Apoptosis inhibitor 5

Overview
NameApoptosis inhibitor 5
Smed IDSMED30006576
Length (bp)1586
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Apoptosis inhibitor 5 (SMED30006576) t-SNE clustered cells

Violin plots show distribution of expression levels for Apoptosis inhibitor 5 (SMED30006576) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Apoptosis inhibitor 5 (SMED30006576) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Apoptosis inhibitor 5 (SMED30006576) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006576

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006576SMESG000000547.1 SmedASXL_009495SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006576SMESG000000547.1 SmedASXL_009495SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30006576SMESG000000547.1 dd_Smed_v4_2384_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006576SMESG000000547.1 dd_Smed_v4_2384_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006576SMESG000000547.1 dd_Smed_v4_2384_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006576SMESG000000547.1 dd_Smed_v4_2384_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006576SMESG000000547.1 dd_Smed_v4_2384_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Apoptosis inhibitor 5 vs. Ensembl Human
Match: API5 (apoptosis inhibitor 5 [Source:HGNC Symbol;Acc:HGNC:594])

HSP 1 Score: 224.172 bits (570), Expect = 3.098e-66
Identity = 162/491 (32.99%), Postives = 265/491 (53.97%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQK 1473
            P+V++LY NY I+ +  E+  + K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  D     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    N +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +                 +F G+  ++ +    +  +D+LL   P+P E      N  +E+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+      KR S +  + +P K
Sbjct:    2 PTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--ENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLGTLTTPVEGLDIQLEVLKLLAEM---------------SSFCGD--MEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKVEIGQKRASEDTTSGSPPK 467          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Human
Match: API5 (apoptosis inhibitor 5 [Source:HGNC Symbol;Acc:HGNC:594])

HSP 1 Score: 224.172 bits (570), Expect = 3.995e-66
Identity = 163/492 (33.13%), Postives = 264/492 (53.66%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDA-STQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQK 1473
            P+V++LY NY I+ +  E+  + K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  D     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    N +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +  +   + +   T + KL                  +D+LL   P+P E      N  +E+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+      KR S +  + +P K
Sbjct:    2 PTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--ENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLGTLTTPVEGLDIQLEVLKLLAEMSSFCGDMEKLETNLRKL------------------FDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKVEIGQKRASEDTTSGSPPK 467          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Human
Match: API5 (apoptosis inhibitor 5 [Source:HGNC Symbol;Acc:HGNC:594])

HSP 1 Score: 224.172 bits (570), Expect = 5.388e-66
Identity = 162/491 (32.99%), Postives = 265/491 (53.97%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQK 1473
            P+V++LY NY I+ +  E+  + K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  D     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    N +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +                 +F G+  ++ +    +  +D+LL   P+P E      N  +E+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+      KR S +  + +P K
Sbjct:    2 PTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--ENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLGTLTTPVEGLDIQLEVLKLLAEM---------------SSFCGD--MEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKVEIGQKRASEDTTSGSPPK 467          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Human
Match: API5 (apoptosis inhibitor 5 [Source:HGNC Symbol;Acc:HGNC:594])

HSP 1 Score: 207.994 bits (528), Expect = 5.338e-60
Identity = 156/472 (33.05%), Postives = 250/472 (52.97%), Query Frame = 1
Query:   97 SKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDA-STQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQK 1473
             K K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  D     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    N +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +  +   + +   T + KL                  +D+LL   P+P E      N  +E+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+      KR S +  + +P K
Sbjct:   11 GKHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--ENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLGTLTTPVEGLDIQLEVLKLLAEMSSFCGDMEKLETNLRKL------------------FDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKVEIGQKRASEDTTSGSPPK 456          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Human
Match: API5 (apoptosis inhibitor 5 [Source:HGNC Symbol;Acc:HGNC:594])

HSP 1 Score: 144.821 bits (364), Expect = 2.258e-37
Identity = 123/415 (29.64%), Postives = 212/415 (51.08%), Query Frame = 1
Query:  265 IRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQK 1473
            IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  D     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    N +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +  +               F G+  ++ +    +  +D+LL   P+P E      N  +E+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+      KR S +  + +P K
Sbjct:   24 IRRQAIKELPQFATG--ENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLGTLTTPVEGLDIQLEVLKLLAEMSS---------------FCGD--MEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKVEIGQKRASEDTTSGSPPK 413          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Fly
Match: cass (gene:FBgn0286781 transcript:FBtr0081001)

HSP 1 Score: 184.882 bits (468), Expect = 1.264e-51
Identity = 148/472 (31.36%), Postives = 235/472 (49.79%), Query Frame = 1
Query:   40 SVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKINTDAKFLTL-------LLNCKQAAK-LVSKNVHAXXXXXXXXXXXXXIVK---MAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLLPVPEEVTPEVLNTHSEDTNKLKELECILLATYNLCKFRPEAMNMNEDT--LKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLP 1407
            +++ LY  Y+I++   ++ S+    Y+ ILK V G  KEKRLASQFI NFFK FP L + + +   DLCEDD+  IR+Q I+ L  + +   +   ++ DTL Q+LI DD TE+  + ++L  +IKLD K +   +F Q+ T  E + E       K++  K  T        EIE  +     K L  ++  DEF   + IL A K  ST+TG  +LV    EQA+L    NTDA  + +        + C  AA    SK + +   +  + D L  I     +A +V   ++   +LK   + +  T   D +++              IN V+ +   + +P+P+    ++ +T    + +    EC+L A + L K  P +++  ED   LK F+ RLQ+L R  Q   KK  +++   +  EL   EN+ K   +K T+N+ IL+R+ F + P FK  I  SW +P
Sbjct:    3 NIERLYKCYEILSEAGDKISEHVDEYKEILKAVKGTSKEKRLASQFIGNFFKHFPDLADTAIDAQFDLCEDDDTQIRRQAIKDLPKLCQGNADATIRVGDTLAQLLILDDPTELQQVNNSLLAIIKLDTKSSIAGLFQQISTGDETTRER----CLKFIATKLLTMGPTVITKEIEDYIVEEIKKALQDVTA-DEFHLCMTILGATKLGSTITGHAELVKLATEQAEL---NNTDADIIAVDDEVVERFIQCASAAAPYFSKTIKSTAFVAHVCDKLLPIKTWNMIATAVSQDQIQLRLLKVFAEMITNTDKLDNASER-------------INAVYNVLL-EYMPLPKLSDEDLGDTPP--SFQFSHAECLLYALHTLGKNHPNSLSFVEDAEKLKDFRARLQYLARGTQGYIKKLEESLKGKTGEELKTEENQLKQTALKTTSNINILIRDLFHSPPIFKHDIVLSWIVP 450          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Zebrafish
Match: api5 (apoptosis inhibitor 5 [Source:ZFIN;Acc:ZDB-GENE-030131-395])

