Serine palmitoyltransferase 1

Overview
NameSerine palmitoyltransferase 1
Smed IDSMED30006553
Length (bp)631
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine palmitoyltransferase 1 (SMED30006553) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine palmitoyltransferase 1 (SMED30006553) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine palmitoyltransferase 1 (SMED30006553) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine palmitoyltransferase 1 (SMED30006553) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006553

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30006553h1SMcG0007431 dd_Smed_v4_11448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Human
Match: SPTLC1 (serine palmitoyltransferase long chain base subunit 1 [Source:HGNC Symbol;Acc:HGNC:11277])

HSP 1 Score: 73.559 bits (179), Expect = 1.050e-14
Identity = 43/161 (26.71%), Postives = 84/161 (52.17%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  +++F+K E+ +I+S  ++ + S +   S     VF+D      ++  L     +I +F HND   L+R+L   +  D +      + R  I VE + ++ GT   +   V+L++K+K  + + E LS G LG  GRG+ E   + +  +DL+
Sbjct:  143 DVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI 303          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Human
Match: SPTLC3 (serine palmitoyltransferase long chain base subunit 3 [Source:HGNC Symbol;Acc:HGNC:16253])

HSP 1 Score: 56.225 bits (134), Expect = 7.755e-9
Identity = 50/202 (24.75%), Postives = 92/202 (45.54%), Query Frame = 1
Query:   34 ITNSGQSN--GELGDYDQNYKLCFTSEISNFFCTNEADSNSVIGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNL--------LIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLG----YFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIE 591
            + N G  N  G    YD++ +     ++   + T  A +   +G L  + E+E  +++FL +E  ++F   ++    N+        LI+S+      L  G  +   T        I +F HN+ +SL+++L     Y   R      + +I VE +   +G+  ++   + L+ K+K  L I+E  SIG +G  GRG+ E
Sbjct:  162 VINMGSYNFLGLAAKYDESMRTI--KDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVFGMGFATNSMNIPALVGKGCLILSDELNHTSLVLGARLSGAT--------IRIFKHNNTQSLEKLLRDAVIYGQPRTRRAWKKILILVEGVYSMEGSIVHLPQIIALKKKYKAYLYIDEAHSIGAVGPTGRGVTE 353          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Human
Match: SPTLC2 (serine palmitoyltransferase long chain base subunit 2 [Source:HGNC Symbol;Acc:HGNC:11278])

HSP 1 Score: 53.5286 bits (127), Expect = 5.817e-8
Identity = 43/154 (27.92%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  154 IGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDA--GCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLG----YFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIE 591
            IGNL  + E+E  +++FL +E  + +   ++    N+  +      +  D     S+VL   L      I +F HN+ +SL+++L     Y   R      + +I VE I   +G+   +   + L+ K+K  L ++E  SIG LG  GRG++E
Sbjct:  147 IGNLDKHEELEELVARFLGVEAAMAYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARLSG--ATIRIFKHNNMQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPTGRGVVE 298          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Human
Match: SPTLC2 (serine palmitoyltransferase long chain base subunit 2 [Source:HGNC Symbol;Acc:HGNC:11278])

HSP 1 Score: 53.5286 bits (127), Expect = 7.180e-8
Identity = 43/154 (27.92%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  154 IGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDA--GCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLG----YFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIE 591
            IGNL  + E+E  +++FL +E  + +   ++    N+  +      +  D     S+VL   L      I +F HN+ +SL+++L     Y   R      + +I VE I   +G+   +   + L+ K+K  L ++E  SIG LG  GRG++E
Sbjct:  210 IGNLDKHEELEELVARFLGVEAAMAYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARL--SGATIRIFKHNNMQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPTGRGVVE 361          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Celegans
Match: sptl-1 (Serine palmitoyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:P91079])

HSP 1 Score: 73.1738 bits (178), Expect = 5.275e-15
Identity = 39/161 (24.22%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  +++F+  E+ +++S  ++ + S +   +     +F+D G +  ++  L      +  F HND E L+R+L   ++RD +       +R  I VE + ++      +   +E +++ K+ + I+E  S G +G  GRG+ E  ++PM  VD+V
Sbjct:  131 DVHLDLEKELAKFMGCEEAVLYSYGFATVSSAIPAYAKKGDVIFVDEGVNFAIQKGLQASRSRVEYFKHNDMEHLERLLLEQEQRDKKDPKKAKSVRRFIVVEGLYVNYADLCPLPKIIEFKWRFKVRVFIDESWSFGVIGKTGRGVTEHFNVPMEDVDMV 291          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Celegans
Match: sptl-1 (Serine palmitoyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:P91079])

HSP 1 Score: 73.1738 bits (178), Expect = 5.275e-15
Identity = 39/161 (24.22%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  +++F+  E+ +++S  ++ + S +   +     +F+D G +  ++  L      +  F HND E L+R+L   ++RD +       +R  I VE + ++      +   +E +++ K+ + I+E  S G +G  GRG+ E  ++PM  VD+V
Sbjct:  131 DVHLDLEKELAKFMGCEEAVLYSYGFATVSSAIPAYAKKGDVIFVDEGVNFAIQKGLQASRSRVEYFKHNDMEHLERLLLEQEQRDKKDPKKAKSVRRFIVVEGLYVNYADLCPLPKIIEFKWRFKVRVFIDESWSFGVIGKTGRGVTEHFNVPMEDVDMV 291          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Celegans
Match: sptl-1 (Serine palmitoyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:P91079])

