Dual specificity tyrosine-phosphorylation-regulated kinase 1A

Overview
NameDual specificity tyrosine-phosphorylation-regulated kinase 1A
Smed IDSMED30006567
Length (bp)2386
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 1A (SMED30006567) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 1A (SMED30006567) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 1A (SMED30006567) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 1A (SMED30006567) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006567

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30006567SMESG000041146.1 dd_Smed_v4_8254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30006567SMESG000041146.1 dd_Smed_v4_8254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30006567SMESG000041146.1 dd_Smed_v4_8126_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006567SMESG000041146.1 dd_Smed_v4_8254_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1A (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:HGNC Symbol;Acc:HGNC:3091])

HSP 1 Score: 404.831 bits (1039), Expect = 1.355e-129
Identity = 238/485 (49.07%), Postives = 302/485 (62.27%), Query Frame = 1
Query:  517 PLSNNCSSPPTNRN---KPLIKLSVDLITTYKNINELYY-QKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNS 1959
            PL+N    P T R+    PL KLSVDLI TYK+INE+YY +KKRR++    D                 D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H+L    K  K+FE++   DG  +    + + +D K+  ++   +R L +ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF +      + +NS
Sbjct:   36 PLTNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGD-----------------DSSHKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKL--PDGTWN----LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNS 454          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1A (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:HGNC Symbol;Acc:HGNC:3091])

HSP 1 Score: 405.216 bits (1040), Expect = 2.222e-129
Identity = 238/485 (49.07%), Postives = 302/485 (62.27%), Query Frame = 1
Query:  517 PLSNNCSSPPTNRN---KPLIKLSVDLITTYKNINELYY-QKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNS 1959
            PL+N    P T R+    PL KLSVDLI TYK+INE+YY +KKRR++    D                 D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H+L    K  K+FE++   DG  +    + + +D K+  ++   +R L +ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF +      + +NS
Sbjct:   65 PLTNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGD-----------------DSSHKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKL--PDGTWN----LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNS 483          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1A (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:HGNC Symbol;Acc:HGNC:3091])

HSP 1 Score: 405.216 bits (1040), Expect = 2.222e-129
Identity = 238/485 (49.07%), Postives = 302/485 (62.27%), Query Frame = 1
Query:  517 PLSNNCSSPPTNRN---KPLIKLSVDLITTYKNINELYY-QKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNS 1959
            PL+N    P T R+    PL KLSVDLI TYK+INE+YY +KKRR++    D                 D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H+L    K  K+FE++   DG  +    + + +D K+  ++   +R L +ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF +      + +NS
Sbjct:   65 PLTNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGD-----------------DSSHKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKL--PDGTWN----LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNS 483          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1A (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:HGNC Symbol;Acc:HGNC:3091])

HSP 1 Score: 405.216 bits (1040), Expect = 2.222e-129
Identity = 238/485 (49.07%), Postives = 302/485 (62.27%), Query Frame = 1
Query:  517 PLSNNCSSPPTNRN---KPLIKLSVDLITTYKNINELYY-QKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNS 1959
            PL+N    P T R+    PL KLSVDLI TYK+INE+YY +KKRR++    D                 D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H+L    K  K+FE++   DG  +    + + +D K+  ++   +R L +ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF +      + +NS
Sbjct:   65 PLTNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGD-----------------DSSHKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKL--PDGTWN----LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNS 483          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1A (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:HGNC Symbol;Acc:HGNC:3091])

HSP 1 Score: 405.216 bits (1040), Expect = 2.222e-129
Identity = 238/485 (49.07%), Postives = 302/485 (62.27%), Query Frame = 1
Query:  517 PLSNNCSSPPTNRN---KPLIKLSVDLITTYKNINELYY-QKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNS 1959
            PL+N    P T R+    PL KLSVDLI TYK+INE+YY +KKRR++    D                 D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H+L    K  K+FE++   DG  +    + + +D K+  ++   +R L +ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF +      + +NS
Sbjct:   65 PLTNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGD-----------------DSSHKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKL--PDGTWN----LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNS 483          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-1 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8WQL7])

HSP 1 Score: 392.504 bits (1007), Expect = 1.720e-123
Identity = 226/485 (46.60%), Postives = 299/485 (61.65%), Query Frame = 1
Query:  553 RNKPLIKLSVDLITTYKNINELYYQKK--RRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPL----PPPQGNAPVSMKNMIE---------------------GSYEYFIKPGEIWKSRYYI--EQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            ++ P+ KL+ DLI TYK INE +Y +K  RR+R    D+   K  K   +  +L+DT    ++  I  +  +     H        N PPL     PP     V M+   +                      +Y+Y +K GEI+  RY I  +  +G GSFGQV KA D + +E VAIKIIKNKK F +QAQ EI LL      ++T+   ++   N IV LK  F H  HLCLVFELL+YNLYDLLKNT+F+GVSLNL RKF  Q+ + L FLS P+L IIHCDLKPEN+LL++ +RS I+V+DFGSSC+   RIY YIQSRFYRSPE++L + Y   ID+WSLGCILVE+HTG+PLF G  E +Q+++IVE++GMPP  ML  G KT+KYF++   T+  I Y  K    RD  + +++   +R L +ILGV +GGP GRR  E GHS  DY KF DL+++ML  DP+ RI P   ++HPF 
Sbjct:  186 QDAPVRKLTSDLIKTYKAINESFYLRKQVRRDRHKSQDAGKPKGSKD-GSGASLTDTFSIHNAIPITSSDNHYQQDAHQ-------NAPPLLDTNAPPTSTMVVPMRTETDLQQQQRQKSSRGGPYNNGYDDQNYDYILKNGEIFDKRYVILSDTPVGKGSFGQVTKAYDTLNKEEVAIKIIKNKKTFFDQAQIEIHLL------ELTNAHDKDNKYN-IVTLKGHFVHRAHLCLVFELLSYNLYDLLKNTSFRGVSLNLARKFAQQLGKTLLFLSSPELSIIHCDLKPENVLLVNAKRSQIRVIDFGSSCQTGHRIYQYIQSRFYRSPEVLLGIAYDTKIDMWSLGCILVEMHTGEPLFAGSSEVDQMMKIVEVLGMPPKEMLDIGPKTHKYFDK---TEDGIYYCKKT---RDGYRHTYKAPGARKLHEILGVTSGGPGGRRLGEPGHSVEDYSKFKDLIKRMLQFDPKQRISPYYVVRHPFL 649          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 235.728 bits (600), Expect = 7.375e-69
Identity = 144/340 (42.35%), Postives = 195/340 (57.35%), Query Frame = 1
Query:  913 RYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNL 1932
            RY + ++IG GSFGQV+KA D   Q+ VA+K+++N+K F  QA  EI +L  + + Q +D      G++ I+ +   F    H C+ FELL+ NLY+L+K   F+G SL L RKF   +   L  L K +L  IHCDLKPEN+LL    RS IKV+DFGSSC   +RIY YIQSRFYR+PE+IL  +Y   ID+WSLGCIL EL TG PL  G+ E++Q+  I+EL+GMPP   L   K+   +    I + G   Y         +  +   G  S+      G   G P  R  S    +  D E F+D +++ L  DPE R+ P  ALKH +  R L
Sbjct:  133 RYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRR-QDSD------GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRL--IHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTF----ITSKGYPRYCTAT--SMPDGSVVLAGARSKR-----GKMRGPPASRSWSTALKNMGD-ELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRL 451          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 235.728 bits (600), Expect = 7.375e-69
Identity = 144/340 (42.35%), Postives = 195/340 (57.35%), Query Frame = 1
Query:  913 RYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNL 1932
            RY + ++IG GSFGQV+KA D   Q+ VA+K+++N+K F  QA  EI +L  + + Q +D      G++ I+ +   F    H C+ FELL+ NLY+L+K   F+G SL L RKF   +   L  L K +L  IHCDLKPEN+LL    RS IKV+DFGSSC   +RIY YIQSRFYR+PE+IL  +Y   ID+WSLGCIL EL TG PL  G+ E++Q+  I+EL+GMPP   L   K+   +    I + G   Y         +  +   G  S+      G   G P  R  S    +  D E F+D +++ L  DPE R+ P  ALKH +  R L
Sbjct:  133 RYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRR-QDSD------GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRL--IHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTF----ITSKGYPRYCTAT--SMPDGSVVLAGARSKR-----GKMRGPPASRSWSTALKNMGD-ELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRL 451          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 235.728 bits (600), Expect = 7.375e-69
Identity = 144/340 (42.35%), Postives = 195/340 (57.35%), Query Frame = 1
Query:  913 RYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNL 1932
            RY + ++IG GSFGQV+KA D   Q+ VA+K+++N+K F  QA  EI +L  + + Q +D      G++ I+ +   F    H C+ FELL+ NLY+L+K   F+G SL L RKF   +   L  L K +L  IHCDLKPEN+LL    RS IKV+DFGSSC   +RIY YIQSRFYR+PE+IL  +Y   ID+WSLGCIL EL TG PL  G+ E++Q+  I+EL+GMPP   L   K+   +    I + G   Y         +  +   G  S+      G   G P  R  S    +  D E F+D +++ L  DPE R+ P  ALKH +  R L
Sbjct:  133 RYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRR-QDSD------GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRL--IHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTF----ITSKGYPRYCTAT--SMPDGSVVLAGARSKR-----GKMRGPPASRSWSTALKNMGD-ELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRL 451          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 235.728 bits (600), Expect = 7.375e-69
Identity = 144/340 (42.35%), Postives = 195/340 (57.35%), Query Frame = 1
Query:  913 RYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNL 1932
            RY + ++IG GSFGQV+KA D   Q+ VA+K+++N+K F  QA  EI +L  + + Q +D      G++ I+ +   F    H C+ FELL+ NLY+L+K   F+G SL L RKF   +   L  L K +L  IHCDLKPEN+LL    RS IKV+DFGSSC   +RIY YIQSRFYR+PE+IL  +Y   ID+WSLGCIL EL TG PL  G+ E++Q+  I+EL+GMPP   L   K+   +    I + G   Y         +  +   G  S+      G   G P  R  S    +  D E F+D +++ L  DPE R+ P  ALKH +  R L
Sbjct:  133 RYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRR-QDSD------GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRL--IHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTF----ITSKGYPRYCTAT--SMPDGSVVLAGARSKR-----GKMRGPPASRSWSTALKNMGD-ELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRL 451          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0300509)

HSP 1 Score: 396.741 bits (1018), Expect = 2.761e-128
Identity = 230/455 (50.55%), Postives = 289/455 (63.52%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIR 1926
            PL KLSVDLI TYK+INE+YY KK+R               +    Q   D+S K   K                                   +      + +++Y IK GE +  RY I+ LIG GSFGQVVKA D   Q +VAIKIIKNKK F+ QAQ E+ LL  M +       A      YIVKLK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FLS P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L ++Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++GMPP ++L    KT K+F++++  DG  SY  K  ++++ +K  ++   SR L DILGV TGGP GRR  E GHS +DY KF DL+ +ML  DP+ R+ P  AL+H FF R
Sbjct:   96 PLRKLSVDLIKTYKHINEVYYAKKKR---------------RAQQTQGDDDSSNKKERK-----------------------------------LYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNR-------ADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIV-ADG--SYVLK--KNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKR 486          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0299619)

HSP 1 Score: 396.356 bits (1017), Expect = 3.737e-128
Identity = 230/455 (50.55%), Postives = 289/455 (63.52%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIR 1926
            PL KLSVDLI TYK+INE+YY KK+R               +    Q   D+S K   K                                   +      + +++Y IK GE +  RY I+ LIG GSFGQVVKA D   Q +VAIKIIKNKK F+ QAQ E+ LL  M +       A      YIVKLK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FLS P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L ++Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++GMPP ++L    KT K+F++++  DG  SY  K  ++++ +K  ++   SR L DILGV TGGP GRR  E GHS +DY KF DL+ +ML  DP+ R+ P  AL+H FF R
Sbjct:   96 PLRKLSVDLIKTYKHINEVYYAKKKR---------------RAQQTQGDDDSSNKKERK-----------------------------------LYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNR-------ADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIV-ADG--SYVLK--KNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKR 486          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0342786)

