACGAAGCCATTGAATCC
ATTAGCAGCATGCTCCATTTGGTGAGTTGGGCTATTCCAGCGTTGAAGTC
AATTTTTATTCTTATTCTCCACAAAATCGACGCCGATGAGTTGACGGGAC
AATGTTTTGTTGGAAACAGTAACAACAAAGTTCTTTGGGGCTTTGTTATT
GTACCAAACATGATTTATTTGTTTATAGGAATTGTGTTTTTAACTATGGG
ATATATTTCTTTGTTAAAGGTTCGTCGTTCATTTTTGCAGAGGCCGGATT
GCATTGACACGAACAATTTAAAGCGTCTTGAAAAGCTAATGGCTAAAATT
GGGGTTTTCTCAATTCTTTATGTCTTGCCTGTTTTGTGCACCATCGTAAG
TTACATTGTTGATGCGTACAAAATGACGAATTTTGATATCACACTCAAAG
CACTATTTCGGTTTTCACCGAATTGCATTGGCCGCAATGGGATCAACTGG
TCAAGCATTAAATGCGTTGAAATTTTACAGCCGGTCCTACCATCAGTTGA
GATGCGCATGTTGAGGATTTTCATGAATTTAGTCATCGGAATCACTTCCG
GTATTTGGATTTGGGGCAACAAAAAAACCGTTAAATCTTGCATTTCAACG
CTTCGATTCTGGGAAAAGAAAAAAGAAGAAGAACCGACCCCAACCAATCA
ATGCGATTCGTCGACAATCCAAAACAATATTCCTTTGTCTCAGACAAAAC
AAAAGGAAACACTGTTGCCTTATCACGATTGGAAGTTAAATTCCTCATAT
CCCGTTGTTGTTGAATACGGCTTGCCAACTGTTTCAGTACCGAGTGATAT
TGTACCCCCTCCAAATAATTCTTCAATCAGTGATGATTCAAGCAGACATT
GAAAAATTTGATCTCTCATTTAATAATTCATTTTCAGACAAATAAAAGAA
TTTACCAAGTTCTTTTCACCCATAAAGAATACGTACCACACGAGTCGTTT
CCTACTGCATCTAGCGTTTTTTTTCTATTTTGAGATTAAACTTATTAAAA
AAAAGATCTGAGGTAAAAAAAATTGAACTAAACGAAAAACTACTTTCAAT
TTTGTGATATATTCTCCTTGTATTTTTATTTTTTTTGGTTTTATTTTTTT
TGAAATTCATGAAAAATTCTGTATTTTCTTAATTTGTAGATTTAGAGATT
CGGCGGAG
back to top

protein sequence of SMED30006583-orf-1

>SMED30006583-orf-1 ID=SMED30006583-orf-1|Name=SMED30006583-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=661bp
MCINLYLYIYKTIIRFCHISMTKTVLILICISGFINIINGRRFGDIYKQC
VPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLK
LFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSE
ELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGN
RIGQSKLEIYQKMSDMVGAQCLPSEVNIGQTPNISCAQICSANVQFNAHD
KVFANIWLLGWSVLCFFSCLLTIIVFSCNTNRFLYPEKPIVFLSICYFFY
ASGNLFGAILGRNVVACRAFNDKTDFIVGSGRETTWCKINFLMIYFFGSA
SALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILIL
HKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLK
VRRSFLQRPDCIDTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAY
KMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRI
FMNLVIGITSGIWIWGNKKTVKSCISTLRFWEKKKEEEPTPTNQCDSSTI
QNNIPLSQTKQKETLLPYHDWKLNSSYPVVVEYGLPTVSVPSDIVPPPNN
SSISDDSSRH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000421tail
PLANA:0007525posterior pole
Vocabulary: INTERPRO
TermDefinition
IPR036790Frizzled_dom_sf
IPR015526Frizzled/SFRP
IPR017981GPCR_2-like
IPR000539Frizzled/Smoothened_TM
IPR020067Frizzled_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007166cell surface receptor signaling pathway
GO:0007275multicellular organism development
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004888transmembrane signaling receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000539Frizzled/Smoothened, transmembrane domainPRINTSPR00489FRIZZLEDcoord: 339..363
score: 55.36
coord: 382..405
score: 40.5
coord: 427..449
score: 40.7
coord: 473..494
score: 44.73
coord: 257..279
score: 32.17
coord: 545..565
score: 41.52
coord: 285..307
score: 44.87
IPR000539Frizzled/Smoothened, transmembrane domainSMARTSM01330Frizzled_2coord: 244..577
e-value: 7.2E-111
score: 384.3
IPR000539Frizzled/Smoothened, transmembrane domainPFAMPF01534Frizzledcoord: 246..573
e-value: 4.6E-96
score: 321.7
IPR020067Frizzled domainSMARTSM00063FRI_4coord: 49..169
e-value: 4.6E-37
score: 139.1
IPR020067Frizzled domainPFAMPF01392Fzcoord: 50..160
e-value: 5.9E-27
score: 94.5
IPR020067Frizzled domainPROSITEPS50038FZcoord: 50..167
score: 21.31
IPR036790Frizzled cysteine-rich domain superfamilyGENE3DG3DSA:1.10.2000.10coord: 44..166
e-value: 1.4E-34
score: 121.1
IPR036790Frizzled cysteine-rich domain superfamilySUPERFAMILYSSF63501Frizzled cysteine-rich domaincoord: 49..161
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 221..581
e-value: 2.6E-96
score: 324.5
NoneNo IPR availablePANTHERPTHR11309:SF99FRIZZLED-3coord: 50..581
NoneNo IPR availableCDDcd159097tmF_FZD4_9_10-likecoord: 244..579
e-value: 8.30349E-167
score: 477.953
NoneNo IPR availableTMHMMTMhelixcoord: 379..401
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 545..567
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 477..499
NoneNo IPR availableTMHMMTMhelixcoord: 256..278
NoneNo IPR availableTMHMMTMhelixcoord: 421..443
NoneNo IPR availableTMHMMTMhelixcoord: 344..366
IPR015526Frizzled/secreted frizzled-related proteinPANTHERPTHR11309FRIZZLEDcoord: 50..581
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 251..572
score: 28.855