HSP 1 Score: 72.7886 bits (177), Expect = 5.529e-15
Identity = 39/161 (24.22%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  +++F+  E+ +++S  ++ + S +   +     +F+D G +  ++  L      +  F HND E L+R+L   ++RD +       +R  I VE + ++      +   +E +++ K+ + I+E  S G +G  GRG+ E  ++PM  VD+V
Sbjct:  107 DVHLDLEKELAKFMGCEEAVLYSYGFATVSSAIPAYAKKGDVIFVDEGVNFAIQKGLQASRSRVEYFKHNDMEHLERLLLEQEQRDKKDPKKAKSVRRFIVVEGLYVNYADLCPLPKIIEFKWRFKVRVFIDESWSFGVIGKTGRGVTEHFNVPMEDVDMV 267          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Celegans
Match: sptl-1 (Serine palmitoyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:P91079])

HSP 1 Score: 72.7886 bits (177), Expect = 5.529e-15
Identity = 39/161 (24.22%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  +++F+  E+ +++S  ++ + S +   +     +F+D G +  ++  L      +  F HND E L+R+L   ++RD +       +R  I VE + ++      +   +E +++ K+ + I+E  S G +G  GRG+ E  ++PM  VD+V
Sbjct:  107 DVHLDLEKELAKFMGCEEAVLYSYGFATVSSAIPAYAKKGDVIFVDEGVNFAIQKGLQASRSRVEYFKHNDMEHLERLLLEQEQRDKKDPKKAKSVRRFIVVEGLYVNYADLCPLPKIIEFKWRFKVRVFIDESWSFGVIGKTGRGVTEHFNVPMEDVDMV 267          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Celegans
Match: sptl-1 (Serine palmitoyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:P91079])

HSP 1 Score: 72.7886 bits (177), Expect = 5.529e-15
Identity = 39/161 (24.22%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  +++F+  E+ +++S  ++ + S +   +     +F+D G +  ++  L      +  F HND E L+R+L   ++RD +       +R  I VE + ++      +   +E +++ K+ + I+E  S G +G  GRG+ E  ++PM  VD+V
Sbjct:  107 DVHLDLEKELAKFMGCEEAVLYSYGFATVSSAIPAYAKKGDVIFVDEGVNFAIQKGLQASRSRVEYFKHNDMEHLERLLLEQEQRDKKDPKKAKSVRRFIVVEGLYVNYADLCPLPKIIEFKWRFKVRVFIDESWSFGVIGKTGRGVTEHFNVPMEDVDMV 267          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Fly
Match: Spt-I (gene:FBgn0086532 transcript:FBtr0087731)

HSP 1 Score: 73.1738 bits (178), Expect = 5.713e-15
Identity = 45/161 (27.95%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  I++F+ LE+ +++S  +S + S +   +     +F+D   +  ++  L      I+ F HND E L+R+L   ++RD +        R  +  E I ++ G    +   V LR K+KL L I+E +S G LG  G G+ E  ++    VDL+
Sbjct:  139 DVHLDLEDRIAKFMGLEEAIVYSYGFSTVASAIPAYAKRGDLIFVDEAVNFAIQKGLDASRSTIVFFKHNDVEDLERLLIEQEKRDQKNPKKAAKTRRFLVAEGIYMNTGEICPLPDLVALRQKYKLRLFIDESISFGTLGQGGHGVTEHFNVDRDEVDLI 299          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Fly
Match: Spt-I (gene:FBgn0086532 transcript:FBtr0087729)

HSP 1 Score: 73.1738 bits (178), Expect = 5.713e-15
Identity = 45/161 (27.95%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  I++F+ LE+ +++S  +S + S +   +     +F+D   +  ++  L      I+ F HND E L+R+L   ++RD +        R  +  E I ++ G    +   V LR K+KL L I+E +S G LG  G G+ E  ++    VDL+
Sbjct:  139 DVHLDLEDRIAKFMGLEEAIVYSYGFSTVASAIPAYAKRGDLIFVDEAVNFAIQKGLDASRSTIVFFKHNDVEDLERLLIEQEKRDQKNPKKAAKTRRFLVAEGIYMNTGEICPLPDLVALRQKYKLRLFIDESISFGTLGQGGHGVTEHFNVDRDEVDLI 299          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Fly
Match: Spt-I (gene:FBgn0086532 transcript:FBtr0087730)

HSP 1 Score: 73.1738 bits (178), Expect = 5.713e-15
Identity = 45/161 (27.95%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  I++F+ LE+ +++S  +S + S +   +     +F+D   +  ++  L      I+ F HND E L+R+L   ++RD +        R  +  E I ++ G    +   V LR K+KL L I+E +S G LG  G G+ E  ++    VDL+
Sbjct:  139 DVHLDLEDRIAKFMGLEEAIVYSYGFSTVASAIPAYAKRGDLIFVDEAVNFAIQKGLDASRSTIVFFKHNDVEDLERLLIEQEKRDQKNPKKAAKTRRFLVAEGIYMNTGEICPLPDLVALRQKYKLRLFIDESISFGTLGQGGHGVTEHFNVDRDEVDLI 299          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Zebrafish
Match: sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:ZFIN;Acc:ZDB-GENE-050522-61])

HSP 1 Score: 70.0922 bits (170), Expect = 1.076e-13
Identity = 41/161 (25.47%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  +++F++ E+ +I+S  ++ + S +   S     +F+D      ++  L      I  F HND E L+R+L   +  D +      ++R  I VE + I+      +   V+L++K+K+ + + E +S G LG  GRG+ E   + +  +DL+
Sbjct:  142 DVHLELEERLAKFMRTEEAIIYSYGFATIASAIPAYSKRGDIIFVDEAACFSIQKGLQASRSFIKYFKHNDMEDLERLLKEQEIEDQKNPRKARVIRRFILVEGLYINTADICPLPELVKLKYKYKVRIFLEESMSFGVLGEHGRGVTEHFGVNIDDIDLI 302          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Zebrafish
Match: sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:ZFIN;Acc:ZDB-GENE-050522-61])