HSP 1 Score: 395.586 bits (1015), Expect = 3.774e-126
Identity = 230/455 (50.55%), Postives = 289/455 (63.52%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIR 1926
            PL KLSVDLI TYK+INE+YY KK+R               +    Q   D+S K   K                                   +      + +++Y IK GE +  RY I+ LIG GSFGQVVKA D   Q +VAIKIIKNKK F+ QAQ E+ LL  M +       A      YIVKLK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FLS P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L ++Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++GMPP ++L    KT K+F++++  DG  SY  K  ++++ +K  ++   SR L DILGV TGGP GRR  E GHS +DY KF DL+ +ML  DP+ R+ P  AL+H FF R
Sbjct:  235 PLRKLSVDLIKTYKHINEVYYAKKKR---------------RAQQTQGDDDSSNKKERK-----------------------------------LYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNR-------ADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIV-ADG--SYVLK--KNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKR 625          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0300508)

HSP 1 Score: 398.282 bits (1022), Expect = 2.398e-125
Identity = 230/455 (50.55%), Postives = 289/455 (63.52%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIR 1926
            PL KLSVDLI TYK+INE+YY KK+R               +    Q   D+S K   K                                   +      + +++Y IK GE +  RY I+ LIG GSFGQVVKA D   Q +VAIKIIKNKK F+ QAQ E+ LL  M +       A      YIVKLK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FLS P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L ++Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++GMPP ++L    KT K+F++++  DG  SY  K  ++++ +K  ++   SR L DILGV TGGP GRR  E GHS +DY KF DL+ +ML  DP+ R+ P  AL+H FF R
Sbjct:   96 PLRKLSVDLIKTYKHINEVYYAKKKR---------------RAQQTQGDDDSSNKKERK-----------------------------------LYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNR-------ADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIV-ADG--SYVLK--KNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKR 486          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0300510)

HSP 1 Score: 396.741 bits (1018), Expect = 1.670e-123
Identity = 230/455 (50.55%), Postives = 289/455 (63.52%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIR 1926
            PL KLSVDLI TYK+INE+YY KK+R               +    Q   D+S K   K                                   +      + +++Y IK GE +  RY I+ LIG GSFGQVVKA D   Q +VAIKIIKNKK F+ QAQ E+ LL  M +       A      YIVKLK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FLS P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L ++Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++GMPP ++L    KT K+F++++  DG  SY  K  ++++ +K  ++   SR L DILGV TGGP GRR  E GHS +DY KF DL+ +ML  DP+ R+ P  AL+H FF R
Sbjct:  235 PLRKLSVDLIKTYKHINEVYYAKKKR---------------RAQQTQGDDDSSNKKERK-----------------------------------LYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNR-------ADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIV-ADG--SYVLK--KNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKR 625          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1ab (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, b [Source:ZFIN;Acc:ZDB-GENE-030131-5677])

HSP 1 Score: 400.208 bits (1027), Expect = 3.811e-128
Identity = 242/530 (45.66%), Postives = 310/530 (58.49%), Query Frame = 1
Query:  331 PMSQVGSVKTSCSSNETSKRQSAVPYYHYPEFPFTNSQQNLKSNPQCNKNKVYANTSQFNISPLSNNCSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            PM       + C    T +  + +PY    +   T SQ+++   PQC ++   A                       PL KLS+DLI TYK+INE+YY KK            K+  +Q   E    D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D   QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H++    K  K+FE++  +DG  S    I + +D K+  ++  +SR L  ILGV  GGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF
Sbjct:    4 PMPHSHQQYSDCHQQSTDQSVTVLPYSDQTQ-ALTASQRHM---PQCFRDPTLA-----------------------PLRKLSIDLIKTYKHINEVYYAKK------------KRRHQQGQGE----DSSHKKERK-----------------------------------VFNDGYDDENYDYVVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKL--SDGTWS----IKKTKDGKR--YKPPASRKLHAILGVECGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFF 440          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B [Source:ZFIN;Acc:ZDB-GENE-060503-499])

HSP 1 Score: 397.512 bits (1020), Expect = 1.429e-127
Identity = 236/469 (50.32%), Postives = 295/469 (62.90%), Query Frame = 1
Query:  541 PPTNRN---KPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVS------SRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            PP+ R+    PL KLSVDLI TYK+INE+YY KK+R              +Q+  E    D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D   QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+HML    K  KYF+++  +DG  +    + +++D KK+ +   S      +R L +ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI P  AL+H FF
Sbjct:   34 PPSFRDPASAPLRKLSVDLIKTYKHINEVYYTKKKRR------------AQQVPPE----DSSTKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWLDRYEIDSLIGKGSFGQVVKAYDHHEQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDT--EMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGVPPNHMLDQAPKARKYFDKL--SDGLWT----VKKNKDIKKVLYPSASEYKPPATRRLHEILGVETGGPGGRRAGEQGHAPCDYLKFKDLILRMLDYDPKTRITPFYALQHNFF 438          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1ab (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, b [Source:ZFIN;Acc:ZDB-GENE-030131-5677])

HSP 1 Score: 399.053 bits (1024), Expect = 1.480e-127
Identity = 237/499 (47.49%), Postives = 303/499 (60.72%), Query Frame = 1
Query:  424 FPFTNSQQNLKSNPQCNKNKVYANTSQFNISPLSNNCSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
             P+++  Q L ++   N   ++ +  Q         C   PT    PL KLS+DLI TYK+INE+YY KK            K+  +Q   E    D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D   QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H++    K  K+FE++  +DG  S    I + +D K+  ++  +SR L  ILGV  GGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF
Sbjct:   27 LPYSDQTQALTASQVLNALLLFRHMPQ---------CFRDPTL--APLRKLSIDLIKTYKHINEVYYAKK------------KRRHQQGQGE----DSSHKKERK-----------------------------------VFNDGYDDENYDYVVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKL--SDGTWS----IKKTKDGKR--YKPPASRKLHAILGVECGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFF 448          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B [Source:ZFIN;Acc:ZDB-GENE-060503-499])

HSP 1 Score: 398.667 bits (1023), Expect = 3.505e-127
Identity = 235/463 (50.76%), Postives = 295/463 (63.71%), Query Frame = 1
Query:  541 PPTNRN---KPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            PP+ R+    PL KLSVDLI TYK+INE+YY KK+R              +Q+  E    D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D   QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+HML    K  KYF+++  +DG  +    + +++D KK  ++  ++R L +ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI P  AL+H FF
Sbjct:   34 PPSFRDPASAPLRKLSVDLIKTYKHINEVYYTKKKRR------------AQQVPPE----DSSTKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWLDRYEIDSLIGKGSFGQVVKAYDHHEQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDT--EMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGVPPNHMLDQAPKARKYFDKL--SDGLWT----VKKNKDIKK-EYKPPATRRLHEILGVETGGPGGRRAGEQGHAPCDYLKFKDLILRMLDYDPKTRITPFYALQHNFF 431          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 374.4 bits (960), Expect = 5.292e-118
Identity = 225/453 (49.67%), Postives = 283/453 (62.47%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            PL KLS++LI TYK+INE+YY KK            K+  +Q   E    D+S K   K                                   +      + +++Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PPSH+L    K  K+FE++  +           + +D K+  ++   SR L  ILGV  GGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF
Sbjct:   93 PLRKLSIELIKTYKHINEVYYAKK------------KRRHQQGQGE----DSSNKKERK-----------------------------------IYNDGYDDDNFDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGVPPSHILEQAPKARKFFEKMPDSMWCAK------KTKDGKR--YKPAGSRKLHSILGVEAGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFF 479          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: gdf7 (growth differentiation factor 7 [Source:Xenbase;Acc:XB-GENE-484925])

HSP 1 Score: 401.749 bits (1031), Expect = 3.652e-129
Identity = 231/453 (50.99%), Postives = 288/453 (63.58%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            PL KLSVDLI TYK+INE+YY KK+R              +Q+  E    D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D   QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G PP+HML    K  KYF+++   +G  +    + +++D KK  ++   +R L ++LGV TGGP GRRA E GHS +DY KF DL+ +ML  DP+ RI P  AL+H FF
Sbjct:   44 PLRKLSVDLIKTYKHINEVYYAKKKRR------------AQQVPPE----DSSTKKERK-----------------------------------VFNDGFDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHHDQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDT--EMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGTPPNHMLDQAPKARKYFDKL--PEGTWT----VKKNKDLKK-DYKVPGTRRLHEVLGVETGGPGGRRAGEQGHSPSDYLKFKDLILRMLDYDPKTRITPFYALQHNFF 431          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: gdf7 (growth differentiation factor 7 [Source:Xenbase;Acc:XB-GENE-484925])

HSP 1 Score: 397.127 bits (1019), Expect = 5.586e-129
Identity = 231/453 (50.99%), Postives = 288/453 (63.58%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            PL KLSVDLI TYK+INE+YY KK+R              +Q+  E    D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D   QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G PP+HML    K  KYF+++   +G  +    + +++D KK  ++   +R L ++LGV TGGP GRRA E GHS +DY KF DL+ +ML  DP+ RI P  AL+H FF
Sbjct:   19 PLRKLSVDLIKTYKHINEVYYAKKKRR------------AQQVPPE----DSSTKKERK-----------------------------------VFNDGFDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHHDQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDT--EMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGTPPNHMLDQAPKARKYFDKL--PEGTWT----VKKNKDLKK-DYKVPGTRRLHEVLGVETGGPGGRRAGEQGHSPSDYLKFKDLILRMLDYDPKTRITPFYALQHNFF 406          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: gdf7 (growth differentiation factor 7 [Source:Xenbase;Acc:XB-GENE-484925])

HSP 1 Score: 400.979 bits (1029), Expect = 6.312e-129
Identity = 231/453 (50.99%), Postives = 288/453 (63.58%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            PL KLSVDLI TYK+INE+YY KK+R              +Q+  E    D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D   QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G PP+HML    K  KYF+++   +G  +    + +++D KK  ++   +R L ++LGV TGGP GRRA E GHS +DY KF DL+ +ML  DP+ RI P  AL+H FF
Sbjct:   33 PLRKLSVDLIKTYKHINEVYYAKKKRR------------AQQVPPE----DSSTKKERK-----------------------------------VFNDGFDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHHDQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDT--EMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGTPPNHMLDQAPKARKYFDKL--PEGTWT----VKKNKDLKK-DYKVPGTRRLHEVLGVETGGPGGRRAGEQGHSPSDYLKFKDLILRMLDYDPKTRITPFYALQHNFF 420          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: gdf7 (growth differentiation factor 7 [Source:Xenbase;Acc:XB-GENE-484925])

HSP 1 Score: 401.749 bits (1031), Expect = 3.055e-128
Identity = 231/453 (50.99%), Postives = 288/453 (63.58%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            PL KLSVDLI TYK+INE+YY KK+R              +Q+  E    D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D   QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G PP+HML    K  KYF+++   +G  +    + +++D KK  ++   +R L ++LGV TGGP GRRA E GHS +DY KF DL+ +ML  DP+ RI P  AL+H FF
Sbjct:  118 PLRKLSVDLIKTYKHINEVYYAKKKRR------------AQQVPPE----DSSTKKERK-----------------------------------VFNDGFDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHHDQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDT--EMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGTPPNHMLDQAPKARKYFDKL--PEGTWT----VKKNKDLKK-DYKVPGTRRLHEVLGVETGGPGGRRAGEQGHSPSDYLKFKDLILRMLDYDPKTRITPFYALQHNFF 505          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: osbpl8 (oxysterol binding protein like 8 [Source:Xenbase;Acc:XB-GENE-5961068])