HSP 1 Score: 206.068 bits (523), Expect = 2.160e-59
Identity = 153/474 (32.28%), Postives = 253/474 (53.38%), Query Frame = 1
Query:   40 SVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFST--ENDFKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXXXXXXXXIVKMAKSVEGSKLCD-ILKCLVDFLNRTQNQDASTQISKL-----NFKGE-DGLKC-INNVFQICYDQLLPVPEEVTPEVLNTHSEDTNKLKELECILLATYNLCKFRPEAM--NMNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETT 1419
            +V++LY NY I+ +  E+ S  K AY+ IL GV G  KEKRLA+QFI  FF  FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E + + +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  E+    E+E  +     K+L  ++G +EF  ++ ILS LKS  T++GRQ+LV  ++EQA L   +N  D   +  LL C +QA  L SKNVH+   +                   +  C+ +L  L    +     D   ++ KL      + G+ D L+  +N +F+    + +P+P E        + E   +   +EC+L + + L K  P+ +   ++ + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+ T
Sbjct:    4 TVEELYRNYGILADAKEDLSTHKDAYQVILDGVKGGAKEKRLAAQFIPKFFSSFPELADAAINAQLDLCEDEDVSIRRQAIKELPRFASG--ENLPRVADILTQLLQTDDSAEFNQVNTALISIFKIDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTMPEDIMTKEVEDYIFVETKKVLEDVTG-EEFVLLMRILSGLKSMQTVSGRQQLVELVVEQAFLEQALNPADTDSVDRLLQCTRQALPLFSKNVHSTRFV-------------------TYFCEFVLPNLSQLTSPVAELDIQLEVLKLLAEMSPYCGDMDKLEVNLNMLFEKLL-EFMPLPPEEENGENAANEEPKLQFSYVECLLFSFHQLGKKLPDFLIDKVSAEKLKDFKIRLQYFARGLQVYIRQLRVALQGKTGDALKTDENKIKVVALKITNNINVLIKDLFHNPPSYKSTVTLSWK-PVQKT 449          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Xenopus
Match: API5 (apoptosis inhibitor 5 [Source:NCBI gene;Acc:100380157])

HSP 1 Score: 227.254 bits (578), Expect = 3.083e-67
Identity = 165/497 (33.20%), Postives = 267/497 (53.72%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXXXXXXXXIVKMAKSVEGSKLCD-ILKCLVDFLNRTQNQDASTQISKL-----NFKGE-DGLKC-INNVFQICYDQLLPVPEEVTPEVLNTHSEDTNKLKELECILLATYNLCKFRPEAM--NMNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQKSKPI 1485
            P+V++LY NY I+ +  ++  + KSAY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED+ V IR+Q I+ LS  A    E +P++AD LTQ+L +DD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L  K  T  D     E++  + +   K+L  ++G +EF   + ILSALK+  T++GRQ+LV  + EQA L   +N  D   +  LL C +QA  L SKNVH+   +                   +  C+ +L  L    +  +  D   ++ KL     +F G+ D L+  +N +F    + +   PEEV       + E   +   +EC+L + + L +  P+ +   ++ + LK FK+RLQ+  R  Q   ++   A+   S   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+ T S  KR S    + +P K KPI
Sbjct:    2 PTVEELYRNYGILADAKDDVGQHKSAYQVILDGVKGGAKEKRLAAQFIPKFFKHFPELSDAALNAQLDLCEDEEVSIRRQAIKELSQFATG--ENLPRVADILTQLLQSDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLATKMKTLPDEILTKEVDDYIFSESKKVLYDVTG-EEFVLFMKILSALKNLQTVSGRQQLVDLVSEQAGLHQSLNPADPDSVDRLLQCMRQAVPLFSKNVHSTKFV-------------------TYFCEQVLPILSSLTSPAEGIDVQLEVLKLLAEMSSFCGDMDKLESNLNKLFDKLLEFMPLPPEEVENGDSAANEEPKLQFSYVECLLFSFHQLGRKLPDFLIAKVDAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKSGDALKTEENKIKVVALKITNNINVLIKDLFHNPPSYKSTVTLSWK-PVQKTDSGQKRTSDETSSSSPPK-KPI 470          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Xenopus
Match: API5 (apoptosis inhibitor 5 [Source:NCBI gene;Acc:100380157])

HSP 1 Score: 220.32 bits (560), Expect = 1.377e-64
Identity = 165/505 (32.67%), Postives = 267/505 (52.87%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXXXXXXXXIVKMAKSVEGSKLCD-ILKCLVDFLNRTQNQDASTQISKL-----NFKGE-DGLKC-INNVFQICYDQLLPVPEEVTPEVLNTHSEDTNKLKELECILLATYNLCKFRPEAM--NMNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVT--------KRLSSNNENPTPQKSKPI 1485
            P+V++LY NY I+ +  ++  + KSAY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED+ V IR+Q I+ LS  A    E +P++AD LTQ+L +DD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L  K  T  D     E++  + +   K+L  ++G +EF   + ILSALK+  T++GRQ+LV  + EQA L   +N  D   +  LL C +QA  L SKNVH+   +                   +  C+ +L  L    +  +  D   ++ KL     +F G+ D L+  +N +F    + +   PEEV       + E   +   +EC+L + + L +  P+ +   ++ + LK FK+RLQ+  R  Q   ++   A+   S   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+ T S T         R S    + +P K KPI
Sbjct:    2 PTVEELYRNYGILADAKDDVGQHKSAYQVILDGVKGGAKEKRLAAQFIPKFFKHFPELSDAALNAQLDLCEDEEVSIRRQAIKELSQFATG--ENLPRVADILTQLLQSDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLATKMKTLPDEILTKEVDDYIFSESKKVLYDVTG-EEFVLFMKILSALKNLQTVSGRQQLVDLVSEQAGLHQSLNPADPDSVDRLLQCMRQAVPLFSKNVHSTKFV-------------------TYFCEQVLPILSSLTSPAEGIDVQLEVLKLLAEMSSFCGDMDKLESNLNKLFDKLLEFMPLPPEEVENGDSAANEEPKLQFSYVECLLFSFHQLGRKLPDFLIAKVDAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKSGDALKTEENKIKVVALKITNNINVLIKDLFHNPPSYKSTVTLSWK-PVQKTDSGTPGLHVVGSGRTSDETSSSSPPK-KPI 478          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Xenopus
Match: API5 (apoptosis inhibitor 5 [Source:NCBI gene;Acc:100380157])