HSP 1 Score: 70.0922 bits (170), Expect = 1.089e-13
Identity = 41/161 (25.47%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  +++F++ E+ +I+S  ++ + S +   S     +F+D      ++  L      I  F HND E L+R+L   +  D +      ++R  I VE + I+      +   V+L++K+K+ + + E +S G LG  GRG+ E   + +  +DL+
Sbjct:  154 DVHLELEERLAKFMRTEEAIIYSYGFATIASAIPAYSKRGDIIFVDEAACFSIQKGLQASRSFIKYFKHNDMEDLERLLKEQEIEDQKNPRKARVIRRFILVEGLYINTADICPLPELVKLKYKYKVRIFLEESMSFGVLGEHGRGVTEHFGVNIDDIDLI 314          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Zebrafish
Match: sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:ZFIN;Acc:ZDB-GENE-050522-61])

HSP 1 Score: 69.707 bits (169), Expect = 1.398e-13
Identity = 41/161 (25.47%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  +++F++ E+ +I+S  ++ + S +   S     +F+D      ++  L      I  F HND E L+R+L   +  D +      ++R  I VE + I+      +   V+L++K+K+ + + E +S G LG  GRG+ E   + +  +DL+
Sbjct:  168 DVHLELEERLAKFMRTEEAIIYSYGFATIASAIPAYSKRGDIIFVDEAACFSIQKGLQASRSFIKYFKHNDMEDLERLLKEQEIEDQKNPRKARVIRRFILVEGLYINTADICPLPELVKLKYKYKVRIFLEESMSFGVLGEHGRGVTEHFGVNIDDIDLI 328          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Zebrafish
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 58.5362 bits (140), Expect = 9.384e-10
Identity = 53/203 (26.11%), Postives = 96/203 (47.29%), Query Frame = 1
Query:   64 LGDYD-----QNYKLCFTS--EISNFFCTNEADSNSVIGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDA--GCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLG----YFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            LG Y+     +N   C T+  E++  F    A +   +GNL  + ++E  ++ FL++E  + F   ++    N+  ++     +  D     S+VL   L      I VF HN+ +SL+++L     +   R      + +I VE I   +G+   +   + L+ K+K  L ++E  SIG LG  GRG++E   +    VD++
Sbjct:  169 LGSYNYLGFAENTGSCATAAGEVTVKFGVGVASTRQEMGNLDRHEKLEKLVASFLRVESAMAFGMGFATNSMNIPALAGKGCLILSDELNHASLVLGARL--SGSTIRVFKHNNMQSLEKLLRDAIVHGQPRTHRPWKKILILVEGIYSMEGSIIRLPEVIALKKKYKAYLYLDEAHSIGALGPGGRGVVEYFGLDPRDVDIM 369          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Zebrafish
Match: sptlc2b (serine palmitoyltransferase, long chain base subunit 2b [Source:ZFIN;Acc:ZDB-GENE-080305-8])

HSP 1 Score: 57.7658 bits (138), Expect = 1.697e-9
Identity = 46/166 (27.71%), Postives = 83/166 (50.00%), Query Frame = 1
Query:  154 IGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDA--GCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLG----YFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            IGNL  + E+E  +++FL +E  ++F   ++    N+  ++     +  D     S+VL   L      I VF HN+ +SL++ML     +   R      + +I VE I   +G+   +   + L+ K+K  L ++E  SIG LG  GRG+++   +  + VD++
Sbjct:  209 IGNLDKHEELEKLVARFLGVESSMVFGMGFATNSMNIPALTGKGCLILSDELNHASLVLGARL--SGSTIRVFKHNNMQSLEKMLRDAIVHGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEIIALKKKYKAYLYLDEAHSIGALGTRGRGVVDYFGLDPSDVDIM 372          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Xenopus
Match: sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:NCBI gene;Acc:779626])

HSP 1 Score: 73.9442 bits (180), Expect = 6.527e-15
Identity = 43/161 (26.71%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  +++F+K E+ +I+S  ++ + S +   S     VF+D      ++  L     +I  F HND + L+R+L   +  D +      + R  I  E + ++ G    +   VEL++K+K+ + + E LS G LG  GRG+ E   + +  +DL+
Sbjct:  131 DVHLELEERLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDEAACFAIQKGLQASRSSIKYFKHNDMDDLERLLKEQELEDQKNPRKASVTRRFIVAEGLYMNTGDICPLPKLVELKYKYKVRIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLI 291          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Xenopus
Match: sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:NCBI gene;Acc:779626])

HSP 1 Score: 73.9442 bits (180), Expect = 6.565e-15
Identity = 43/161 (26.71%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  +++F+K E+ +I+S  ++ + S +   S     VF+D      ++  L     +I  F HND + L+R+L   +  D +      + R  I  E + ++ G    +   VEL++K+K+ + + E LS G LG  GRG+ E   + +  +DL+
Sbjct:  123 DVHLELEERLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDEAACFAIQKGLQASRSSIKYFKHNDMDDLERLLKEQELEDQKNPRKASVTRRFIVAEGLYMNTGDICPLPKLVELKYKYKVRIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLI 283          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Xenopus
Match: sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:NCBI gene;Acc:779626])

HSP 1 Score: 73.559 bits (179), Expect = 8.430e-15
Identity = 43/161 (26.71%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  +++F+K E+ +I+S  ++ + S +   S     VF+D      ++  L     +I  F HND + L+R+L   +  D +      + R  I  E + ++ G    +   VEL++K+K+ + + E LS G LG  GRG+ E   + +  +DL+
Sbjct:  131 DVHLELEERLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDEAACFAIQKGLQASRSSIKYFKHNDMDDLERLLKEQELEDQKNPRKASVTRRFIVAEGLYMNTGDICPLPKLVELKYKYKVRIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLI 291          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Xenopus
Match: sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:NCBI gene;Acc:779626])