HSP 1 Score: 375.555 bits (963), Expect = 4.317e-120
Identity = 241/517 (46.62%), Postives = 309/517 (59.77%), Query Frame = 1
Query:  430 FTNSQQNLKSNPQCNKNKVYANTSQFNIS---PLSNNCSSPPTNRN---KPLIKLSVDLITTYKNINELYY-QKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNS 1959
             ++S Q      Q N N   A+   +N     PL N    P T R+    PL KLSVDLI TYK+INE+YY +KKRR++    D                 D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D   QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H+L    K  K+FE++   +G  +    + + +D KK  ++   +R L ++LGV TGGP GRR  E GH+  DY KF DL+ +ML  D + RI+P  AL+H FF +      + +NS
Sbjct:   41 MSHSHQQYSDRRQQNLNDQQASALPYNDQIQQPLPNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGD-----------------DSSHKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMSKIVEVLGIPPAHILDQAPKARKFFEKM--PEGTWN----LKKTKDGKK-EYKPPGTRKLHNLLGVETGGPGGRRGGESGHTVADYLKFKDLILRMLDYDAKTRIQPYYALQHSFFKKTADEGTNTSNS 491          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1a (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a [Source:MGI Symbol;Acc:MGI:1330299])

HSP 1 Score: 406.371 bits (1043), Expect = 2.359e-130
Identity = 239/485 (49.28%), Postives = 302/485 (62.27%), Query Frame = 1
Query:  517 PLSNNCSSPPTNRN---KPLIKLSVDLITTYKNINELYY-QKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNS 1959
            PL+N    P T R+    PL KLSVDLI TYK+INE+YY +KKRR++    D                 D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H+L    K  K+FE++   DG  S    + + +D K+  ++   +R L +ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF +      + +NS
Sbjct:   36 PLTNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGD-----------------DSSHKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKL--PDGTWS----LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNS 454          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1a (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a [Source:MGI Symbol;Acc:MGI:1330299])

HSP 1 Score: 400.979 bits (1029), Expect = 6.947e-128
Identity = 233/467 (49.89%), Postives = 294/467 (62.96%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYY-QKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNS 1959
            PL KLSVDLI TYK+INE+YY +KKRR++    D                 D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H+L    K  K+FE++   DG  S    + + +D K+  ++   +R L +ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF +      + +NS
Sbjct:   92 PLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGD-----------------DSSHKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKL--PDGTWS----LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNS 492          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1a (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a [Source:MGI Symbol;Acc:MGI:1330299])

HSP 1 Score: 400.979 bits (1029), Expect = 6.947e-128
Identity = 233/467 (49.89%), Postives = 294/467 (62.96%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYY-QKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNS 1959
            PL KLSVDLI TYK+INE+YY +KKRR++    D                 D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H+L    K  K+FE++   DG  S    + + +D K+  ++   +R L +ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF +      + +NS
Sbjct:   92 PLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGD-----------------DSSHKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKL--PDGTWS----LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNS 492          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 396.356 bits (1017), Expect = 1.241e-127
Identity = 230/484 (47.52%), Postives = 294/484 (60.74%), Query Frame = 1
Query:  556 NKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNSQVNINQTAANLASVST 2007
            + PL KLSVDLI TYK+INE+YY KK            K+  +Q   +    D+S K   K                                   V      + +++Y ++ GE W  RY I+ LIG GSFGQVVKA D  TQE VAIKIIKNKK F+ QAQ E+ LL  M ++    EM       YIV LK  F    HLCLVFELL+YNLYDLL+NT+F+GVSLNLTRK   Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L   Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ RIVE++G+PP+ ML    K  KYFE++ G    +    ++ +D       ++G  +R L ++LGV TGGP GRRA E GHS  DY +F DLV +ML  +P  RI P  AL+H FF R    ++  TN+    +  + + A + T
Sbjct:   42 SAPLRKLSVDLIKTYKHINEVYYAKK------------KRRAQQAPPQ----DSSTKKEKK-----------------------------------VLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDT--EM-----KYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGWTLRRTKELRKD-------YQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRT---ADEATNTGPAGSSASTSPAPLDT 457          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 397.897 bits (1021), Expect = 1.497e-127
Identity = 230/484 (47.52%), Postives = 294/484 (60.74%), Query Frame = 1
Query:  556 NKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNSQVNINQTAANLASVST 2007
            + PL KLSVDLI TYK+INE+YY KK            K+  +Q   +    D+S K   K                                   V      + +++Y ++ GE W  RY I+ LIG GSFGQVVKA D  TQE VAIKIIKNKK F+ QAQ E+ LL  M ++    EM       YIV LK  F    HLCLVFELL+YNLYDLL+NT+F+GVSLNLTRK   Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L   Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ RIVE++G+PP+ ML    K  KYFE++ G    +    ++ +D       ++G  +R L ++LGV TGGP GRRA E GHS  DY +F DLV +ML  +P  RI P  AL+H FF R    ++  TN+    +  + + A + T
Sbjct:  102 SAPLRKLSVDLIKTYKHINEVYYAKK------------KRRAQQAPPQ----DSSTKKEKK-----------------------------------VLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDT--EM-----KYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGWTLRRTKELRKD-------YQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRT---ADEATNTGPAGSSASTSPAPLDT 517          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q63470|DYR1A_RAT (Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Rattus norvegicus OX=10116 GN=Dyrk1a PE=1 SV=2)

HSP 1 Score: 401.749 bits (1031), Expect = 2.799e-127
Identity = 233/467 (49.89%), Postives = 294/467 (62.96%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYY-QKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNS 1959
            PL KLSVDLI TYK+INE+YY +KKRR++    D                 D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H+L    K  K+FE++   DG  S    + + +D K+  ++   +R L +ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF +      + +NS
Sbjct:   92 PLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGD-----------------DSSHKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKL--PDGTWS----LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNS 492          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q61214|DYR1A_MOUSE (Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Mus musculus OX=10090 GN=Dyrk1a PE=1 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 2.952e-127
Identity = 233/467 (49.89%), Postives = 294/467 (62.96%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYY-QKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNS 1959
            PL KLSVDLI TYK+INE+YY +KKRR++    D                 D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H+L    K  K+FE++   DG  S    + + +D K+  ++   +R L +ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF +      + +NS
Sbjct:   92 PLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGD-----------------DSSHKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKL--PDGTWS----LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNS 492          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q9Y463|DYR1B_HUMAN (Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Homo sapiens OX=9606 GN=DYRK1B PE=1 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 7.640e-127
Identity = 230/484 (47.52%), Postives = 292/484 (60.33%), Query Frame = 1
Query:  556 NKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNSQVNINQTAANLASVST 2007
            + PL KLSVDLI TYK+INE+YY KK             K + Q    Q  S+  EK                                       V      + +++Y ++ GE W  RY I+ LIG GSFGQVVKA D  TQE VAIKIIKNKK F+ QAQ E+ LL  M ++    EM       YIV LK  F    HLCLVFELL+YNLYDLL+NT+F+GVSLNLTRK   Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L   Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ RIVE++G+PP+ ML    K  KYFE++ G    +    ++ +D       ++G  +R L ++LGV TGGP GRRA E GHS  DY +F DLV +ML  +P  RI P  AL+H FF R    ++  TN+    +  + + A + T
Sbjct:   42 SAPLRKLSVDLIKTYKHINEVYYAKK-------------KRRAQQAPPQDSSNKKEKK--------------------------------------VLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDT--EM-----KYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRTKELRKD-------YQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRT---ADEATNTGPAGSSASTSPAPLDT 457          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q9Z188|DYR1B_MOUSE (Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Mus musculus OX=10090 GN=Dyrk1b PE=1 SV=3)

HSP 1 Score: 396.356 bits (1017), Expect = 8.683e-127
Identity = 230/484 (47.52%), Postives = 294/484 (60.74%), Query Frame = 1
Query:  556 NKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNSQVNINQTAANLASVST 2007
            + PL KLSVDLI TYK+INE+YY KK            K+  +Q   +    D+S K   K                                   V      + +++Y ++ GE W  RY I+ LIG GSFGQVVKA D  TQE VAIKIIKNKK F+ QAQ E+ LL  M ++    EM       YIV LK  F    HLCLVFELL+YNLYDLL+NT+F+GVSLNLTRK   Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L   Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ RIVE++G+PP+ ML    K  KYFE++ G    +    ++ +D       ++G  +R L ++LGV TGGP GRRA E GHS  DY +F DLV +ML  +P  RI P  AL+H FF R    ++  TN+    +  + + A + T
Sbjct:   42 SAPLRKLSVDLIKTYKHINEVYYAKK------------KRRAQQAPPQ----DSSTKKEKK-----------------------------------VLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDT--EM-----KYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGWTLRRTKELRKD-------YQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRT---ADEATNTGPAGSSASTSPAPLDT 457          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q13627|DYR1A_HUMAN (Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2)

HSP 1 Score: 400.208 bits (1027), Expect = 1.172e-126
Identity = 232/467 (49.68%), Postives = 294/467 (62.96%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYY-QKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNS 1959
            PL KLSVDLI TYK+INE+YY +KKRR++    D                 D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H+L    K  K+FE++   DG  +    + + +D K+  ++   +R L +ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF +      + +NS
Sbjct:   92 PLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGD-----------------DSSHKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKL--PDGTWN----LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNS 492          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A4E0R639 (Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Fasciola hepatica OX=6192 GN=D915_005203 PE=4 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 7.611e-134
Identity = 211/394 (53.55%), Postives = 277/394 (70.30%), Query Frame = 1
Query:  871 SYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQV-IGT---------------------------------------DGAISYQPK-IYRDRDNK-KISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIR 1926
            ++   ++ G+IW+ RY I  LIG G+FGQVV+A D +T E VAIK+IKNK++F++QA+ EI LL EMA +Q+ D+MA E G+NYIV LK  F+HHGHLCLVFELL+YNLYDLL NTN++GVSLNLTRKF  Q+C AL FLS+P +Q+IHCDLKPENILL++P+RSAIKV+DFGSSC VSE++Y YIQSRFYRSPE++ N++Y   ID+WSLGCILVE+HTG+PLF G  E EQ+L+I+E++G PP HM+ +  K   +FE + +G+                                       +G I Y+ K +++  D   + +F GV +R L  ++G  TGGP GRR  E GH   DY+KF+DLVQ+MLV DP +RI+PE AL H FFIR
Sbjct:  644 AHHGLVRIGDIWQDRYKILALIGKGTFGQVVRALDQMTGEEVAIKVIKNKRSFLQQAEIEIKLLREMAMFQVNDQMAAEVGANYIVNLKAHFSHHGHLCLVFELLSYNLYDLLGNTNYRGVSLNLTRKFAQQLCAALVFLSRPDVQVIHCDLKPENILLVNPKRSAIKVIDFGSSCHVSEKVYQYIQSRFYRSPEVLFNLDYGLGIDMWSLGCILVEMHTGEPLFSGSNELEQVLQIIEVLGFPPVHMIESSPKLSTFFEMIPVGSGNSSTASSGSNTLSSDYVQSQPTHYSSVECGANSVLRSANGHICYKLKRLWKKNDGTYECNFAGVEARPLRAVVGADTGGPHGRRKDEPGHGPEDYDKFIDLVQRMLVYDPRHRIRPEEALAHRFFIR 1037          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A3R7CCH7 (Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Clonorchis sinensis OX=79923 GN=Dyrk1b PE=4 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 9.239e-134
Identity = 208/361 (57.62%), Postives = 268/361 (74.24%), Query Frame = 1
Query:  853 KNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQE---WGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIR 1926
            +   + +Y+Y ++PGE+W  RY I+ LIG GSFGQV+KA +  T E+VAIKIIKNK+ F  QAQ EI LL EM +Y    E + E    G+NYIV+L T FT  GHLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FLS+P+L+IIHCDLKPENILL++P+RSAIK+VDFGSSC V E++Y YIQSRFYRSP+++L ++Y+ +ID+WSLGCILVELHTG+PLF GQ E  Q+++I+E++GMPP  +L   ++ + +FE+ I  +    Y P         K++ +   SR L DILGV TGGP GRRA E GHS +DY  F++LV +ML  DPE RI+P +AL H FF R
Sbjct:  263 RRHTDANYDYIVRPGEMWMGRYLIQSLIGKGSFGQVMKAHNCATNEDVAIKIIKNKRAFTNQAQVEIRLLHEMNRYLEVAEASGEPAPLGANYIVRLLTHFTFRGHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCHALEFLSRPELRIIHCDLKPENILLVNPKRSAIKLVDFGSSCHVKEKVYQYIQSRFYRSPDVLLGLDYTMSIDMWSLGCILVELHTGEPLFAGQNEVGQMMKIIEVLGMPPRGLLEKSRRWHVFFERTIDRE----YIP---------KVACQPPGSRRLSDILGVNTGGPRGRRAHEPGHSPSDYNVFMELVLRMLTFDPERRIRPSSALAHRFFRR 610          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A2T7P0M0 (Protein kinase domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12113 PE=4 SV=1)