HSP 1 Score: 218.779 bits (556), Expect = 8.168e-64
Identity = 158/481 (32.85%), Postives = 258/481 (53.64%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXXXXXXXXIVKMAKSVEGSKLCD-ILKCLVDFLNRTQNQDASTQISKL-----NFKGE-DGLKC-INNVFQICYDQLLPVPEEVTPEVLNTHSEDTNKLKELECILLATYNLCKFRPEAM--NMNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKR 1437
            P+V++LY NY I+ +  ++  + KSAY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED+ V IR+Q I+ LS  A    E +P++AD LTQ+L +DD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L  K  T  D     E++  + +   K+L  ++G +EF   + ILSALK+  T++GRQ+LV  + EQA L   +N  D   +  LL C +QA  L SKNVH+   +                   +  C+ +L  L    +  +  D   ++ KL     +F G+ D L+  +N +F    + +   PEEV       + E   +   +EC+L + + L +  P+ +   ++ + LK FK+RLQ+  R  Q   ++   A+   S   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+ T S   R
Sbjct:    2 PTVEELYRNYGILADAKDDVGQHKSAYQVILDGVKGGAKEKRLAAQFIPKFFKHFPELSDAALNAQLDLCEDEEVSIRRQAIKELSQFATG--ENLPRVADILTQLLQSDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLATKMKTLPDEILTKEVDDYIFSESKKVLYDVTG-EEFVLFMKILSALKNLQTVSGRQQLVDLVSEQAGLHQSLNPADPDSVDRLLQCMRQAVPLFSKNVHSTKFV-------------------TYFCEQVLPILSSLTSPAEGIDVQLEVLKLLAEMSSFCGDMDKLESNLNKLFDKLLEFMPLPPEEVENGDSAANEEPKLQFSYVECLLFSFHQLGRKLPDFLIAKVDAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKSGDALKTEENKIKVVALKITNNINVLIKDLFHNPPSYKSTVTLSWK-PVQKTDSGAAR 455          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Mouse
Match: Api5 (apoptosis inhibitor 5 [Source:MGI Symbol;Acc:MGI:1888993])

HSP 1 Score: 225.713 bits (574), Expect = 6.512e-67
Identity = 162/494 (32.79%), Postives = 266/494 (53.85%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQKSKP 1482
            P+V++LY NY I+ +  E+  + K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  D     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    + +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +                 +F G+  ++ +    +  +D+LL   P+P E      N  +E+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+      KR S +  + +P K  P
Sbjct:    2 PTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--ENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQAFSPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLSTLTTPVEGLDIQLEVLKLLAEM---------------SSFCGD--MEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKVEIGQKRTSEDTSSGSPPKKSP 470          
BLAST of Apoptosis inhibitor 5 vs. UniProt/SwissProt
Match: sp|Q7ZY79|API5B_XENLA (Apoptosis inhibitor 5-B OS=Xenopus laevis OX=8355 GN=api5-b PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 2.535e-66
Identity = 163/497 (32.80%), Postives = 268/497 (53.92%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFST--ENDFKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXXXXXXXXIVKMAKSVEGSKLCD-ILKCLVDFLNRTQNQDASTQISKL-----NFKGE-DGLKC-INNVFQICYDQLLPVPEEVTPEVLNTHSEDTNKLKELECILLATYNLCKFRPEAM--NMNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQKSKPI 1485
            P+V++LY NY I+ +  ++  + KSAY+ IL GV G  KEKRLA+QFI  FFK FP L + + N  LDLCED++V IR+Q I+ LS  A    E +P++AD LTQ+L +DD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L  K  T  E+    E++  + +   K+L  ++G +EF   + ILSALK+  T++GRQ+LV  + EQA L   +N  D   +  LL C +QA  L SKNVH+   +                   +  C+ +L  L    +  +  D   ++ KL     +F G+ D L+  +N +F    + +   PEEV       + E   +   +EC+L + + L +  P+ +   ++ + LK FK+RLQ+  R  Q   ++    +   S   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+ T S  KR+S    + +P K KP+
Sbjct:    2 PTVEELYRNYGILADAKDDVGQHKSAYQVILDGVKGGPKEKRLAAQFIPKFFKHFPDLSDAALNAQLDLCEDEDVSIRRQAIKELSQFATG--ENLPRVADILTQLLQSDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDVVRERAIKFLATKMKTLPEDILTKEVDDYIFSESKKVLYDVTG-EEFVLFMKILSALKNLQTVSGRQQLVDLVSEQAGLHQTLNPADPDSVDRLLQCMRQAVPLFSKNVHSTKFV-------------------TYFCEQVLPILSSLTSPAEGIDVQLEVLKLLAEMSSFCGDMDKLESNLNKLFDKLLEFMPLPPEEVENGDSAANEEPKLQFSYVECLLFSFHQLGRKLPDFLIAKVDAEKLKDFKIRLQYFARGLQVYIRQLRLTLQGKSGDALKTEENKIKVVALKITNNINVLIKDLFHNPPSYKSTVTLSWK-PVQKTDSGQKRMSDETSSTSPPK-KPV 470          
BLAST of Apoptosis inhibitor 5 vs. UniProt/SwissProt
Match: sp|O35841|API5_MOUSE (Apoptosis inhibitor 5 OS=Mus musculus OX=10090 GN=Api5 PE=1 SV=2)

HSP 1 Score: 225.713 bits (574), Expect = 4.555e-66
Identity = 162/494 (32.79%), Postives = 266/494 (53.85%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQKSKP 1482
            P+V++LY NY I+ +  E+  + K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  D     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    + +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +                 +F G+  ++ +    +  +D+LL   P+P E      N  +E+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+      KR S +  + +P K  P
Sbjct:    2 PTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--ENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQAFSPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLSTLTTPVEGLDIQLEVLKLLAEM---------------SSFCGD--MEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKVEIGQKRTSEDTSSGSPPKKSP 470          
BLAST of Apoptosis inhibitor 5 vs. UniProt/SwissProt
Match: sp|Q5R644|API5_PONAB (Apoptosis inhibitor 5 OS=Pongo abelii OX=9601 GN=API5 PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 1.488e-65
Identity = 162/491 (32.99%), Postives = 265/491 (53.97%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQK 1473
            P+V++LY NY I+ +  E+  + K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  D     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    N +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +                 +F G+  ++ +    +  +D+LL   P+P E      N  +E+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+      KR S +  + +P K
Sbjct:    2 PTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--ENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLGTLTTPVEGLDIQLEVLKLLAEM---------------SSFCGD--MEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKVEIGQKRASEDTTSGSPPK 467          
BLAST of Apoptosis inhibitor 5 vs. UniProt/SwissProt
Match: sp|Q9BZZ5|API5_HUMAN (Apoptosis inhibitor 5 OS=Homo sapiens OX=9606 GN=API5 PE=1 SV=3)