HSP 1 Score: 73.559 bits (179), Expect = 9.062e-15
Identity = 43/161 (26.71%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  +++F+K E+ +I+S  ++ + S +   S     VF+D      ++  L     +I  F HND + L+R+L   +  D +      + R  I  E + ++ G    +   VEL++K+K+ + + E LS G LG  GRG+ E   + +  +DL+
Sbjct:  141 DVHLELEERLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDEAACFAIQKGLQASRSSIKYFKHNDMDDLERLLKEQELEDQKNPRKASVTRRFIVAEGLYMNTGDICPLPKLVELKYKYKVRIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLI 301          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Xenopus
Match: sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:NCBI gene;Acc:779626])

HSP 1 Score: 73.1738 bits (178), Expect = 1.296e-14
Identity = 43/161 (26.71%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  +++F+K E+ +I+S  ++ + S +   S     VF+D      ++  L     +I  F HND + L+R+L   +  D +      + R  I  E + ++ G    +   VEL++K+K+ + + E LS G LG  GRG+ E   + +  +DL+
Sbjct:  141 DVHLELEERLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDEAACFAIQKGLQASRSSIKYFKHNDMDDLERLLKEQELEDQKNPRKASVTRRFIVAEGLYMNTGDICPLPKLVELKYKYKVRIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLI 301          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Mouse
Match: Sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:MGI Symbol;Acc:MGI:1099431])

HSP 1 Score: 76.2554 bits (186), Expect = 8.981e-16
Identity = 43/161 (26.71%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  +++F+K E+ +I+S  +S + S +   S     +F+D+     ++  L     +I +F HND   L+R+L   +  D +      + R  I VE + ++ GT   +   V+L++K+K  + + E LS G LG  GRG+ E   + +  +DL+
Sbjct:  143 DVHLDLEERLAKFMKTEEAIIYSYGFSTIASAIPAYSKRGDIIFVDSAACFAIQKGLQASRSDIKLFKHNDVADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGISIDDIDLI 303          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Mouse
Match: Sptlc2 (serine palmitoyltransferase, long chain base subunit 2 [Source:MGI Symbol;Acc:MGI:108074])

HSP 1 Score: 52.7582 bits (125), Expect = 9.126e-8
Identity = 43/172 (25.00%), Postives = 80/172 (46.51%), Query Frame = 1
Query:  100 TSEISNFFCTNEADSNSVIGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDA--GCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLG----YFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIE 591
             +E+   +      +   IGNL  + E+E  +++FL +E  + +   ++    N+  +      +  D     S+VL   L      I +F HN+ +SL+++L     Y   R      + +I VE I   +G+   +   + L+ K+K  L ++E  SIG LG  GRG+++
Sbjct:  190 AAEVLKEYGAGVCSTRQEIGNLDKHEELEKLVARFLGVEAAMTYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARL--SGATIRIFKHNNMQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVD 359          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Mouse
Match: Sptlc3 (serine palmitoyltransferase, long chain base subunit 3 [Source:MGI Symbol;Acc:MGI:2444678])

HSP 1 Score: 52.373 bits (124), Expect = 1.328e-7
Identity = 45/163 (27.61%), Postives = 77/163 (47.24%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGC----------SMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRP---------VIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIE 591
            +++ E+E  +++FL +E  + F   ++    N+         VF+  GC          S++L + L   V  I  F HN+ E+L+++L     R+     +P         +I VE +   +G+  N+   V L+ K+K  L I+E  SIGC G  GRG+ E
Sbjct:  206 DIHKELEDLMAEFLNVEAVMSFGMGFATNAMNI--------PVFVGKGCLILSDEFNHTSVILGSRLSGAV--IRPFKHNNAENLEKLL-----REAIIRGQPGTGRAWKKILIVVEGVYSMEGSIVNLAQIVALKKKYKAYLYIDEAHSIGCTGPTGRGVRE 353          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Mouse
Match: Sptlc3 (serine palmitoyltransferase, long chain base subunit 3 [Source:MGI Symbol;Acc:MGI:2444678])