HSP 1 Score: 424.476 bits (1090), Expect = 2.678e-133
Identity = 237/455 (52.09%), Postives = 293/455 (64.40%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPL--DDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            PL K+SVDLI TYK+INE+YY KK+R       D+S NKKNK   +      D                                                  + +++Y I PGE W  RY I+ LIG GSFGQVVKA D   QE+VAIKIIKNKK F+ QAQ E+ LL  M ++   ++        YIV+LK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+++IVE++GMPP  +L   +KT KYF+Q+   DG  SY PK  + RDNKK  ++   +R L DI+G  TGGP GRRA E GHS +DY KF DLV +ML  DP+ RI P  AL+H FF
Sbjct:  125 PLRKMSVDLIKTYKHINEVYYAKKKRRAQVTQGDESGNKKNKTNTHVYNDGHD--------------------------------------------------DANHDYIIHPGEKWNERYEIDSLIGKGSFGQVVKAYDHGDQEHVAIKIIKNKKPFLNQAQIEVKLLELMNRHDAENKY-------YIVRLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFAGSNEFDQMMKIVEVLGMPPRSILDQAQKTRKYFDQL--PDG--SYVPK--KPRDNKK--YKSPGTRKLHDIIGTETGGPGGRRAGEPGHSVSDYLKFKDLVLRMLDYDPKTRISPYYALQHNFF 514          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A5J4NG04 (Dual specificity tyrosine-phosphorylation-regulated kinase 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0004529 PE=4 SV=1)

HSP 1 Score: 430.639 bits (1106), Expect = 6.453e-133
Identity = 212/391 (54.22%), Postives = 276/391 (70.59%), Query Frame = 1
Query:  835 NAPVSMKNMIEGS-----YEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAIS--------------------YQPK-IYRDRD-NKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIR 1926
            N PV   +   G+     +  F++ G++W  RY I  LIG G+FGQVV+A D  T E VAIK+IKNK++F++QA+ EI LL EM+ +Q+ +++A E G+NYIV LK  F HHGHLCLVFELL+YNLYDLL NTN++GVSLNLTRKF  Q+C AL FLS+P +Q+IHCDLKPENILL++P+RSAIKVVDFGSSC VSE++Y YIQSRFYRSPE++LN++Y   ID+WSLGCILVE+HTG+PLF G  E EQ+L+I+E++G PP  M+    K   +FE +    G  S                    ++PK I+  +D   + +F GV +R L  ++G  TGGP GRR  E GH+  DYEKF+DLVQ+MLV +P  RI+PE AL H FF+R
Sbjct:  530 NVPVGTVSTANGTVNPYFHHGFVRTGDVWHDRYKILALIGKGTFGQVVRALDEHTGEEVAIKVIKNKRSFLQQAEVEIKLLREMSAFQVNEQVAVEVGANYIVNLKAHFNHHGHLCLVFELLSYNLYDLLVNTNYRGVSLNLTRKFAQQLCAALVFLSRPDVQVIHCDLKPENILLVNPKRSAIKVVDFGSSCHVSEKVYQYIQSRFYRSPEVLLNLDYGLGIDMWSLGCILVEMHTGEPLFSGSNELEQLLQIIEVLGCPPVSMVETSPKLSTFFETIPSYPGTASQPTQSNQTDLLLPATSGLSWFKPKRIWHKQDWTHECTFLGVGARPLRSVVGADTGGPQGRRLGEPGHTPEDYEKFVDLVQRMLVYEPRQRIRPEEALAHRFFVR 920          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A564YX26 (Protein kinase domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS10358 PE=4 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 6.815e-133
Identity = 208/360 (57.78%), Postives = 270/360 (75.00%), Query Frame = 1
Query:  856 NMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQ---ITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIR 1926
            N  + +Y+Y ++PGE+W +RYY++ LIG GSFGQV+KARD V  E+VAIKIIKNK+ F  QA+ EI LL +M   Q     D      G+NY+V+L T F   GHLCLVFELL++NLYDLL+NTNF+GVSLNLTRKF  Q+C AL FLS+P LQIIHCDLKPENILLI+P+RSAIK+VDFGSSC V+E++Y YIQSRFYRSP+++L ++Y+ AID+WSLGCILVELHTG+PLF GQ E +Q+L+I+E++GM PS+++   ++   +FE+  G +   +Y+  +   +DN  IS++   +R L DILGV +GGP GRR  E GHS  DY  F+DLV +ML  DPE RI+P  AL H FF R
Sbjct:  645 NYTDANYDYIVRPGEVWMNRYYMDSLIGKGSFGQVMKARDFVANEDVAIKIIKNKRAFTNQAREEIRLLTKMNHLQDLNAADGSNSNQGANYVVRLLTHFMFRGHLCLVFELLSHNLYDLLRNTNFRGVSLNLTRKFTQQLCSALEFLSRPDLQIIHCDLKPENILLINPKRSAIKLVDFGSSCHVNEKVYQYIQSRFYRSPDVLLGLDYTMAIDMWSLGCILVELHTGEPLFAGQHELDQMLKIIEVLGMLPSYLIEKSRRWPLFFEREPGGNFVPNYKASM---KDNIPISYKAPGTRKLNDILGVNSGGPMGRRLQEPGHSPQDYAIFMDLVLQMLTYDPEKRIRPSEALAHRFFCR 1001          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk1ab (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, b [Source:ZFIN;Acc:ZDB-GENE-030131-5677])

HSP 1 Score: 380.178 bits (975), Expect = 3.896e-120
Identity = 228/453 (50.33%), Postives = 289/453 (63.80%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            PL KLS+DLI TYK+INE+YY KK+R              +Q   E    D+S K   K                                   V  +   + +++Y +K GE W  RY I+ LIG GSFGQVVKA D   QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H++    K  K+FE++  +DG+ S    + + +D K+  ++  +SR L  ILGV  GGP GRRA E GH+  DY KF DLV +ML  DP+ RI+P  AL+H FF
Sbjct:   88 PLRKLSIDLIKTYKHINEVYYAKKKRRH------------QQGQGE----DSSHKKERK-----------------------------------VVNEGYDDDNFDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKL--SDGSWS----VKKTKDGKR--YKPPASRKLHAILGVEAGGPGGRRAGESGHAVADYLKFKDLVLRMLDYDPKTRIQPYYALQHSFF 474          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 371.703 bits (953), Expect = 4.593e-117
Identity = 224/453 (49.45%), Postives = 283/453 (62.47%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            PL KLS++LI TYK+INE+YY KK            K+  +Q   E    D+S K   K                                   +      + +++Y +K GE W  RY I+ LIG GSFGQVVKA D   QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PPSH+L    K  K+FE++  +           + +D K+  ++   SR L +ILGV  GGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF
Sbjct:   75 PLRKLSIELIKTYKHINEVYYAKK------------KRRHQQGQGE----DSSNKKERK-----------------------------------IYNDGYDDDNFDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRHEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGVPPSHILDQAPKARKFFEKMSDSTWCAK------KTKDGKR--YKPAGSRKLHNILGVEAGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFF 461          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:103042530])

HSP 1 Score: 245.358 bits (625), Expect = 3.499e-71
Identity = 150/381 (39.37%), Postives = 209/381 (54.86%), Query Frame = 1
Query:  865 EGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNL-QPSNSDTNSQVNINQTAANLASVS 2004
            +GSY +   P +    RY + ++IG GSFGQVVKA D  T ++VA+K+++N+K F  QA  EI +L  + K      M        ++ +   FT   H+C+ FELL+ NLY+L+K   F+G SL L RKF   I + L  L K +  IIHCDLKPENILL    RS IKV+DFGSSC   +R+Y YIQSRFYR+PE+IL   Y   ID+WSLGCIL EL TG PL  G+ E +Q+  ++EL+GMP   +L + K+   +    I + G   Y         +  ++  G  SR      G   G P G +         D   FLD +++ L  DP  R+ P  AL+HP+  R L +P   +  +   I +    + S+S
Sbjct:  192 QGSYIHV--PHDHIAYRYEVLKVIGKGSFGQVVKAYDHKTHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMN-------VIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDSLHKNR--IIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIELLGMPSQKLLDSSKRAKNF----ISSKGYPRYC--TVTSLPDGTVALNGGRSRR-----GKLRGPP-GSKDWVTALKGCDDPLFLDFLKQCLEWDPTLRMTPSQALRHPWLRRRLPKPPTGEKTTVKRITEGTGAITSIS 549          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:103034036])

HSP 1 Score: 241.506 bits (615), Expect = 6.508e-70
Identity = 151/399 (37.84%), Postives = 211/399 (52.88%), Query Frame = 1
Query:  913 RYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQ---PSNSDTNSQVNINQTAANLASVSTDLS--TPQTIHTIETDCFNASCSTEPTHTYL 2094
            RY   ++IG GSFGQV K  D    +++A+K+++N+K F  QA  EI +L  + K   T       GS  +V +   FT   H+C+ FELL+ NLY+L+K   F+G SL L RKF   I + L  L +   +IIHCDLKPENILL    RS IKV+DFGSSC   +R+Y YIQSRFYR+PE+IL   Y   ID+WS GCIL EL TG PLF G+ E +Q+  ++EL+GMPP  +L   K+   +    I + G   Y         N  +   G  SR           GP G +         D   F+D ++K L  +P  R+ P +AL+HP+  + L    PS   T     I + + +  S+ + +     QT + + T+    S  + P  T L
Sbjct:  195 RYEFLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKT-------GSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALQR--HKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPQKLLEQAKRAKNF----INSKGHPRYC--TVTTLSNGTLVLNGSRSRR------GKMRGPPGSKEWVTALKGCDDPTFIDFLRKCLDWEPSTRMTPVSALRHPWLYKRLPKPVPSGEKTMVPKRITEHSTSFPSIISKVPPVVGQTNNKLRTNMMGDSSGSIPLRTVL 572          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:103034036])