HSP 1 Score: 224.172 bits (570), Expect = 2.587e-65
Identity = 162/491 (32.99%), Postives = 265/491 (53.97%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQK 1473
            P+V++LY NY I+ +  E+  + K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  D     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    N +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +                 +F G+  ++ +    +  +D+LL   P+P E      N  +E+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+      KR S +  + +P K
Sbjct:    2 PTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--ENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLGTLTTPVEGLDIQLEVLKLLAEM---------------SSFCGD--MEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKVEIGQKRASEDTTSGSPPK 467          
BLAST of Apoptosis inhibitor 5 vs. UniProt/SwissProt
Match: sp|Q5ZMW3|API5_CHICK (Apoptosis inhibitor 5 OS=Gallus gallus OX=9031 GN=API5 PE=2 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 3.461e-65
Identity = 162/491 (32.99%), Postives = 264/491 (53.77%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFST--ENDFKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQK 1473
            P+V++LY NY I+ +  E   + K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    + +P++AD LTQ+L +DD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  E     E+E  + A   K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    N +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +  +   + +          K E  LK +       +D+LL   P+P E      N   E+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+   +  KR S +  + +P K
Sbjct:    2 PTVEELYRNYGILADATETAGQHKDAYQVILDGVKGGAKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--DNLPRVADILTQLLQSDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPEEVLTKEVEEFILAESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTKFVTYFCEHVLPNLSALTTPVEGLDIQLEVLKLLAEMSSFCGDME----------KLESNLKKL-------FDKLLEYMPLPPEEAENGENAGGEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKADANQKRTSEDTTSSSPPK 467          
BLAST of Apoptosis inhibitor 5 vs. TrEMBL
Match: A0A250Y2F4 (Apoptosis inhibitor 5 OS=Castor canadensis OX=51338 GN=API5 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.144e-64
Identity = 164/494 (33.20%), Postives = 267/494 (54.05%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQKSKP 1482
            P+V++LY NY I+ +  E+ S+ K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  D     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    N +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +                 +F G+  ++ +    +  +D+LL   P+P E      N  +E+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+      KR S +  + +P K  P
Sbjct:    2 PTVEELYRNYGILADATEQVSQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--ENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLSTLTTPVEGLDIQLEVLKLLAEM---------------SSFCGD--MEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKVEMGQKRTSEDTTSSSPPKKSP 470          
BLAST of Apoptosis inhibitor 5 vs. TrEMBL
Match: A0A452GU69 (Apoptosis inhibitor 5 OS=Gopherus agassizii OX=38772 GN=API5 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.694e-64
Identity = 164/494 (33.20%), Postives = 266/494 (53.85%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFST--ENDFKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQKSKP 1482
            P+V++LY NY I+ +  E   + K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    + +P++AD LTQ+L +DD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  E     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    N +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +  +   + +          K E  LK +       +D+LL   P+P E      N  SE+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+   +  KR S +  + +P K  P
Sbjct:    2 PTVEELYRNYGILADATETAGQHKDAYQVILDGVKGGAKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--DNLPRVADILTQLLQSDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPEEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEHVLPNLSSLTSPVEGLDIQLEVLKLLAEMSSFCGDME----------KLESNLKKL-------FDKLLEYMPLPPEEAENGENAGSEEPKLQFSYVECLLYSFHQLGRKLPDFLTSKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKADAGQKRTSEDTTSSSPPKKAP 470          
BLAST of Apoptosis inhibitor 5 vs. TrEMBL
Match: G1Q2G7 (Uncharacterized protein OS=Myotis lucifugus OX=59463 GN=LOC102428191 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.966e-64
Identity = 163/495 (32.93%), Postives = 264/495 (53.33%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNCK-QAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDA-STQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQKSKP 1482
            P+V++LY NY I+ +  E+  + K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  D     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    N +D   +  LL C  QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +  +   + +   T + KL                  +D+LL   P+P E      N  +E+   +   +EC+L + +  C+  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+      KR + +  + +P K  P
Sbjct:    2 PTVEELYRNYGILADAMEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--ENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTWQAVPLFSKNVHSTRFVTYFCEQVLPNLSSLTTPVEGLNIQLEVLKLLAEMCSFCGDMEKLETNLRKL------------------FDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQFCRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTDENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKVEIGQKRATEDTTSGSPPKKSP 470          
BLAST of Apoptosis inhibitor 5 vs. TrEMBL
Match: A0A452RY96 (Apoptosis inhibitor 5 OS=Ursus americanus OX=9643 GN=API5 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 3.314e-64
Identity = 163/494 (33.00%), Postives = 266/494 (53.85%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQKSKP 1482
            P+V++LY NY I+ +  E+  + K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  D     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    N +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +                 +F G+  ++ +    +  +D+LL   P+P E      N  +E+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+      KR S +  + +P K  P
Sbjct:    2 PTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--ENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLSSLTTPVEGLDIQLEVLKLLAEM---------------SSFCGD--MEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKVEIGQKRASEDTTSGSPPKKSP 470          
BLAST of Apoptosis inhibitor 5 vs. TrEMBL
Match: A0A2Y9GPG4 (apoptosis inhibitor 5 isoform X2 OS=Neomonachus schauinslandi OX=29088 GN=API5 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 3.314e-64
Identity = 163/494 (33.00%), Postives = 266/494 (53.85%), Query Frame = 1
Query:   37 PSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXX-XXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMN--MNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQKSKP 1482
            P+V++LY NY I+ +  E+  + K AY+ IL GV G  KEKRLA+QFI  FFK FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E +L+ +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  D     E+E L+     K+L  ++G +EF   + ILS LKS  T++GRQ+LV  + EQA L    N +D   +  LL C +QA  L SKNVH+   +       L ++  +   VEG  +  ++LK L +                 +F G+  ++ +    +  +D+LL   P+P E      N  +E+   +   +EC+L + + L +  P+ +   +N + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  ++ SW  PV+      KR S +  + +P K  P
Sbjct:    2 PTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATG--ENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTG-EEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLSSLTTPVEGLDIQLEVLKLLAEM---------------SSFCGD--MEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWK-PVQKVEIGQKRASEDTTSGSPPKKSP 470          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Cavefish
Match: api5 (apoptosis inhibitor 5 [Source:ZFIN;Acc:ZDB-GENE-030131-395])