HSP 1 Score: 52.373 bits (124), Expect = 1.328e-7
Identity = 45/163 (27.61%), Postives = 77/163 (47.24%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGC----------SMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRP---------VIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIE 591
            +++ E+E  +++FL +E  + F   ++    N+         VF+  GC          S++L + L   V  I  F HN+ E+L+++L     R+     +P         +I VE +   +G+  N+   V L+ K+K  L I+E  SIGC G  GRG+ E
Sbjct:  206 DIHKELEDLMAEFLNVEAVMSFGMGFATNAMNI--------PVFVGKGCLILSDEFNHTSVILGSRLSGAV--IRPFKHNNAENLEKLL-----REAIIRGQPGTGRAWKKILIVVEGVYSMEGSIVNLAQIVALKKKYKAYLYIDEAHSIGCTGPTGRGVRE 353          
BLAST of Serine palmitoyltransferase 1 vs. UniProt/SwissProt
Match: sp|O35704|SPTC1_MOUSE (Serine palmitoyltransferase 1 OS=Mus musculus OX=10090 GN=Sptlc1 PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 6.282e-15
Identity = 43/161 (26.71%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  +++F+K E+ +I+S  +S + S +   S     +F+D+     ++  L     +I +F HND   L+R+L   +  D +      + R  I VE + ++ GT   +   V+L++K+K  + + E LS G LG  GRG+ E   + +  +DL+
Sbjct:  143 DVHLDLEERLAKFMKTEEAIIYSYGFSTIASAIPAYSKRGDIIFVDSAACFAIQKGLQASRSDIKLFKHNDVADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGISIDDIDLI 303          
BLAST of Serine palmitoyltransferase 1 vs. UniProt/SwissProt
Match: sp|O54695|SPTC1_CRIGR (Serine palmitoyltransferase 1 OS=Cricetulus griseus OX=10029 GN=SPTLC1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.122e-15
Identity = 43/161 (26.71%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  +++F++ E+ +I+S  +S + S +   S     VF+D+     ++  L     +I +F HND   L+R+L   +  D +      + R  I VE + ++ GT   +   V+L++K+K  + + E LS G LG  GRG+ E   + +  +DL+
Sbjct:  143 DVHLDLEERLAKFMRTEEAIIYSYGFSTIASAIPAYSKRGDIVFVDSAACFAIQKGLQASRSDIKLFKHNDVADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTVCPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGISIDDIDLI 303          
BLAST of Serine palmitoyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q3MHG1|SPTC1_BOVIN (Serine palmitoyltransferase 1 OS=Bos taurus OX=9913 GN=SPTLC1 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.942e-15
Identity = 44/161 (27.33%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  +++F+K E+ +I+S  ++ + S +   S     VF+D      ++  L     +I VF HND + L+R+L   +  D +      + R  I VE + ++ GT   +   V+L++K+K  + + E LS G LG  GRG+ E   + +  +DL+
Sbjct:  143 DVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKVFNHNDMDDLERLLKEQEIEDQKNPRKARVTRRFIIVEGLYMNTGTVCPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGISIDDIDLI 303          
BLAST of Serine palmitoyltransferase 1 vs. UniProt/SwissProt
Match: sp|D4A2H2|SPTC1_RAT (Serine palmitoyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Sptlc1 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.868e-14
Identity = 43/161 (26.71%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  +++F+K E+ +I+S  +S + S +   S     VF+D+     ++  L     +I +F HND   L+R+L   +  D +      + R  I  E + ++ GT   +   V L++K+K  + + E LS G LG  GRG+ E   + +  +DL+
Sbjct:  143 DVHLDLEERLAKFMKTEEAIIYSYGFSTIASAIPAYSKRGDIVFVDSAACFAIQKGLQASRSDIKLFKHNDVADLERLLKEQEIEDQKNPRKARVTRRFIVAEGLYMNTGTICPLPELVRLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGISIDDIDLI 303          
BLAST of Serine palmitoyltransferase 1 vs. UniProt/SwissProt
Match: sp|O15269|SPTC1_HUMAN (Serine palmitoyltransferase 1 OS=Homo sapiens OX=9606 GN=SPTLC1 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 5.041e-14
Identity = 43/161 (26.71%), Postives = 84/161 (52.17%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ ++E  +++F+K E+ +I+S  ++ + S +   S     VF+D      ++  L     +I +F HND   L+R+L   +  D +      + R  I VE + ++ GT   +   V+L++K+K  + + E LS G LG  GRG+ E   + +  +DL+
Sbjct:  143 DVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI 303          
BLAST of Serine palmitoyltransferase 1 vs. TrEMBL
Match: A0A2B4SJD6 (Serine palmitoyltransferase 1 OS=Stylophora pistillata OX=50429 GN=Sptlc1 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 3.051e-17
Identity = 46/161 (28.57%), Postives = 90/161 (55.90%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  +++F++ E+ ++++  +S + S +   S     +F D G S  ++  L+     I+ F HND E L+R+L     +D +      + R  + +E IS++ G  + +   +EL++K+K+ L+I+E  S G LG  GRGL E   +P+  VD++
Sbjct:  165 DVHLELEERLAKFMRTEEAILYAYGFSTIASVIPAYSKRGDVIFCDKGVSFAIQKGLVASRSRIMWFEHNDMEDLERLLHEQKEKDDKNPKKASVTRRFLVIEGISVNYGDIAPLPKIIELKYKYKVRLIIDESASFGVLGQTGRGLTEHFDVPIEEVDMI 325          
BLAST of Serine palmitoyltransferase 1 vs. TrEMBL
Match: A0A3M6UZP1 (Aminotran_1_2 domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00010797 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.223e-16
Identity = 46/161 (28.57%), Postives = 89/161 (55.28%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  +++F+  E+ ++++  +S + S +   S     +F D G S  ++  L+     I+ F HND E L+R+L     +D +      + R  + +E IS++ G  + +   +EL++K+K+ L+I+E  S G LG  GRGL E   +P+  VD++
Sbjct:   95 DVHLELEERLAKFMGTEEAILYAYGFSTIASVIPAYSKRGDVIFCDKGVSFAIQKGLVASRSRIMWFEHNDMEDLERLLHEQKEKDDKNPKKASVTRRFLVIEGISVNYGDIAPLPKIIELKYKYKVRLIIDESASFGVLGQAGRGLTEHFDVPIKDVDMI 255          
BLAST of Serine palmitoyltransferase 1 vs. TrEMBL
Match: A0A087TAV6 (Serine palmitoyltransferase 1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_25406 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.786e-15
Identity = 47/161 (29.19%), Postives = 88/161 (54.66%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRD-----CEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  ++QF+K+E+ +++S  +S + S +   +     VF+DAG +  ++  L+     I  F HND + L+R+L     RD        + R  + +E I I+ G    +   VEL+ K+++ + I+E  S G LG  GRG+ E  ++P+  +DL+
Sbjct:  150 DIHLELEAKLAQFMKVEEAVLYSYGFSTISSAIPAYAKHGDVVFVDAGVNFAIQKGLIGSRSEIHFFKHNDPDDLERLLKEQAERDKLNPSKAKVTRRFLVLEGIYINYGDICPLPRMVELKNKYRVRIFIDEACSFGVLGATGRGVTEHFNIPIDEIDLI 310          
BLAST of Serine palmitoyltransferase 1 vs. TrEMBL
Match: W5JS92 (Serine palmitoyltransferase i OS=Anopheles darlingi OX=43151 GN=AND_001221 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.808e-15
Identity = 51/164 (31.10%), Postives = 89/164 (54.27%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRPV--------IFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  +++F+ +E+ +++S A+S + S +   S     +F+D   +  ++  L      I  + HND E L+R+L    +++ E L RP         +  E+I ++ G    +   VELR ++KL L ++E LS G LG  GRGLIE  ++  T VDLV
Sbjct:  140 DVHLELEERLAKFMAVEEAVVYSYAFSTIASAIPAYSKRNDLIFVDECVNFAIQKGLDASRSKIFFYKHNDMEDLERLL---QKQEAEDLRRPAKAKKTRRFLVAEAIYMNTGEMCPLPRLVELRARYKLRLFLDESLSFGVLGASGRGLIEHFNVDKTEVDLV 300          
BLAST of Serine palmitoyltransferase 1 vs. TrEMBL
Match: A0A165ZK01 (PLP-dependent transferase OS=Exidia glandulosa HHB12029 OX=1314781 GN=EXIGLDRAFT_683954 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 5.299e-15
Identity = 48/160 (30.00%), Postives = 82/160 (51.25%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDR---RDCEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLVF 630
            +++ ++E  IS FL  E  +I+S A++   S +         +  DAG    ++  +      +  + HND + L+ +L   DR   +    L R  I  E+I   DGT +++   VEL+ K+K  L+++E  S G LG  GRGL E   +P+T VD+++
Sbjct:  179 DVHVDLERDISSFLGTESTIIYSQAFATGSSVIPAFCKKGDVIVADAGVGFGIRKGIQNSRSTVRYYRHNDMQHLEEVLHSMDRERRKKRAPLTRRFIITEAIFDHDGTIADLPRIVELKKKYKHRLILDETTSFGSLGKHGRGLTEHHGVPVTDVDILY 338          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Cavefish
Match: sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:ZFIN;Acc:ZDB-GENE-050522-61])