HSP 1 Score: 241.506 bits (615), Expect = 8.777e-70
Identity = 151/399 (37.84%), Postives = 211/399 (52.88%), Query Frame = 1
Query:  913 RYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQ---PSNSDTNSQVNINQTAANLASVSTDLS--TPQTIHTIETDCFNASCSTEPTHTYL 2094
            RY   ++IG GSFGQV K  D    +++A+K+++N+K F  QA  EI +L  + K   T       GS  +V +   FT   H+C+ FELL+ NLY+L+K   F+G SL L RKF   I + L  L +   +IIHCDLKPENILL    RS IKV+DFGSSC   +R+Y YIQSRFYR+PE+IL   Y   ID+WS GCIL EL TG PLF G+ E +Q+  ++EL+GMPP  +L   K+   +    I + G   Y         N  +   G  SR           GP G +         D   F+D ++K L  +P  R+ P +AL+HP+  + L    PS   T     I + + +  S+ + +     QT + + T+    S  + P  T L
Sbjct:  203 RYEFLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKT-------GSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALQR--HKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPQKLLEQAKRAKNF----INSKGHPRYC--TVTTLSNGTLVLNGSRSRR------GKMRGPPGSKEWVTALKGCDDPTFIDFLRKCLDWEPSTRMTPVSALRHPWLYKRLPKPVPSGEKTMVPKRITEHSTSFPSIISKVPPVVGQTNNKLRTNMMGDSSGSIPLRTVL 580          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 404.831 bits (1039), Expect = 7.100e-130
Identity = 232/466 (49.79%), Postives = 292/466 (62.66%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNS 1959
            PL KLSVDLI TYK+INE+YY KK+R                   +Q   D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D   QE VAIKIIKNKK F+ QAQ E+ LL  M K+  TD         YIV LK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+HML    K  KYFE++  +DG+ +    + + +D+K+  ++   SR L DI+GV +GGP GRR  E GH+  DY KF DL+ +ML  DP+ RI P  AL+H FF +      + +NS
Sbjct:   95 PLRKLSVDLIKTYKHINEVYYAKKKRRAQ----------------QQQGEDSSHKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHQEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHD-TDM------KYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGLPPTHMLEQAPKARKYFERL--SDGSWT----VKKTKDSKR-EYKTAGSRKLHDIIGVESGGPGGRRMGEAGHTVADYLKFKDLILRMLDYDPKTRITPFYALQHNFFKKTTDEGTNTSNS 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 248.054 bits (632), Expect = 3.696e-73
Identity = 143/335 (42.69%), Postives = 192/335 (57.31%), Query Frame = 1
Query:  913 RYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPF 1917
            RY + ++IG GSFGQVVKA D  TQ +VA+K+++N+K F  QA  EI +L  + K    + M        I+ L  +FT  GH+C+ FELL+ NLY+L+K   F+G SL L RKF   I + L  L + +  IIHCDLKPENILL  P RS IKV+DFGSSC   +R+Y YIQSRFYR+PE++L   Y   ID+WSLGCIL EL TG PL  G+ E +Q+   +EL+GMPP  +L  GK++  +    + + G   Y   +    D   +   G S R           GP G R         D    LD ++  L  +P  R+ P  AL+HP+
Sbjct:  161 RYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDRENSM-------NIIHLLESFTFRGHVCMTFELLSMNLYELIKKNKFQGFSLALVRKFAHSILQCLDTLHRNR--IIHCDLKPENILLKQPGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVVLGARYGPPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELLGMPPQRLLAQGKRSRNF----VSSRGHPRYC-GVTEAPDGAVVLNAGRSRRG-------KPRGPPGSRELPAALRGCDDPLLLDFLRGCLEWEPSERLTPAQALRHPW 474          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 216.468 bits (550), Expect = 1.303e-61
Identity = 139/360 (38.61%), Postives = 192/360 (53.33%), Query Frame = 1
Query:  865 EGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVV-DFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQV----IGTDGAISYQPKIYRDRDNKKISFRG-VSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIR 1926
            +GSY +   P +    RY + ++IG GSFGQVVKA D  T + VA+K+++N+K F  QA  EI +L  + K    + M        ++ +  +F    H+C+ FELL+ NLY+L+K   F+G SL + RKF   I   L  L K +  IIHCDLKPENILL    RS IK++ DFGSSC   +R+Y YIQSRFYR+P       Y   ID+WSLGCIL EL TG PL  G+ E +Q+   +EL G PP+ +L   K+  ++F  +      T   +   P +      ++   RG  SSR+    L                    D   F+D ++K L  DP  R+ P  ALKHP+  R
Sbjct:  157 QGSYIHV--PHDHVAYRYEVLRVIGKGSFGQVVKAYDHRTHQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKENTMN-------VIHMLESFNFRNHICMTFELLSMNLYELIKKNKFQGFSLQVVRKFAHSILLCLNALHKNR--IIHCDLKPENILLRQQGRSGIKIIIDFGSSCYEHQRVYTYIQSRFYRAP----GGRYGLPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELTGSPPARLLEQSKRARQFFSSLGHPRYCTVTTLPGGPVVLNGGRTRRGKLRGPPSSRDWTTAL-----------------KGCDDHLFIDFLKKCLDWDPATRLTPSQALKHPWLRR 484          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: hipk2 (homeodomain interacting protein kinase 2 [Source:ZFIN;Acc:ZDB-GENE-031125-4])

HSP 1 Score: 209.534 bits (532), Expect = 1.051e-56
Identity = 126/345 (36.52%), Postives = 189/345 (54.78%), Query Frame = 1
Query:  916 YYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSA--IKVVDFGSSCRVSERI-YCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISY--QPKIY------RDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPF 1917
            Y + + +G G+FGQVVK     T E VAIKI+KN  ++  Q Q E+ +L      +++ E A ++     V+    F H  H CLVFE+L  NLYD LK  NF  + L   R    Q+  AL  L    L +IH DLKPENI+L+ P R    +KV+DFGS+  VS+ +   Y+QSR+YR+PEIIL + + +AID+WSLGC++ EL  G PL+ G  E++QI  I    G+PP  +L AG KT ++F++  G    +     P+ +      + ++ +K  F  +      +      G       S++     D  +F++L+++ML +D + RI P   L HPF
Sbjct:  192 YEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYARQGQVEVGILA-----RLSSESADDYN---FVRAHECFQHKSHTCLVFEMLEQNLYDFLKQNNFSPLPLKYIRPVLQQVASALMKLKS--LGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISATQGLPPEQLLSAGTKTGRFFQRETGAGYPLWRIKSPEEHEAETGIKSKEARKYMFNCLEDMGQVNPASDLEG-------SDVLAEKADRRQFIELLRRMLTMDADKRISPLETLAHPF 519          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007958.1 (pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 3.743e-45
Identity = 112/335 (33.43%), Postives = 173/335 (51.64%), Query Frame = 1
Query:  913 RYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPF 1917
            RY + +++G GSFG+V+K  D  ++E VAIK++   +      + EI +L  +       + A+E  S+ I+++   F+  G  C+VFELL  NL   LK T+ +G  L + R F   + ++L  L      +IH DLKP NI +       +K+ DFG SC   E  +  IQ+R YR+PE+IL++ YS   D+WSLGC L ELH+GQ LF G    +Q+  I+E+ G+PP  M+   +    +F        AI+ +P  + D +N +   R   SR L          P   R ++        E F D ++  L  DPE+R+ P  A+ H +
Sbjct:   10 RYEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVLNRARFNESVHRREIEILKRL-------QTARE--SSKIIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDAN--VIHGDLKPGNIGICSYEAGEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFF--------AIT-KPTHW-DINNHRGLVRVPGSRAL----------PLALRTTD--------EHFTDFIRSCLQWDPEWRLTPHGAMDHEW 305          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: YAK1 (Serine-threonine protein kinase; component of a glucose-sensing system that inhibits growth in response to glucose availability; upon nutrient deprivation Yak1p phosphorylates Pop2p to regulate mRNA deadenylation, the co-repressor Crf1p to inhibit transcription of ribosomal genes, and the stress-responsive transcription factors Hsf1p and Msn2p; nuclear localization negatively regulated by the Ras/PKA signaling pathway in the presence of glucose [Source:SGD;Acc:S000003677])

HSP 1 Score: 237.269 bits (604), Expect = 1.740e-67
Identity = 129/347 (37.18%), Postives = 208/347 (59.94%), Query Frame = 1
Query:  913 RYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDN--------KKISFRGVSSRNLCDILGVYTGGPFGRRASEL-GHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIR 1926
            +Y +  ++G G+FGQVVK ++++T+E +A+K++K++  ++ Q+ TE  +L      ++ ++       ++ +++  +F H  HLCLVFELL+ NLY+LLK   F G+S+ L R F +QI ++L  L + +L  IHCDLKPENILL  P +  +K++DFGSSC  +  +Y YIQSRFYR+PEIIL + YS +ID+WSLGCI+ EL  G P+F G  E+ Q+ RI++ +G PPS M+  GK + K+ +++   + + S Q    +  +         +K S +    R L DI+  Y      + + EL      + E  +  +  +L L+P  R  P+ A+ HPF  +
Sbjct:  368 KYLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKIL------ELLNQKIDPTNKHHFLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLKESKL--IHCDLKPENILLCAPDKPELKIIDFGSSCEEARTVYTYIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMIDMGKNSGKFMKKLAPEESSSSTQKHRMKTIEEFCREYNIVEKPSKQYFKWRKLPDIIRNYRYPKSIQNSQELIDQEMQNRECLIHFLGGVLNLNPLERWTPQQAMLHPFITK 706          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 109.768 bits (273), Expect = 2.626e-26
Identity = 110/371 (29.65%), Postives = 171/371 (46.09%), Query Frame = 1
Query:  910 SRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXX--XXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTN--FKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFG-SSCRVSER---------IYCYIQSRFYRSPEIILNV-EYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYE-KFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNSQVNIN 1974
            S+Y +  LIG G++G V  A    +   VAIK I+  +KK FV +   EI LL    +++    +  +     I KL   +       LV EL+  +L  ++ N N  F  +S +  + F  QI  AL   S    Q+IH D+KP N+LL       +KV DFG + C  S           +  Y+ +R+YR+PEI+L   EY+ A+DIWS GCIL E+ +G+PLF G+  H Q+  I+E++G P          +++ F Q+                        +   ++     L +    P+     E   S TD     +DL+ KML  +P+ RI    AL+HP+      PS+      +N++
Sbjct:   11 SQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVY-------LVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALK--SIHSAQVIHRDIKPSNLLL--NSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTP----------SFEDFNQI------------------------KSKRAKEYIANLPMRPPLPW-----ETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSDEPEYPPLNLD 331          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 106.301 bits (264), Expect = 1.060e-25
Identity = 79/274 (28.83%), Postives = 129/274 (47.08%), Query Frame = 1
Query: 1123 IVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNF----KGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCY---IQSRFYRSPEIILNVE-YSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            IV+L         L LVFE +  +L   + +       +G+ LNL + F  Q+ + LAF  + +  I+H DLKP+N+L+   +R  +K+ DFG +      +  +   + + +YR+P++++    YS +IDIWS GCIL E+ TG+PLF G  + EQ+  I ++MG P   +  +  K  KY                      N  I  R    R+L  +L  +T  P                  +D +  +L L+P+ R+  + AL HP+F
Sbjct:   65 IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENK--ILHRDLKPQNLLI--NKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKY----------------------NPNIQQR--PPRDLRQVLQPHTKEPLD-------------GNLMDFLHGLLQLNPDMRLSAKQALHHPWF 297          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: MCK1 (Dual-specificity ser/thr and tyrosine protein kinase; roles in chromosome segregation, meiotic entry, genome stability, phosphorylation-dependent protein degradation (Rcn1p and Cdc6p), inhibition of protein kinase A, transcriptional regulation, inhibition of RNA pol III, calcium stress and inhibition of Clb2p-Cdc28p after nuclear division; MCK1 has a paralog, YGK3, that arose from the whole genome duplication [Source:SGD;Acc:S000005251])

HSP 1 Score: 103.99 bits (258), Expect = 2.192e-24
Identity = 100/348 (28.74%), Postives = 153/348 (43.97%), Query Frame = 1
Query:  934 IGTGSFGQVVKARDMVTQEN-VAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTH--------HGHLCLVFELLTYNLYDLLKN--TNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRV--SERIYCYIQSRFYRSPEIILN-VEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF--IRN 1929
            IG G+FG VV+A     ++N +    IK      E    E+ +L      +I D          IVKL+  FTH        + HL +  E L   L   +    TN   + L   R +  QI   + +L    L + H D+KP N+L + P    +K+ DFGS+ ++  ++    YI SRFYR+PE+I+   +Y+  IDIW LGC++ E+  G+ +F GQ    Q+  I +L+G P    +      Y         DG +  +P                          +++G    R     GHS  D    +DL+ K+LV +P+ R+ P   L H FF  +RN
Sbjct:   41 IGRGAFGTVVQAYLTQDKKNWLGPFAIKKVPAHTEYKSRELQIL------RIADHPN-------IVKLQYFFTHLSPQDNKVYQHLAM--ECLPETLQIEINRYVTNKLEMPLKHIRLYTYQIARGMLYLHG--LGVCHRDIKPSNVL-VDPETGVLKICDFGSAKKLEHNQPSISYICSRFYRAPELIIGCTQYTTQIDIWGLGCVMGEMLIGKAIFQGQEPLLQLREIAKLLGPPDKRFIFFSNPAY---------DGPLFSKP--------------------------LFSGSSQQRFEKYFGHSGPDG---IDLLMKILVYEPQQRLSPRRILAHQFFNELRN 332          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: KNS1 (Protein kinase involved in negative regulation of PolIII transcription; effector kinase of the TOR signaling pathway and phosphorylates Rpc53p to regulate ribosome and tRNA biosynthesis; member of the LAMMER family of protein kinases, which are serine/threonine kinases also capable of phosphorylating tyrosine residues; capable of autophosphorylation [Source:SGD;Acc:S000003942])