HSP 1 Score: 207.994 bits (528), Expect = 3.209e-60
Identity = 160/499 (32.06%), Postives = 262/499 (52.51%), Query Frame = 1
Query:   40 SVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFST--ENDFKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXXXXXXXXIVKMAKS--VEGSKLCDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTNKLKELECILLATYNLCKFRPEAM--NMNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETT-----ISVTKRLSSNNENPTPQKSKPIN 1488
            +V++LY NY I+ +  E+ SK K AY+ IL GV G  KEKRLA+QFI  FF  FP+L + + N  LDLCED++V IR+Q I+ L   A    E +P++AD LTQ+L TDD+ E + + +AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  E+    E+E  +     K+L  ++G +EF  ++ +LS LK   T++GRQ+LV  ++EQA L   +N  D   +  LL C +QA  L SKNVH+   +    +++   + M  S   E     ++LK L +      + D          K E  L  +       +++LL   P+P E       T  E   +   +EC+L + + L K  P+ +   ++ + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ +L+++ F   P++K  I+ SW  PV+ T     +   KR S  + +  P   K ++
Sbjct:    4 TVEELYRNYGILADAKEDLSKHKEAYQVILDGVKGGPKEKRLAAQFIPKFFSSFPELADAAINAQLDLCEDEDVSIRRQAIKELPRFASG--ENLPRVADILTQLLQTDDSAEFNQVNTALISIFKIDAKGTLGGLFSQIL----QGEDVVRERAIKFLSSKLKTMPEDIMTKEVEDYIFTETKKVLEDVTG-EEFVLLMRVLSGLKYLQTVSGRQQLVELVVEQAFLEQALNPADTDSVDRLLQCTRQALPLFSKNVHSTRFVTYFCEHVLPNLSMLTSPVAELDIQLEVLKLLAEMSPFCGDMD----------KLEANLTML-------FEKLLEFMPLPPEEENGENATSEEPKLQFSYVECLLFSFHQLGKKLPDFLIDKVDAEKLKDFKIRLQYFARGLQVYIRQLRVALQGKTGDALKTEENKIKVVALKITNNINVLIKDLFHNPPSYKSTITLSWK-PVQKTEAAAAVVGQKRASGEDTDAGPLGGKKVS 477          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Sea Lamprey
Match: api5 (apoptosis inhibitor 5 [Source:ZFIN;Acc:ZDB-GENE-030131-395])

HSP 1 Score: 204.912 bits (520), Expect = 3.723e-60
Identity = 157/487 (32.24%), Postives = 248/487 (50.92%), Query Frame = 1
Query:   40 SVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTEND--FKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXXXXXXXXIVKMAKSVEGSKL-CDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLL----PVPEEVTPEVLNTHSEDTNKLKELECILLATYNLCKFRPEAMNMNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQK 1473
            S++D+Y NY I+ +  ++  + K AY+ IL GV G  KEKRLA+QFI  FFK F  L E + N  LDLCED++V IR+Q I+ L   A    E +P+IAD LTQ+L +DD TE +L+ +AL ++ K+D K     +F Q++    +  +++   A K+L+ +  T+ +     E+E  +     K+L  ++G +EF   + +LS LKS  +++GRQ+LV  +++QA L  + N  D   +  LL C +QA  L SKNVH+   +      +   + +    E S    ++LK L +                  F G D  K  +NV +I + +LL    P PEE     L T                     CK    +   + + LK FKLRLQ+  R +Q   K+   A+   +   L   EN+ K V +K+T N+ IL+++ F   P++K  I+ SW  PV+  ++  KR S   E+   ++
Sbjct:    3 SIEDMYKNYGILADAKDKVVEHKDAYQAILDGVKGGPKEKRLAAQFIPKFFKHFADLAENAINAQLDLCEDEDVSIRRQAIKELPQFATG--ENLPRIADVLTQLLQSDDQTEFTLVNNALLSIFKVDAKGTLGGLFTQIL----QGEDVVRERAIKFLSTRLKTQPEEVLTKEVEEYIMVECKKVLEDVTG-EEFMSFMRLLSGLKSLQSVSGRQQLVALVVDQADLEQEFNPADPDAVDRLLQCTRQALPLFSKNVHSTPFVTYFCQRVLPNLSLLPGEESSNTQLEVLKLLAEM---------------SLFYGVDNEKLESNVKEI-FTKLLEYMPPPPEETEGNGLITG--------------------CK----SYKSSAERLKDFKLRLQYFARGSQVYIKQLRSALQGKTGDTLKTQENKIKVVALKITNNINILIKDLFHNPPSYKSAITLSWK-PVQKAVAAQKRRSLGEEDTAAKR 441          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Nematostella
Match: EDO32347 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVC3])

HSP 1 Score: 145.591 bits (366), Expect = 1.751e-38
Identity = 131/455 (28.79%), Postives = 225/455 (49.45%), Query Frame = 1
Query:   40 SVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEES--------SELINTFAFKYLNEKFSTENDFKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEIL-EQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAX---XXXXXXXXXXXXIVKMAKSVEGSKLCDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLLPVPEEVTPEVLNTHSEDTNKLK--ELECILLATYNLCKFRPEAMNMNEDT---LKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVR 1347
             V++LY  + I+ +  E   +    Y  IL  V G   EK+LAS FI  FFK FP+L E + + +LDLCED++ ++RKQ I+ L  + K+  E++P+IAD LTQ+L +DD  E+ ++ +AL ++ K++PK     +F+Q+++  E+         +E +  FA K L+    TE     EI+        K L  ++G +EF   + ILS LK   T+ G  +++ +I+ EQA+L      TD   +   ++C +QA     +   AD     L+  +      +  A+  E  KL ++LK                ++S      E     +  +F +   + +P+P   + +   T      KL+   +EC+L A + L + + EA     D+   LK F+LRLQ+  +  Q   K+   A+   + A L   EN+ K V ++ T+N+ I+++
Sbjct:    3 GVEELYRQFGILADAGESAGEHSDEYSAILAAVKGTLGEKKLASSFITRFFKYFPKLQEHAIDAMLDLCEDEDNLLRKQAIKGLPELCKANVEHLPRIADVLTQLLQSDDVLELGIVKNALVSLFKMEPKGTIGGLFSQILSGEEQVRDKAIKFLAEAVAEFAKKTLHPSPETEEYLVDEIK--------KALSDVTG-EEFKAFMTILSQLK---TMQGSPQVLADIVTEQAELCQPFQPTDVDSIDRFISCARQAIPFFVRGASADPFFSYLIKQVVPQASQLTQAEDGEDPKL-EMLKL-------------CAEMSSCTLPEETIKAAVEPLFSLLL-EYMPLPPSDSEDGKPTEDGTEPKLQFSYVECLLFAFHQLAR-KDEAFLTGADSTERLKDFRLRLQYFAQGCQMYIKQLRVALQGKAGAALQEKENKIKVVALRTTSNINIIIK 429          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Nematostella
Match: EDO28170 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T783])