HSP 1 Score: 67.781 bits (164), Expect = 5.004e-13
Identity = 41/161 (25.47%), Postives = 82/161 (50.93%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  +++F++ E+ +I+S  ++ + S +   S     VF+D      ++  L      I  F HND E L+R+L   +  D +      + R  I VE + ++      +   V+L++K+K+ + + E +S G LG  GRG+ E   + +  +DL+
Sbjct:  154 DVHLELEERLAKFMRTEEAIIYSYGFATIASAIPAYSKRGDIVFVDEASCFSIQKGLQASRSFIKYFKHNDMEDLERLLKEQELEDQKNPRKARVTRRFIVVEGLYMNTADICPLPELVKLKYKYKVRIFLEESMSFGVLGEHGRGVTEHFGVNIDDIDLI 314          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Cavefish
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 53.1434 bits (126), Expect = 4.684e-8
Identity = 49/188 (26.06%), Postives = 90/188 (47.87%), Query Frame = 1
Query:  103 SEISNFFCTNEADSNSVIGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDA--GCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRP---------VIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +E++  +    + +   +GNL  + E+E  +++FL +E  + F   ++    N+  ++     +  D     S+VL   L      I VF HN+ +SL+++L     RD     +P         +I VE I   +G+   +   + L+ K+K  L ++E  SIG LG  GRG++E   +  T VD++
Sbjct:  264 AEVTVKYGVGVSSTRQEMGNLDRHEEMEKLVARFLGVESAMAFGMGFATNSMNIPALTGKGCLILSDELNHASLVLGARLSG--STIRVFKHNNMQSLEKLL-----RDAIVHGQPRTHRPWKKILILVEGIYSMEGSIIRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVEYFGLDPTDVDIM 444          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Cavefish
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 53.1434 bits (126), Expect = 4.722e-8
Identity = 49/188 (26.06%), Postives = 90/188 (47.87%), Query Frame = 1
Query:  103 SEISNFFCTNEADSNSVIGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDA--GCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRP---------VIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +E++  +    + +   +GNL  + E+E  +++FL +E  + F   ++    N+  ++     +  D     S+VL   L      I VF HN+ +SL+++L     RD     +P         +I VE I   +G+   +   + L+ K+K  L ++E  SIG LG  GRG++E   +  T VD++
Sbjct:  285 AEVTVKYGVGVSSTRQEMGNLDRHEEMEKLVARFLGVESAMAFGMGFATNSMNIPALTGKGCLILSDELNHASLVLGARLSG--STIRVFKHNNMQSLEKLL-----RDAIVHGQPRTHRPWKKILILVEGIYSMEGSIIRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVEYFGLDPTDVDIM 465          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Cavefish
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 53.1434 bits (126), Expect = 4.722e-8
Identity = 49/188 (26.06%), Postives = 90/188 (47.87%), Query Frame = 1
Query:  103 SEISNFFCTNEADSNSVIGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDA--GCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRP---------VIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +E++  +    + +   +GNL  + E+E  +++FL +E  + F   ++    N+  ++     +  D     S+VL   L      I VF HN+ +SL+++L     RD     +P         +I VE I   +G+   +   + L+ K+K  L ++E  SIG LG  GRG++E   +  T VD++
Sbjct:  285 AEVTVKYGVGVSSTRQEMGNLDRHEEMEKLVARFLGVESAMAFGMGFATNSMNIPALTGKGCLILSDELNHASLVLGARLSG--STIRVFKHNNMQSLEKLL-----RDAIVHGQPRTHRPWKKILILVEGIYSMEGSIIRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVEYFGLDPTDVDIM 465          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Sea Lamprey
Match: sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:ZFIN;Acc:ZDB-GENE-050522-61])