HSP 1 Score: 105.531 bits (262), Expect = 7.241e-24
Identity = 85/279 (30.47%), Postives = 134/279 (48.03%), Query Frame = 1
Query:  865 EGSYEYFIKPGEIWKS--RYYIEQLIGTGSFGQVVKARDMVTQEN-VAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENIL------------------LIHPRRSA------------IKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMP 1602
            +G Y Y  +  +I+ S  R+ ++ L+G G+FG+V+K  D   + N VA+K+I+    + E A+TE+ +L       I +   Q  G    + L+  F +  H+CLV +L   ++YD + +        +  +    Q+  ++ FL    L IIH DLKPENIL                  L   RR A            IK++DFGS+    E     I +R YR+PEI+L + +S   DIWS+ C+LVEL  G+ L+      E +  +  + G P
Sbjct:  296 DGHYVY--QENDIFGSGGRFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELRILQ-----TILNNDPQ--GQFQCLLLRECFDYKNHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAIARQLIRSVCFLH--DLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRREASKGKRKILKNPEIKIIDFGSAIFHYEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIGESLYPIHENLEHMAMMQRINGTP 563          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO45187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC8])

HSP 1 Score: 394.045 bits (1011), Expect = 6.619e-130
Identity = 230/469 (49.04%), Postives = 286/469 (60.98%), Query Frame = 1
Query:  562 PLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNSQVN 1968
            PL KLSVDLI TYK+INE+YY  K+R +    D +  K +                                               PPQ N     +N     Y+Y +K GE W  RY IE LIG GSFGQV KA D   +E++A+KIIKNKK F+ QAQ E+ LL  M K           G  YIV+LK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL  P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y+ AID+WSLGCILVE+HTG+PLF G  E +Q+++IVE++GMPP  +L    K  K+F+++   DG  SYQ    +D   + +S     SR L DILG  TGGP GRR  E GH+  DY KF DL+ +ML  D + RI P AAL H FF +  +   + T+S  N
Sbjct:   13 PLRKLSVDLIKTYKHINEVYYANKKRPKPEEPDPVRPKKR-----------------------------------------------PPQYNDGYDDEN-----YDYIVKAGEKWFDRYEIESLIGKGSFGQVCKAYDHQEKEHIAVKIIKNKKPFLNQAQIEVKLLELMNKNDPD-------GKYYIVRLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLCSPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQIGQRIYQYIQSRFYRSPEVLLGIPYNLAIDMWSLGCILVEMHTGEPLFSGANEFDQMMKIVEVLGMPPKDILDNAPKARKFFDRL--PDG--SYQCLKVKDGVKEYLS---PGSRKLHDILGCETGGPGGRRLGEAGHTLQDYLKFKDLILRMLDYDRKTRIVPYAALHHCFFKKTAEEGTNTTHSATN 415          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO46144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP1])

HSP 1 Score: 236.113 bits (601), Expect = 1.136e-68
Identity = 153/381 (40.16%), Postives = 210/381 (55.12%), Query Frame = 1
Query:  865 EGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNSQVNINQTAANLASVST 2007
            +GSY +   P +    RY + ++IG GSFGQVVKA D  T  +VA+K+++N+K F  QAQ EI +L E  K Q  D       ++ I+ +   FT   H+C+ FELL+ NLY+L+K   F+G SL L RKF   I + L  L K +  IIHCDLKPENILL    RS IKV+DFGSSC   +RIY YIQSRFYR+PE+IL   Y   ID+WS GCIL EL TG PLF G+ E +Q+   +EL+G  P  +    ++T K  +  I + G   Y         +  ++  G  SR      G   G P  +   +      D   F+D +++ L  DP  R+ P  AL+HP+  R   P   ++N+         NLAS ++
Sbjct:  152 QGSYIHV--PKDHIAYRYEVLKIIGKGSFGQVVKALDHKTNTHVALKMVRNEKRFHRQAQEEIRIL-EHLKKQDKDN------THNIIHMLEHFTFRNHVCMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNR--IIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGARYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACNMELLGYIPEKL----RETSKRAKNFINSKGYPRYC--TITTLPDGSVAVSGGRSRR-----GKTRGAPNSKTFVQ-ALKGCDDAMFIDFLKRCLEWDPSARMTPSQALRHPWLRRRALPRAPESNN---------NLASATS 500          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO36294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ45])

HSP 1 Score: 212.231 bits (539), Expect = 3.450e-62
Identity = 114/246 (46.34%), Postives = 163/246 (66.26%), Query Frame = 1
Query:  913 RYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFE 1650
            RY + +++G GSFGQVVKA D  T ++VA+KII+NKK F +QA  E+ +L  + K         +  ++ ++ +   F    HLC+ FEL+  NLY+L+K  NF+G SL L R+F   +   L  + K +  IIHCDLKPENILL    +++IKV+DFGSSC   +R+Y YIQSRFYRSPE+IL + YS AID+WS GCIL EL+TG PLF G+ E EQ+  I+E++G+P   ++ +  +   +F+
Sbjct:   59 RYEVLEVLGKGSFGQVVKALDHKTGQHVAVKIIRNKKRFHQQALVEVKILDNLRK-------KDKDNTHNLIHMIEHFYFRNHLCITFELMGMNLYELIKKNNFQGFSLALIRRFAFALLHCLKVIHKEK--IIHCDLKPENILLRQRGQTSIKVIDFGSSCYEHQRVYTYIQSRFYRSPEVILGLPYSMAIDMWSFGCILAELYTGYPLFPGENEVEQLACIMEVLGLPSPKLIESASRRRLFFD 295          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO49238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV4])

HSP 1 Score: 197.208 bits (500), Expect = 1.805e-56
Identity = 125/346 (36.13%), Postives = 193/346 (55.78%), Query Frame = 1
Query:  922 IEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRS--AIKVVDFGSSCRVSERIYC--YIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTD-GAISYQPKIYRD---------RDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPF 1917
            + + +G G+FGQVVK     T E VAIKI+K+  ++  Q Q EI++L +++        A+   +   V+    F H  H CLVFE+L  NLYD LK + F  + L   R    Q+  AL+ L    L +IH DLKPENI+L+ P +    +KV+DFGS+  VS ++ C  Y+QSR+YR+PE+IL + + ++ID+WSLGC++ EL  G PL+ G  E +QI  I++  G+P  H+L    KT ++F++ I T  G + ++ K   +         ++ +K  F  +      ++    TG     R +E      D  +F+ L+++ML +D E RI PE AL H F
Sbjct:    1 VLEFLGRGTFGQVVKCWKKGTNELVAIKILKDHPSYARQGQIEISILAKLS--------AENSEAYNFVRAIECFQHKNHTCLVFEMLQQNLYDYLKQSKFNPLPLKHIRPIVQQVLVALSKLRT--LGLIHADLKPENIMLVDPDKQPFRVKVIDFGSATHVS-KVVCSTYLQSRYYRAPEVILGLPFCESIDMWSLGCVIAELFLGWPLYPGSSEFDQIRYIIQTQGLPYDHLLNNATKTSRFFKKAINTHTGVLEWKLKNANEHERETKIPSKEARKYIFNSLDDIAQVNLSSSLTG---NERIAE----KIDRYEFVSLLKRMLTIDQEKRITPEEALSHQF 328          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO33758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR83])

HSP 1 Score: 164.466 bits (415), Expect = 6.709e-44
Identity = 110/359 (30.64%), Postives = 182/359 (50.70%), Query Frame = 1
Query:  895 GEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLI-----------------HPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            G+   SRY +  L+G G+FG+V++  D  T + VA+K+IKN + + E A+ EI +L ++ +          +G +  +K+   F HHGH+CLVFE +  +++D +K+ N++   L+  R    Q+  A+ FL   ++++ H DLKPEN+L +                 + + S ++++DFGS+    E     + +R YR+PE+IL + +S   DIWS+GCI+ EL+TG  LF      E +  +  ++G  PS      +KT KYF +     G + +  K          S  G   R  C  L  Y           +   S  ++ F +L+  +L  DPE RI  + A++HPFF
Sbjct:  118 GDQLHSRYEVHCLLGEGTFGKVLECYDKKTGDVVAVKVIKNIEKYREAAKLEIKVLEKINQ-------KNRYGKSLCIKMLDWFNHHGHMCLVFEKMGLSVFDFMKDNNYEPYPLDQVRHISYQLIVAVKFLH--EMKLTHTDLKPENMLFVNSDCDVFYNKDTKQDQRYVKSSHMRLIDFGSATFEHEHHSTTVSTRHYRAPEVILELGWSYPCDIWSIGCIMFELYTGFTLFQTHENREHLAMMERIIGPIPSDFAKKSRKT-KYFYK-----GKLEWDEK----------SSSGKYVRENCKPLKKY-----------MLSDSEGHQLFFNLLDYLLEYDPEKRITAKEAMQHPFF 440          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1ab (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:NCBI gene;Acc:101169628])

HSP 1 Score: 397.897 bits (1021), Expect = 4.214e-127
Identity = 233/463 (50.32%), Postives = 293/463 (63.28%), Query Frame = 1
Query:  532 CSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            C   PT+   PL KLS+DLI TYK+INE+YY KK            K+  +Q   E    D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H++    K  K+FE++  +DG  S    + + +D K+  ++  +SR L  ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF
Sbjct:   72 CFRDPTS--APLRKLSIDLIKTYKHINEVYYAKK------------KRRHQQGQGE----DSSHKKERK-----------------------------------VFNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKL--SDGTWS----VKKTKDGKR--YKPPASRKLHSILGVETGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFF 466          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1ab (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:NCBI gene;Acc:101169628])

HSP 1 Score: 397.127 bits (1019), Expect = 4.546e-127
Identity = 233/463 (50.32%), Postives = 293/463 (63.28%), Query Frame = 1
Query:  532 CSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            C   PT+   PL KLS+DLI TYK+INE+YY KK            K+  +Q   E    D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H++    K  K+FE++  +DG  S    + + +D K+  ++  +SR L  ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF
Sbjct:   46 CFRDPTS--APLRKLSIDLIKTYKHINEVYYAKK------------KRRHQQGQGE----DSSHKKERK-----------------------------------VFNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKL--SDGTWS----VKKTKDGKR--YKPPASRKLHSILGVETGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFF 440          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1ab (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:NCBI gene;Acc:101169628])

HSP 1 Score: 397.512 bits (1020), Expect = 8.546e-127
Identity = 233/463 (50.32%), Postives = 293/463 (63.28%), Query Frame = 1
Query:  532 CSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            C   PT+   PL KLS+DLI TYK+INE+YY KK            K+  +Q   E    D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H++    K  K+FE++  +DG  S    + + +D K+  ++  +SR L  ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF
Sbjct:   75 CFRDPTS--APLRKLSIDLIKTYKHINEVYYAKK------------KRRHQQGQGE----DSSHKKERK-----------------------------------VFNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKL--SDGTWS----VKKTKDGKR--YKPPASRKLHSILGVETGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFF 469          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1ab (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:NCBI gene;Acc:101169628])