HSP 1 Score: 51.6026 bits (122), Expect = 3.611e-7
Identity = 83/337 (24.63%), Postives = 149/337 (44.21%), Query Frame = 1
Query:  424 PKVAFEAIFNQLITQLEES--------SELINTFAFKYLNEKFSTENDFKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEIL-EQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAX---XXXXXXXXXXXXIVKMAKSVEGSKLCDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLLPVPEEVTPEVLNTHSEDTNKLK--ELECILLATYNLCKFRPEAMNMNEDT---LKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFK 1377
            PK     +F+Q+++  E+         +E +  FA K L+    TE       E LV+      L  ++G +EF   + ILS LK   T+ G  +++ +I+ EQA+L      TD   +   ++C +QA     +   AD     L+  +      +  A+  E  KL ++LK                ++S      E     +  +F +   + +P+P   + +   T      KL+   +EC+L A + L + + EA     D+   LK F+LRLQ+  +  Q   K+   A+   + A L   EN+ K V ++ T+N+ I++++ F   P++K
Sbjct:   26 PKGTIGGLFSQILSGEEQVRDKAIKFLAEAVAEFAKKTLHPSPETE-------EYLVDEIKKVALSDVTG-EEFKAFMTILSQLK---TMQGSPQVLADIVTEQAELCQPFQPTDVDSIDRFISCARQAIPFFVRGASADPFFSYLIKQVVPQASQLTQAEDGEDPKL-EMLKL-------------CAEMSSCTLPEETIKAAVEPLFSLLL-EYMPLPPSDSEDGKPTEDGTEPKLQFSYVECLLFAFHQLAR-KDEAFLTGADSTERLKDFRLRLQYFAQGCQMYIKQLRVALQGKAGAALQEKENKIKVVALRTTSNINIIIKDLFHNPPSYK 335          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Medaka
Match: api5 (apoptosis inhibitor 5 [Source:NCBI gene;Acc:100049243])

HSP 1 Score: 205.682 bits (522), Expect = 2.430e-59
Identity = 158/486 (32.51%), Postives = 256/486 (52.67%), Query Frame = 1
Query:   40 SVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFST--ENDFKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXXXXXXXXIVKMAKSVEGSKLCD-ILKCLVDFLNRTQNQDASTQISKL-----NFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAM--NMNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISV-TKRLSS 1446
            +++DLY NY ++ +  +  S+ K AY+ IL GV G  KEKRLA+QFI  FF  FP+L + + N  LDLCED++V IR+Q I+ L   A    E I ++AD LTQ+L TDD  E + +  AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  E+    E+E  V A   K+L  ++G +EF  ++ + S L+   T+ GRQ+LV  ++EQA L   +N  D   +  LL C +QA  L SKNVH+   +                   +  C+ +L  L    +     D   ++ KL      + G+  ++ +     I + +LL   P+P E      N+ SE+   +   +EC+L + + L K  P+ +   ++ + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ IL+++ F   P+FK  ++ SW  PV+ T +V  KRLSS
Sbjct:    4 TIEDLYRNYGVLADAKDNLSQHKDAYQVILAGVKGGPKEKRLAAQFIPKFFNSFPELADAAINAQLDLCEDEDVSIRRQAIKELPRFATG--ENIFRVADILTQLLQTDDTAEFNQVNVALISIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPEDIMTKEVEEYVFAETKKVLEDVTG-EEFVLLMRVASGLRVLQTVNGRQQLVELVVEQADLDQALNPADPDAVDRLLQCTRQALPLFSKNVHSTRFV-------------------TYFCEHVLPNLSTLTSPVAELDIQLEVLKLMAEMSPYCGD--MEKLEANLTILFTKLLEFMPLPPEEVENGENSASEEPKLQFSYVECLLFSFHQLGKKLPDFLLDKVDGERLKDFKIRLQYFARGLQVYIRQLRVALQGKTGDALKTEENKIKVVALKITNNINILIKDLFHNPPSFKSTVTLSWK-PVQKTEAVAAKRLSS 460          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Medaka
Match: api5 (apoptosis inhibitor 5 [Source:NCBI gene;Acc:100049243])

HSP 1 Score: 193.741 bits (491), Expect = 8.770e-55
Identity = 158/505 (31.29%), Postives = 256/505 (50.69%), Query Frame = 1
Query:   40 SVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFST--ENDFKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVS-------------------KNVHAXXXXXXXXXXXXXIVKMAKSVEGSKLCD-ILKCLVDFLNRTQNQDASTQISKL-----NFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAM--NMNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISV-TKRLSS 1446
            +++DLY NY ++ +  +  S+ K AY+ IL GV G  KEKRLA+QFI  FF  FP+L + + N  LDLCED++V IR+Q I+ L   A    E I ++AD LTQ+L TDD  E + +  AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  E+    E+E  V A   K+L  ++G +EF  ++ + S L+   T+ GRQ+LV  ++EQA L   +N  D   +  LL C +QA  L S                   KNVH+   +                   +  C+ +L  L    +     D   ++ KL      + G+  ++ +     I + +LL   P+P E      N+ SE+   +   +EC+L + + L K  P+ +   ++ + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ IL+++ F   P+FK  ++ SW  PV+ T +V  KRLSS
Sbjct:    4 TIEDLYRNYGVLADAKDNLSQHKDAYQVILAGVKGGPKEKRLAAQFIPKFFNSFPELADAAINAQLDLCEDEDVSIRRQAIKELPRFATG--ENIFRVADILTQLLQTDDTAEFNQVNVALISIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPEDIMTKEVEEYVFAETKKVLEDVTG-EEFVLLMRVASGLRVLQTVNGRQQLVELVVEQADLDQALNPADPDAVDRLLQCTRQALPLFSLFTCESGDGSLQQISCSEQKNVHSTRFV-------------------TYFCEHVLPNLSTLTSPVAELDIQLEVLKLMAEMSPYCGD--MEKLEANLTILFTKLLEFMPLPPEEVENGENSASEEPKLQFSYVECLLFSFHQLGKKLPDFLLDKVDGERLKDFKIRLQYFARGLQVYIRQLRVALQGKTGDALKTEENKIKVVALKITNNINILIKDLFHNPPSFKSTVTLSWK-PVQKTEAVAAKRLSS 479          
BLAST of Apoptosis inhibitor 5 vs. Ensembl Medaka
Match: api5 (apoptosis inhibitor 5 [Source:NCBI gene;Acc:100049243])