HSP 1 Score: 54.299 bits (129), Expect = 3.682e-9
Identity = 38/161 (23.60%), Postives = 81/161 (50.31%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  I++F++ E+ +I++  +S + S +   S     +++       ++  L     N+  F HND   L+R+L    + D +      ++R  + VE +  + G    +   V L++++K+ + + E LS G LG  GRG+ E   + +  +DL+
Sbjct:  144 DVHLELEEQIARFMRCEEAIIYAYGFSTIASAIPAYSKRGDIIYVSKAVCFAIQKGLQASRSNVKYFRHNDVADLERLLQQQQQEDRKNPKKASVVRRFLVVEGLYTNTGDVCPLPDLVRLKYQYKVRIFLEESLSFGVLGETGRGVTEHFGVNIDDIDLI 304          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Sea Lamprey
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 50.447 bits (119), Expect = 7.092e-8
Identity = 47/189 (24.87%), Postives = 86/189 (45.50%), Query Frame = 1
Query:  100 TSEISNFFCTNEADSNSVIGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDA--GCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDC-----EYLLRP----VIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
             ++++  +      +   +GNL  + E+E  +++FL +E  + F   ++    N+  +      +  D     S+VL   L      I VF HND  +L+++L     RD          RP    +I VE I   +G+   +   V L+ ++K  L ++E  SIG +G  GRG++E   +    VD++
Sbjct:  139 AAQVAQKYGVGVCSTRQEMGNLDKHEELEKLVARFLGVEAAMAFGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARL--STATIRVFKHNDMVNLEKLL-----RDAIVNGQPRTHRPWKKILILVEGIYSMEGSIVRLPEVVALKKRYKAYLYLDEAHSIGAVGPTGRGVVEYFGLHPQDVDVL 320          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Yeast
Match: LCB1 (Component of serine palmitoyltransferase; responsible along with Lcb2p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine [Source:SGD;Acc:S000004911])

HSP 1 Score: 53.5286 bits (127), Expect = 5.291e-9
Identity = 37/152 (24.34%), Postives = 69/152 (45.39%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRD----CEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESM 603
            +++  +E  ++QF   +  +++   + A  S L   +     +  D   S+ ++ +L      +  F HND  SL+ +L     ++       + R  I  E I  + G  + +    +L+ K+K  L ++E  SIG LG  GRGL E  +M
Sbjct:  190 DVHYTLEYDLAQFFGTQGSVLYGQDFCAAPSVLPAFTKRGDVIVADDQVSLPVQNALQLSRSTVYYFNHNDMNSLECLLNELTEQEKLEKLPAIPRKFIVTEGIFHNSGDLAPLPELTKLKNKYKFRLFVDETFSIGVLGATGRGLSEHFNM 341          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Yeast
Match: LCB2 (Component of serine palmitoyltransferase; responsible along with Lcb1p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine [Source:SGD;Acc:S000002469])

HSP 1 Score: 47.3654 bits (111), Expect = 5.628e-7
Identity = 44/161 (27.33%), Postives = 74/161 (45.96%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMV--------LKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRP---------VIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIE 591
            +L+ + E  +++F+  ED L+FS  Y    +NL          FLD  C ++        ++T +      +  F H D   L++++     R+   L +P         +I  E +   +GT  N+   VEL+ K+K  L I+E  SIG +G  GRG+ E
Sbjct:  201 DLHIKAEKLVARFIGKEDALVFSMGYGT-NANLF-------NAFLDKKCLVISDELNHTSIRTGVRLSGAAVRTFKHGDMVGLEKLI-----REQIVLGQPKTNRPWKKILICAEGLFSMEGTLCNLPKLVELKKKYKCYLFIDEAHSIGAMGPTGRGVCE 348          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Nematostella
Match: EDO36082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJP9])

HSP 1 Score: 65.855 bits (159), Expect = 8.055e-13
Identity = 41/161 (25.47%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++  +E  +++F+  E+ +++S  +S + S +   S     +F D G    ++  +      ++ F HND + L+R+L     +D +      + R  + VE + I+ GT + +   +EL+ K+K+ ++++E  S G LG  GRG+ E   +P+  VDL+
Sbjct:  138 DVHLHLEERLAKFMHTEEAILYSYGFSTVASAIPAYSKRGDVLFCDKGVCFAIQQGVTASRSRVMWFEHNDMDDLERLLKEQQEKDRKNPKKGSVTRRFLIVEGLYINHGTIAPLPKLLELKKKYKVRILVDESCSFGVLGKTGRGVTEYYDIPVDDVDLI 298          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Nematostella
Match: EDO42990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZR1])

HSP 1 Score: 49.6766 bits (117), Expect = 2.432e-7
Identity = 39/150 (26.00%), Postives = 73/150 (48.67%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDA--GCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRP----VIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIE 591
            +++ E+E  +++F+  E  ++F   ++   +N+ ++ +    +  D     S+VL   L      I VF HND +SL+  L     +      RP    +I VE +   +G+   +   V ++ K+K  L ++E  SIG +G  GRG+ E
Sbjct:  196 DIHIELEKMVARFVGKESAMVFGMGFATNSTNIPVLVSKGDLIISDELNHSSLVLGARLSG--ATIKVFKHNDIKSLENKLRTSVVQGQPRTHRPWRKILIIVEGVYSMEGSLVRLPEIVAIKKKYKAYLYLDEAHSIGAVGPTGRGVSE 343          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Medaka
Match: sptlc1 (serine palmitoyltransferase long chain base subunit 1 [Source:NCBI gene;Acc:101173642])

HSP 1 Score: 67.3958 bits (163), Expect = 6.545e-13
Identity = 40/161 (24.84%), Postives = 81/161 (50.31%), Query Frame = 1
Query:  160 NLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCE-----YLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            +++ E+E  +++F++ E+ +I+S  ++ + S +   S     +F+D      ++  L      I  F HND E L+R+L   +  D +      + R  I VE + I+      +   V L++K+K+ + + E +S G LG  G+G+ E   + +  +DL+
Sbjct:  143 DVHLELESRLAKFMRTEEAIIYSYGFATIASAIPAYSKRGDIIFVDEAACFSIQKGLQASRSFIKYFKHNDMEDLERLLKEQELEDQKNPRKARVTRKFIVVEGLYINTADVCPLPELVRLKYKYKVRIFLEESMSFGVLGEHGKGVTEHFGVNIDDIDLI 303          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Medaka
Match: sptlc2b (serine palmitoyltransferase 2 [Source:NCBI gene;Acc:101165525])