HSP 1 Score: 397.512 bits (1020), Expect = 8.546e-127
Identity = 233/463 (50.32%), Postives = 293/463 (63.28%), Query Frame = 1
Query:  532 CSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            C   PT+   PL KLS+DLI TYK+INE+YY KK            K+  +Q   E    D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D V QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFE+L+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PP+H++    K  K+FE++  +DG  S    + + +D K+  ++  +SR L  ILGV TGGP GRRA E GH+  DY KF DL+ +ML  DP+ RI+P  AL+H FF
Sbjct:   75 CFRDPTS--APLRKLSIDLIKTYKHINEVYYAKK------------KRRHQQGQGE----DSSHKKERK-----------------------------------VFNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDT--EM-----KYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKL--SDGTWS----VKKTKDGKR--YKPPASRKLHSILGVETGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFF 469          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1b (dual specificity tyrosine-phosphorylation-regulated kinase 1B [Source:NCBI gene;Acc:101167568])

HSP 1 Score: 328.176 bits (840), Expect = 1.365e-102
Identity = 194/367 (52.86%), Postives = 234/367 (63.76%), Query Frame = 1
Query:  541 PPTNRN---KPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKK 1632
            PP+ R+    PL KLSVDLI TYK+INE+YY KK+R              +Q+  E    D+S K   K                                   V      + +Y+Y +K GE W  RY I+ LIG GSFGQVVKA D   QE VAIKIIKNKK F+ QAQ E+ LL  M K+    EM       YIV LK  F    HLCLVFELL+YNLYDLL+NTNF+GVSLNLTRKF  Q+C AL FL+ P+L IIHCDLKPENILL +P+RSAIK+VDFGSSC++ +RIY YIQSRFYRSPE++L + Y  AID+WSLGCILVE+HTG+PLF G  E +Q+ +IVE++G+PPSHML A  K
Sbjct:   15 PPSFRDPASAPLRKLSVDLIKTYKHINEVYYTKKKRR------------AQQVPPE----DSSTKKERK-----------------------------------VYNDGYDDDNYDYIVKNGEKWLDRYEIDSLIGKGSFGQVVKAYDHHEQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDT--EMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGVPPSHMLDAAPK 323          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000041146.1 (SMESG000041146.1)

HSP 1 Score: 1390.17 bits (3597), Expect = 0.000e+0
Identity = 701/701 (100.00%), Postives = 701/701 (100.00%), Query Frame = 1
Query:   88 MNYKCNIDKMGFESISHKEENTTKLNQLKAHQLQKQNVFPHRTEAKKSGPVYGQLLTEDQVNQLNNQNIGLDSKTSGYVNLPMSQVGSVKTSCSSNETSKRQSAVPYYHYPEFPFTNSQQNLKSNPQCNKNKVYANTSQFNISPLSNNCSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNSQVNINQTAANLASVSTDLSTPQTIHTIETDCFNASCSTEPTHTYLTYVGSNHDCVMNNADCSKQFEVSLTNASKSES 2190
            MNYKCNIDKMGFESISHKEENTTKLNQLKAHQLQKQNVFPHRTEAKKSGPVYGQLLTEDQVNQLNNQNIGLDSKTSGYVNLPMSQVGSVKTSCSSNETSKRQSAVPYYHYPEFPFTNSQQNLKSNPQCNKNKVYANTSQFNISPLSNNCSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIHHNYQNAGHHHHHHHHHYHQNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAIKIIKNKKNFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNSQVNINQTAANLASVSTDLSTPQTIHTIETDCFNASCSTEPTHTYLTYVGSNHDCVMNNADCSKQFEVSLTNASKSES
Sbjct:    1 MNYKCNIDKMGFESISHKEENTTKLNQLKAHQLQKQNVFPHRTEAKKSGPVYGQLLTEDQVNQLNNQNIGLDSKTSGYVNLPMSQVGSVKTSCSSNETSKRQSAVPYYHYPEFPFTNSQQNLKSNPQCNKNKVYANTSQFNISPLSNNCSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIHHNYQNAGHHHHHHHHHYHQNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAIKIIKNKKNFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNSQVNINQTAANLASVSTDLSTPQTIHTIETDCFNASCSTEPTHTYLTYVGSNHDCVMNNADCSKQFEVSLTNASKSES 701          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000041146.1 (SMESG000041146.1)

HSP 1 Score: 1370.91 bits (3547), Expect = 0.000e+0
Identity = 692/692 (100.00%), Postives = 692/692 (100.00%), Query Frame = 1
Query:  115 MGFESISHKEENTTKLNQLKAHQLQKQNVFPHRTEAKKSGPVYGQLLTEDQVNQLNNQNIGLDSKTSGYVNLPMSQVGSVKTSCSSNETSKRQSAVPYYHYPEFPFTNSQQNLKSNPQCNKNKVYANTSQFNISPLSNNCSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXXXXXXXXXNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNSQVNINQTAANLASVSTDLSTPQTIHTIETDCFNASCSTEPTHTYLTYVGSNHDCVMNNADCSKQFEVSLTNASKSES 2190
            MGFESISHKEENTTKLNQLKAHQLQKQNVFPHRTEAKKSGPVYGQLLTEDQVNQLNNQNIGLDSKTSGYVNLPMSQVGSVKTSCSSNETSKRQSAVPYYHYPEFPFTNSQQNLKSNPQCNKNKVYANTSQFNISPLSNNCSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIHHNYQNAGHHHHHHHHHYHQNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAIKIIKNKKNFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNSQVNINQTAANLASVSTDLSTPQTIHTIETDCFNASCSTEPTHTYLTYVGSNHDCVMNNADCSKQFEVSLTNASKSES
Sbjct:    1 MGFESISHKEENTTKLNQLKAHQLQKQNVFPHRTEAKKSGPVYGQLLTEDQVNQLNNQNIGLDSKTSGYVNLPMSQVGSVKTSCSSNETSKRQSAVPYYHYPEFPFTNSQQNLKSNPQCNKNKVYANTSQFNISPLSNNCSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIHHNYQNAGHHHHHHHHHYHQNKPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAIKIIKNKKNFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTNSQVNINQTAANLASVSTDLSTPQTIHTIETDCFNASCSTEPTHTYLTYVGSNHDCVMNNADCSKQFEVSLTNASKSES 692          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000080906.1 (SMESG000080906.1)

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 345/688 (50.15%), Postives = 435/688 (63.23%), Query Frame = 1
Query:  235 PVYGQLLTEDQVNQLNNQN--IGLDSKTSG--------------------YVNL-----PM--SQVGSVKTSCSSNETSKRQSAV-------------------PYYHYPEFPF----------------TNSQQNL-------------------KSNPQCNKNKVYANTS----------QFNISPLSNNCSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXX-----------XXXXXXXNKPPLPP--------PQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTD--GAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTN 1956
            PVYG L+T DQ+NQ+  +   +GL S  S                     Y NL     PM  + + S     S N  S   S++                    YYHYP+F +                +N+QQNL                   +SN   N N   +++S          +     L   CS+P       LIKLSVDLI TYKNINE+YY+KKRR ++P DD+  KK++K+ +  +   +T  KSS++ +          +                 +   + P+P         P  N   S+ +   G YEY IKPGEIWKS+Y IE+LIGTGSFGQVV+A+D+ + E VAIKIIKNK+NFVEQA  EI+LL E+ K+Q  DE+AQEWG+NYIVKLK+ F H GHLCLVFELLTY LY+LLKNTNF+GVSLNLTRKF  QIC+AL FLSKPQ+QIIHCDLKPENILL+HPRRSAIKVVDFGSSC  + RIY YIQSRFYRSPEIILN++YS AID+WSLGCI+ ELHTGQPLFIGQFEHEQILRI+E++GMPP+ M+ +GKK+ +YF++   T+     +Y+PK++R++D KKI+F+G+SSR L DI+GVYTGGP GRR +E GHSS DYEKFLDL+QKM+V+DP+ RIKP+ ALKHPFFIR+     SDTN
Sbjct:   19 PVYGHLVTADQLNQIEKRKGVLGLHSTDSASKTIFSAINTGIEISSDNFIYANLANTNEPMDITNISSEVQMASPNHHSGSLSSIISTYASPKFEKKSEDDVGGSYYHYPDFSYCQGNLGIDKLYVNTFVSNAQQNLIRSHNISTSLTSSKTLTEKQSNFAGNLNFPKSDSSIDKTLTSLPMETGAIKLDPRCSNPHI-----LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHE--DNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFELLTYTLYELLKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPNTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST--PTSDTN 697          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000080906.1 (SMESG000080906.1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 345/688 (50.15%), Postives = 435/688 (63.23%), Query Frame = 1
Query:  235 PVYGQLLTEDQVNQLNNQN--IGLDSKTSG--------------------YVNL-----PM--SQVGSVKTSCSSNETSKRQSAV-------------------PYYHYPEFPF----------------TNSQQNL-------------------KSNPQCNKNKVYANTS----------QFNISPLSNNCSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSDTSEKSSSKNIXXXXXXXXXXXXX-----------XXXXXXXNKPPLPP--------PQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTD--GAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTN 1956
            PVYG L+T DQ+NQ+  +   +GL S  S                     Y NL     PM  + + S     S N  S   S++                    YYHYP+F +                +N+QQNL                   +SN   N N   +++S          +     L   CS+P       LIKLSVDLI TYKNINE+YY+KKRR ++P DD+  KK++K+ +  +   +T  KSS++ +          +                 +   + P+P         P  N   S+ +   G YEY IKPGEIWKS+Y IE+LIGTGSFGQVV+A+D+ + E VAIKIIKNK+NFVEQA  EI+LL E+ K+Q  DE+AQEWG+NYIVKLK+ F H GHLCLVFELLTY LY+LLKNTNF+GVSLNLTRKF  QIC+AL FLSKPQ+QIIHCDLKPENILL+HPRRSAIKVVDFGSSC  + RIY YIQSRFYRSPEIILN++YS AID+WSLGCI+ ELHTGQPLFIGQFEHEQILRI+E++GMPP+ M+ +GKK+ +YF++   T+     +Y+PK++R++D KKI+F+G+SSR L DI+GVYTGGP GRR +E GHSS DYEKFLDL+QKM+V+DP+ RIKP+ ALKHPFFIR+     SDTN
Sbjct:    7 PVYGHLVTADQLNQIEKRKGVLGLHSTDSASKTIFSAINTGIEISSDNFIYANLANTNEPMDITNISSEVQMASPNHHSGSLSSIISTYASPKFEKKSEDDVGGSYYHYPDFSYCQGNLGIDKLYVNTFVSNAQQNLIRSHNISTSLTSSKTLTEKQSNFAGNLNFPKSDSSIDKTLTSLPMETGAIKLDPRCSNPHI-----LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHE--DNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFELLTYTLYELLKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPNTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST--PTSDTN 685          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000003953.1 (SMESG000003953.1)