HSP 1 Score: 180.259 bits (456), Expect = 4.282e-50
Identity = 145/469 (30.92%), Postives = 236/469 (50.32%), Query Frame = 1
Query:   40 SVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFST--ENDFKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKIN-TDAKFLTLLLNC-KQAAKLVSKNVHAXXXXXXXXXXXXXIVKMAKSVEGSKLCD-ILKCLVDFLNRTQNQDASTQISKL-----NFKGEDGLKCINNVFQICYDQLL---PVPEEVTPEVLNTHSEDTN-KLKELECILLATYNLCKFRPEAMNMNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNL 1404
            +++DLY NY ++ +  +  S+ K AY+ IL GV G  KEKRLA+QFI  FF  FP+L + + N  LDLCED++V IR+Q I+ L   A    E I ++AD LTQ+L TDD  E + +  AL ++ K+D K     +F+Q++    +  +++   A K+L+ K  T  E+    E+E  V A   K+L  ++G +EF  ++ + S L+   T+ GRQ+LV  ++EQA L   +N  D   +  LL C +QA  L SKNVH+   +                   +  C+ +L  L    +     D   ++ KL      + G+  ++ +     I + +LL   P+P E      N+ SE+   +   +EC+L               M+ + LK FK+RLQ+  R  Q   ++   A+   +   L   EN+ K V +K+T N+ IL+    K    ++I  + +WN+
Sbjct:    4 TIEDLYRNYGVLADAKDNLSQHKDAYQVILAGVKGGPKEKRLAAQFIPKFFNSFPELADAAINAQLDLCEDEDVSIRRQAIKELPRFATG--ENIFRVADILTQLLQTDDTAEFNQVNVALISIFKMDAKGTLGGLFSQIL----QGEDIVRERAIKFLSTKLKTLPEDIMTKEVEEYVFAETKKVLEDVTG-EEFVLLMRVASGLRVLQTVNGRQQLVELVVEQADLDQALNPADPDAVDRLLQCTRQALPLFSKNVHSTRFV-------------------TYFCEHVLPNLSTLTSPVAELDIQLEVLKLMAEMSPYCGD--MEKLEANLTILFTKLLEFMPLPPEEVENGENSASEEPKLQFSYVECLLF--------------MDGERLKDFKIRLQYFARGLQVYIRQLRVALQGKTGDALKTEENKIKVVALKITNNINILI----KVKSCYRIDTNLNWNI 426          
BLAST of Apoptosis inhibitor 5 vs. Planmine SMEST
Match: SMESG000000547.1 (SMESG000000547.1)