HSP 1 Score: 477.633 bits (1228), Expect = 8.589e-157
Identity = 227/356 (63.76%), Postives = 283/356 (79.49%), Query Frame = 1
Query:  877 EYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAXXXXXXXXXFVEQAQTEIALLMEMAKYQITDEMAQ--EWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYF-EQVI-----GTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 1920
            EY +KPGE+W +RY ++ LIGTGSFGQVV+A D++T E VAIKII+N+++FV+QA+TEI LL  +AKYQ   ++     WG+N IV+LK+ F + GHLCLVFELLTY+LY+LLKNT+F GVSLNLT+KFG Q+C AL FLS+P LQIIHCDLKPEN+LL+HP+RSAIKVVDFGSSCR++ER+Y YIQSRFYR+PE++L + Y+ AID+WSLGCILVELHTGQPLF+GQ+EHEQILRI+E+ GMPP HM+   K+  KYF E  I     G    IS++PK++R+RD K+I F GV +R L  I+G  TGGP GRR  E GHS  DY  FLDL+ +ML +DP  RI PE ALKHPFF
Sbjct:  448 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 803          
The following BLAST results are available for this feature:
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYRK1A1.355e-12949.07dual specificity tyrosine phosphorylation regulate... [more]
DYRK1A2.222e-12949.07dual specificity tyrosine phosphorylation regulate... [more]
DYRK1A2.222e-12949.07dual specificity tyrosine phosphorylation regulate... [more]
DYRK1A2.222e-12949.07dual specificity tyrosine phosphorylation regulate... [more]
DYRK1A2.222e-12949.07dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbk-11.720e-12346.60Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-27.375e-6942.35Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-27.375e-6942.35Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-27.375e-6942.35Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-27.375e-6942.35Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mnb2.761e-12850.55gene:FBgn0259168 transcript:FBtr0300509[more]
mnb3.737e-12850.55gene:FBgn0259168 transcript:FBtr0299619[more]
mnb3.774e-12650.55gene:FBgn0259168 transcript:FBtr0342786[more]
mnb2.398e-12550.55gene:FBgn0259168 transcript:FBtr0300508[more]
mnb1.670e-12350.55gene:FBgn0259168 transcript:FBtr0300510[more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk1ab3.811e-12845.66dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1b1.429e-12750.32dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1ab1.480e-12747.49dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1b3.505e-12750.76dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1aa5.292e-11849.67dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdf73.652e-12950.99growth differentiation factor 7 [Source:Xenbase;Ac... [more]
gdf75.586e-12950.99growth differentiation factor 7 [Source:Xenbase;Ac... [more]
gdf76.312e-12950.99growth differentiation factor 7 [Source:Xenbase;Ac... [more]
gdf73.055e-12850.99growth differentiation factor 7 [Source:Xenbase;Ac... [more]
osbpl84.317e-12046.62oxysterol binding protein like 8 [Source:Xenbase;A... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyrk1a2.359e-13049.28dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1a6.947e-12849.89dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1a6.947e-12849.89dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b1.241e-12747.52dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b1.497e-12747.52dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63470|DYR1A_RAT2.799e-12749.89Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q61214|DYR1A_MOUSE2.952e-12749.89Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q9Y463|DYR1B_HUMAN7.640e-12747.52Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q9Z188|DYR1B_MOUSE8.683e-12747.52Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q13627|DYR1A_HUMAN1.172e-12649.68Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R6397.611e-13453.55Dual specificity tyrosine-phosphorylation-regulate... [more]
A0A3R7CCH79.239e-13457.62Dual specificity tyrosine-phosphorylation-regulate... [more]
A0A2T7P0M02.678e-13352.09Protein kinase domain-containing protein OS=Pomace... [more]
A0A5J4NG046.453e-13354.22Dual specificity tyrosine-phosphorylation-regulate... [more]
A0A564YX266.815e-13357.78Protein kinase domain-containing protein OS=Hymeno... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk1ab3.896e-12050.33dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1aa4.593e-11749.45dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk23.499e-7139.37dual specificity tyrosine phosphorylation regulate... [more]
dyrk36.508e-7037.84dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk38.777e-7037.84dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk1aa7.100e-13049.79dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk23.696e-7342.69dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk21.303e-6138.61dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
hipk21.051e-5636.52homeodomain interacting protein kinase 2 [Source:Z... [more]
ENSPMAT00000007958.13.743e-4533.43pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YAK11.740e-6737.18Serine-threonine protein kinase; component of a gl... [more]
KSS12.626e-2629.65Mitogen-activated protein kinase (MAPK); involved ... [more]
PHO851.060e-2528.83Cyclin-dependent kinase; has ten cyclin partners; ... [more]
MCK12.192e-2428.74Dual-specificity ser/thr and tyrosine protein kina... [more]
KNS17.241e-2430.47Protein kinase involved in negative regulation of ... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451876.619e-13049.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461441.136e-6840.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362943.450e-6246.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492381.805e-5636.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337586.709e-4430.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk1ab4.214e-12750.32dual specificity tyrosine phosphorylation regulate... [more]
dyrk1ab4.546e-12750.32dual specificity tyrosine phosphorylation regulate... [more]
dyrk1ab8.546e-12750.32dual specificity tyrosine phosphorylation regulate... [more]
dyrk1ab8.546e-12750.32dual specificity tyrosine phosphorylation regulate... [more]
dyrk1b1.365e-10252.86dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041146.10.000e+0100.00SMESG000041146.1[more]
SMESG000041146.10.000e+0100.00SMESG000041146.1[more]
SMESG000080906.10.000e+050.15SMESG000080906.1[more]
SMESG000080906.10.000e+050.15SMESG000080906.1[more]
SMESG000003953.18.589e-15763.76SMESG000003953.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006567 ID=SMED30006567|Name=Dual specificity tyrosine-phosphorylation-regulated kinase 1A|organism=Schmidtea mediterranea sexual|type=transcript|length=2386bp
TTTATAATTAAGGAATATAAATTTAGTAATTCTTTCGATAATAAATCATG
AATTAATAATTCGAATATTATAAATGACATTTTCACAATGAATTATAAAT
GCAACATTGACAAAATGGGTTTTGAATCTATCAGTCACAAGGAAGAAAAT
ACGACTAAATTAAATCAATTAAAGGCACATCAGCTTCAAAAACAAAATGT
CTTTCCTCATCGAACCGAGGCAAAGAAAAGTGGTCCAGTCTATGGCCAGC
TTCTGACGGAAGACCAAGTAAATCAACTTAATAATCAGAATATAGGTTTA
GATTCCAAAACTTCAGGATATGTCAATTTGCCAATGTCACAAGTTGGTTC
TGTCAAAACGTCATGCAGTTCAAATGAAACCTCAAAACGTCAATCCGCAG
TGCCTTATTATCATTATCCTGAATTCCCTTTCACAAACAGTCAACAGAAT
CTCAAATCAAATCCTCAGTGCAACAAAAACAAAGTCTATGCGAACACGTC
GCAATTCAATATTTCACCTTTATCAAACAACTGTTCATCACCGCCAACTA
ACAGAAATAAACCATTAATAAAATTATCAGTAGACCTCATTACGACATAT
AAAAATATTAATGAATTATACTATCAAAAAAAGAGAAGAAATCGGGATCC
TTTAGATGATAGTCTGAATAAAAAGAATAAAAAACAAATAAATACTGAAC
AAACTTTAAGTGATACATCAGAAAAAAGTAGTTCTAAAAATATTCATCAT
AATTATCAGAATGCTGGTCACCATCATCATCACCACCATCATCATTACCA
TCAAAACAAACCACCACTACCACCGCCACAAGGAAATGCACCTGTTTCCA
TGAAAAATATGATTGAAGGTTCTTATGAATATTTCATAAAGCCAGGAGAA
ATATGGAAGTCAAGATATTATATCGAGCAATTGATAGGAACTGGATCTTT
TGGTCAGGTTGTTAAAGCACGTGATATGGTTACACAGGAAAATGTAGCCA
TCAAAATAATAAAAAACAAAAAGAATTTTGTCGAACAAGCACAAACAGAA
ATCGCATTGCTGATGGAAATGGCCAAATATCAAATAACGGATGAAATGGC
TCAAGAATGGGGTTCAAATTATATAGTGAAATTGAAAACAACATTTACTC
ATCATGGGCATCTCTGTCTTGTTTTTGAATTGTTGACTTACAATCTATAT
GATTTATTAAAAAATACCAATTTCAAAGGAGTCTCATTAAATCTTACAAG
AAAATTTGGAAGTCAAATTTGTGAGGCCTTGGCATTTTTATCAAAGCCAC
AATTACAAATTATTCATTGTGATCTCAAACCCGAAAATATTTTACTCATT
CACCCCAGACGATCTGCCATTAAGGTAGTCGATTTTGGTAGTTCTTGTCG
AGTCAGTGAAAGAATATATTGTTATATTCAGTCTAGATTTTACAGATCTC
CTGAAATAATTTTAAATGTGGAATACTCGCAAGCAATTGATATATGGTCC
TTAGGTTGTATTCTGGTCGAGTTGCACACGGGTCAGCCTTTGTTCATTGG
TCAGTTTGAGCATGAACAAATTCTACGCATTGTCGAACTTATGGGTATGC
CTCCAAGCCATATGTTAATGGCAGGTAAGAAAACTTATAAATACTTTGAA
CAAGTAATTGGAACTGACGGCGCAATTTCCTATCAACCAAAAATATATCG
TGACAGAGATAATAAAAAAATTTCGTTTAGAGGTGTGTCAAGTCGGAACC
TCTGTGATATTTTAGGAGTATATACTGGTGGTCCGTTTGGTAGGCGGGCC
AGTGAACTTGGACACTCCTCAACAGACTATGAAAAATTCCTAGATTTAGT
TCAGAAAATGCTTGTCCTTGATCCTGAATATAGAATAAAACCGGAAGCCG
CCTTAAAACATCCATTTTTTATTCGCAATCTTCAACCAAGCAATTCAGAT
ACTAACAGTCAAGTAAATATAAATCAGACAGCTGCAAATTTAGCATCAGT
TTCAACAGATTTATCTACACCTCAAACGATTCACACCATTGAAACCGATT
GTTTCAATGCTAGCTGTTCTACAGAGCCAACACATACCTATTTAACCTAC
GTTGGTTCCAACCATGACTGTGTAATGAACAATGCTGATTGTAGTAAACA
ATTCGAAGTTTCACTCACAAATGCATCTAAATCAGAAAGTTAATATATCT
TACTCCCTATTATTGACTGATAAACTTTTATTCGGCTGCACTGCTGAAAA
AGCAACATCTAAATCTATTTATGTATAAAATAAAAGAACTGATTCTTTTC
CTGAAAAACATTATCGGTAACATCTTACACGTACCGACACACACACACAC
ACACACAAGAAATATTATTATTATTATAATTATTAT
back to top

protein sequence of SMED30006567-orf-1

>SMED30006567-orf-1 ID=SMED30006567-orf-1|Name=SMED30006567-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=702bp
MNYKCNIDKMGFESISHKEENTTKLNQLKAHQLQKQNVFPHRTEAKKSGP
VYGQLLTEDQVNQLNNQNIGLDSKTSGYVNLPMSQVGSVKTSCSSNETSK
RQSAVPYYHYPEFPFTNSQQNLKSNPQCNKNKVYANTSQFNISPLSNNCS
SPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQ
INTEQTLSDTSEKSSSKNIHHNYQNAGHHHHHHHHHYHQNKPPLPPPQGN
APVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQ
ENVAIKIIKNKKNFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLK
TTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAF
LSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSR
FYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVE
LMGMPPSHMLMAGKKTYKYFEQVIGTDGAISYQPKIYRDRDNKKISFRGV
SSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRI
KPEAALKHPFFIRNLQPSNSDTNSQVNINQTAANLASVSTDLSTPQTIHT
IETDCFNASCSTEPTHTYLTYVGSNHDCVMNNADCSKQFEVSLTNASKSE
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR028318DYRK1A/B_MNB
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0000381regulation of alternative mRNA splicing, via spliceosome
GO:0007623circadian rhythm
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0018107peptidyl-threonine phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
GO:0043518negative regulation of DNA damage response, signal transduction by p53 class mediator
GO:0046777protein autophosphorylation
GO:0048025negative regulation of mRNA splicing, via spliceosome
GO:0090312positive regulation of protein deacetylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004712protein serine/threonine/tyrosine kinase activity
GO:0004713protein tyrosine kinase activity
GO:0004715non-membrane spanning protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0042802identical protein binding
GO:0043621protein self-association
GO:0048156tau protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0016607nuclear speck
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 277..611
e-value: 1.6E-70
score: 250.2
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 279..611
e-value: 5.6E-49
score: 166.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 277..611
score: 38.464
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 263..365
e-value: 1.1E-121
score: 408.0
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 333..611
e-value: 1.1E-121
score: 408.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 199..217
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 185..217
NoneNo IPR availablePANTHERPTHR24058DUAL SPECIFICITY PROTEIN KINASEcoord: 119..651
IPR028318Dual specificity tyrosine-phosphorylation-regulated kinase 1A/BPANTHERPTHR24058:SF12DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-REGULATED KINASE 1Bcoord: 119..651
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 283..306
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 408..420
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 266..618