HSP 1 Score: 971.459 bits (2510), Expect = 0.000e+0
Identity = 497/497 (100.00%), Postives = 497/497 (100.00%), Query Frame = 1
Query:   28 MSTPSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTENDFKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKINTDAKFLTLLLNCKQAAKLVSKNVHAXXXXXXXXXXXXXIVKMAKSVEGSKLCDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLLPVPEEVTPEVLNTHSEDTNKLKELECILLATYNLCKFRPEAMNMNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQKSKPINKGANFNNRRR 1518
            MSTPSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTENDFKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKINTDAKFLTLLLNCKQAAKLVSKNVHADDLLMLLLDNLNDIVKMAKSVEGSKLCDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLLPVPEEVTPEVLNTHSEDTNKLKELECILLATYNLCKFRPEAMNMNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQKSKPINKGANFNNRRR
Sbjct:    1 MSTPSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQFIANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIPKIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEESSELINTFAFKYLNEKFSTENDFKPEIEALVEAHGSKLLIKLSGKDEFPFIIGILSALKSNSTLTGRQKLVTEILEQAKLIGKINTDAKFLTLLLNCKQAAKLVSKNVHADDLLMLLLDNLNDIVKMAKSVEGSKLCDILKCLVDFLNRTQNQDASTQISKLNFKGEDGLKCINNVFQICYDQLLPVPEEVTPEVLNTHSEDTNKLKELECILLATYNLCKFRPEAMNMNEDTLKQFKLRLQFLGRYNQTASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFKIPISPSWNLPVETTISVTKRLSSNNENPTPQKSKPINKGANFNNRRR 497          
The following BLAST results are available for this feature:
BLAST of Apoptosis inhibitor 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
API53.098e-6632.99apoptosis inhibitor 5 [Source:HGNC Symbol;Acc:HGNC... [more]
API53.995e-6633.13apoptosis inhibitor 5 [Source:HGNC Symbol;Acc:HGNC... [more]
API55.388e-6632.99apoptosis inhibitor 5 [Source:HGNC Symbol;Acc:HGNC... [more]
API55.338e-6033.05apoptosis inhibitor 5 [Source:HGNC Symbol;Acc:HGNC... [more]
API52.258e-3729.64apoptosis inhibitor 5 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Apoptosis inhibitor 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Apoptosis inhibitor 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cass1.264e-5131.36gene:FBgn0286781 transcript:FBtr0081001[more]
back to top
BLAST of Apoptosis inhibitor 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
api52.160e-5932.28apoptosis inhibitor 5 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Apoptosis inhibitor 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
API53.083e-6733.20apoptosis inhibitor 5 [Source:NCBI gene;Acc:100380... [more]
API51.377e-6432.67apoptosis inhibitor 5 [Source:NCBI gene;Acc:100380... [more]
API58.168e-6432.85apoptosis inhibitor 5 [Source:NCBI gene;Acc:100380... [more]
back to top
BLAST of Apoptosis inhibitor 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Api56.512e-6732.79apoptosis inhibitor 5 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Apoptosis inhibitor 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZY79|API5B_XENLA2.535e-6632.80Apoptosis inhibitor 5-B OS=Xenopus laevis OX=8355 ... [more]
sp|O35841|API5_MOUSE4.555e-6632.79Apoptosis inhibitor 5 OS=Mus musculus OX=10090 GN=... [more]
sp|Q5R644|API5_PONAB1.488e-6532.99Apoptosis inhibitor 5 OS=Pongo abelii OX=9601 GN=A... [more]
sp|Q9BZZ5|API5_HUMAN2.587e-6532.99Apoptosis inhibitor 5 OS=Homo sapiens OX=9606 GN=A... [more]
sp|Q5ZMW3|API5_CHICK3.461e-6532.99Apoptosis inhibitor 5 OS=Gallus gallus OX=9031 GN=... [more]
back to top
BLAST of Apoptosis inhibitor 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A250Y2F41.144e-6433.20Apoptosis inhibitor 5 OS=Castor canadensis OX=5133... [more]
A0A452GU692.694e-6433.20Apoptosis inhibitor 5 OS=Gopherus agassizii OX=387... [more]
G1Q2G72.966e-6432.93Uncharacterized protein OS=Myotis lucifugus OX=594... [more]
A0A452RY963.314e-6433.00Apoptosis inhibitor 5 OS=Ursus americanus OX=9643 ... [more]
A0A2Y9GPG43.314e-6433.00apoptosis inhibitor 5 isoform X2 OS=Neomonachus sc... [more]
back to top
BLAST of Apoptosis inhibitor 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
api53.209e-6032.06apoptosis inhibitor 5 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Apoptosis inhibitor 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
api53.723e-6032.24apoptosis inhibitor 5 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Apoptosis inhibitor 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Apoptosis inhibitor 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO323471.751e-3828.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281703.611e-724.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Apoptosis inhibitor 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
api52.430e-5932.51apoptosis inhibitor 5 [Source:NCBI gene;Acc:100049... [more]
api58.770e-5531.29apoptosis inhibitor 5 [Source:NCBI gene;Acc:100049... [more]
api54.282e-5030.92apoptosis inhibitor 5 [Source:NCBI gene;Acc:100049... [more]
back to top
BLAST of Apoptosis inhibitor 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000000547.10.000e+0100.00SMESG000000547.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006576 ID=SMED30006576|Name=Apoptosis inhibitor 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1586bp
CTCGTTGTTTAAATATCTTCATTCAAAATGTCTACTCCTTCTGTTAAAGA
TTTGTATGATAATTATGACATTGTAAATAATCCTAACGAAGAAGATTCTA
AAAAAAAGTCAGCTTATGAAAATATTTTAAAAGGTGTGAATGGTGAAGAA
AAAGAAAAACGGTTAGCTTCACAGTTCATAGCTAATTTTTTCAAATTATT
TCCGCAACTTTATGAAGAATCGTTTAATAAATTGCTTGATCTATGTGAAG
ATGATAATGTAATAATTCGTAAACAAGTAATTCAATATTTATCGGTTATT
GCAAAATCTGTTCCGGAATATATTCCTAAAATCGCAGACACATTGACACA
AATGCTAATAACAGATGATAATACTGAAGTTAGTTTAATATACAGTGCAT
TAAATACTGTCATTAAACTTGATCCTAAAGTAGCTTTTGAAGCTATATTT
AATCAATTAATAACTCAACTTGAAGAATCAAGTGAACTTATAAACACGTT
TGCTTTTAAATATTTAAATGAAAAATTTTCCACTGAAAATGATTTTAAAC
CCGAAATAGAAGCTCTAGTTGAAGCGCATGGCTCTAAATTACTGATTAAA
CTTTCAGGAAAAGATGAATTTCCATTCATTATTGGAATTCTCTCGGCACT
CAAATCAAATTCTACACTTACTGGACGACAGAAATTAGTTACTGAAATAT
TAGAACAAGCAAAATTAATTGGCAAAATTAACACTGACGCCAAATTTTTG
ACATTGCTTTTAAATTGCAAACAAGCTGCTAAGTTGGTTTCGAAAAATGT
GCATGCAGATGATTTGTTGATGCTGTTGTTAGACAATTTAAACGACATCG
TCAAGATGGCTAAGTCAGTCGAAGGATCAAAACTTTGTGACATTTTGAAA
TGCTTGGTGGATTTCTTAAACAGAACGCAAAATCAAGATGCAAGCACTCA
AATTTCTAAGCTTAATTTCAAAGGAGAAGACGGATTGAAGTGTATAAATA
ATGTATTCCAAATCTGCTACGATCAATTGCTCCCGGTTCCAGAAGAAGTC
ACTCCTGAAGTTCTAAATACTCACAGTGAAGACACTAACAAACTCAAAGA
ATTGGAATGCATTTTATTGGCTACTTACAATCTGTGCAAATTCCGCCCAG
AAGCAATGAACATGAATGAGGACACGTTGAAACAATTTAAGCTCCGATTG
CAATTCCTAGGCAGATACAATCAAACTGCCAGCAAAAAGGCCTCTGATGC
CGTTGCAAAACTTTCCCGGGCTGAGCTGGGATTGGGTGAAAATCGTGATA
AATCTGTATTGGTGAAGGTTACTGCCAATCTCCAAATCCTGGTGCGAGAG
TTCTTTAAAGCAACCCCGAATTTTAAAATCCCCATTAGTCCGTCCTGGAA
TCTACCGGTGGAAACGACAATAAGTGTGACAAAGCGGCTCTCATCCAACA
ATGAAAATCCCACTCCACAGAAATCCAAACCGATTAATAAAGGCGCCAAT
TTCAATAATCGCCGTCGTTGATAGATTTGATGATCTGTATTTGTGCATTA
GTTTATAATATATTTGTTGCAGTTATTTAAAAAAAA
back to top

protein sequence of SMED30006576-orf-1

>SMED30006576-orf-1 ID=SMED30006576-orf-1|Name=SMED30006576-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=498bp
MSTPSVKDLYDNYDIVNNPNEEDSKKKSAYENILKGVNGEEKEKRLASQF
IANFFKLFPQLYEESFNKLLDLCEDDNVIIRKQVIQYLSVIAKSVPEYIP
KIADTLTQMLITDDNTEVSLIYSALNTVIKLDPKVAFEAIFNQLITQLEE
SSELINTFAFKYLNEKFSTENDFKPEIEALVEAHGSKLLIKLSGKDEFPF
IIGILSALKSNSTLTGRQKLVTEILEQAKLIGKINTDAKFLTLLLNCKQA
AKLVSKNVHADDLLMLLLDNLNDIVKMAKSVEGSKLCDILKCLVDFLNRT
QNQDASTQISKLNFKGEDGLKCINNVFQICYDQLLPVPEEVTPEVLNTHS
EDTNKLKELECILLATYNLCKFRPEAMNMNEDTLKQFKLRLQFLGRYNQT
ASKKASDAVAKLSRAELGLGENRDKSVLVKVTANLQILVREFFKATPNFK
IPISPSWNLPVETTISVTKRLSSNNENPTPQKSKPINKGANFNNRRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR008383API5
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0017134fibroblast growth factor binding
Vocabulary: biological process
TermDefinition
GO:0006915apoptotic process
GO:0043066negative regulation of apoptotic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008383Apoptosis inhibitory 5PFAMPF05918API5coord: 7..487
e-value: 9.2E-83
score: 278.8
IPR008383Apoptosis inhibitory 5PANTHERPTHR12758APOPTOSIS INHIBITOR 5-RELATEDcoord: 1..482
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 44..173
e-value: 6.2E-7
score: 30.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 470..497
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 470..490
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 46..374