HSP 1 Score: 55.8398 bits (133), Expect = 7.005e-9
Identity = 48/195 (24.62%), Postives = 93/195 (47.69%), Query Frame = 1
Query:   73 YDQNYKLCFTS--EISNFFCTNEADSNSVIGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDA--GCSMVLKTSLMRHVDNIIVFPHNDCESLDRML----GYFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            + +N   C ++  E ++ +    A +   IGNL  + E+E  +++FL +E  + F   ++    N+  ++     +  D     S+VL   L      I VF HN+ +SL+++L     +   R      + +I VE I   +G+   +   + L+ ++K  L ++E  SIG LG  GRG+++   +    VD++
Sbjct:  185 FAENTGACASAAIETTHAYGVGVASTRCEIGNLDIHEELEQLVARFLGVESSMAFGMGFATNSMNIPPLTGKGCLILSDELNHASLVLGARL--SGSTIRVFKHNNMQSLEKLLRDAIAHGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVIALKKRYKAYLYLDEAHSIGALGPNGRGVVDYFGLDPKDVDIM 377          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Medaka
Match: ENSORLT00000013273.2 (serine palmitoyltransferase 2-like [Source:NCBI gene;Acc:101156930])

HSP 1 Score: 52.373 bits (124), Expect = 1.032e-7
Identity = 44/178 (24.72%), Postives = 81/178 (45.51%), Query Frame = 1
Query:  100 TSEISNFFCTNEADSNSVIGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNL--------LIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLG----YFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIE 591
             +++   +    A +   IGNL  + E+E  +++FL +E  + F   ++    N+        LI+S+      L  G  +   T        I VF HN+ + L+++L     Y   R      + +I VE I   +G+   +   + L+ ++K  L ++E  SIG LG  GRG+++
Sbjct:  203 AAQVVRTYGIGVASTRQEIGNLDKHEEMEKQVAKFLGVESAMAFGMGFATNSMNIPALVGKGCLILSDELNHTSLVLGARLSGAT--------IRVFKHNNMQCLEKLLSEAIIYGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVITLKKRYKAYLYLDEAHSIGALGHRGRGVVD 372          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Medaka
Match: ENSORLT00000042858.1 (serine palmitoyltransferase 2-like [Source:NCBI gene;Acc:101156930])

HSP 1 Score: 51.9878 bits (123), Expect = 1.176e-7
Identity = 44/178 (24.72%), Postives = 81/178 (45.51%), Query Frame = 1
Query:  100 TSEISNFFCTNEADSNSVIGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNL--------LIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLG----YFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIE 591
             +++   +    A +   IGNL  + E+E  +++FL +E  + F   ++    N+        LI+S+      L  G  +   T        I VF HN+ + L+++L     Y   R      + +I VE I   +G+   +   + L+ ++K  L ++E  SIG LG  GRG+++
Sbjct:  203 AAQVVRTYGIGVASTRQEIGNLDKHEEMEKQVAKFLGVESAMAFGMGFATNSMNIPALVGKGCLILSDELNHTSLVLGARLSGAT--------IRVFKHNNMQCLEKLLSEAIIYGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVITLKKRYKAYLYLDEAHSIGALGHRGRGVVD 372          
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Medaka
Match: ENSORLT00000022091.2 (serine palmitoyltransferase 2-like [Source:NCBI gene;Acc:101156930])

HSP 1 Score: 51.9878 bits (123), Expect = 1.179e-7
Identity = 43/172 (25.00%), Postives = 80/172 (46.51%), Query Frame = 1
Query:  100 TSEISNFFCTNEADSNSVIGNL--YNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDA--GCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLG----YFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIE 591
             +++   +    A +   IGNL  + E+E  +++FL +E  + F   ++    N+  +      +  D     S+VL   L      I VF HN+ + L+++L     Y   R      + +I VE I   +G+   +   + L+ ++K  L ++E  SIG LG  GRG+++
Sbjct:  155 AAQVVRTYGIGVASTRQEIGNLDKHEEMEKQVAKFLGVESAMAFGMGFATNSMNIPALVGKGCLILSDELNHTSLVLGARL--SGATIRVFKHNNMQCLEKLLSEAIIYGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVITLKKRYKAYLYLDEAHSIGALGHRGRGVVD 324          
BLAST of Serine palmitoyltransferase 1 vs. Planmine SMEST
Match: SMESG000071514.1 (SMESG000071514.1)

HSP 1 Score: 393.275 bits (1009), Expect = 1.607e-138
Identity = 195/208 (93.75%), Postives = 199/208 (95.67%), Query Frame = 1
Query:    7 FKEFLTVALITNSGQSNGELGDYDQNYKLCFTSEISNFFCTNEADSNSVIGNLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLVF 630
            F++ +   +I  S  SNGELGDYDQNYKLCFTSEISNFFCTNEADSNSVIGNLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVEL FKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLVF
Sbjct:    8 FQKKIIFLVIDASLLSNGELGDYDQNYKLCFTSEISNFFCTNEADSNSVIGNLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELWFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLVF 215          
BLAST of Serine palmitoyltransferase 1 vs. Planmine SMEST
Match: SMESG000071514.1 (SMESG000071514.1)

HSP 1 Score: 221.476 bits (563), Expect = 2.679e-72
Identity = 106/107 (99.07%), Postives = 106/107 (99.07%), Query Frame = 1
Query:  310 MVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLVF 630
            MVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVEL FKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLVF
Sbjct:    1 MVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRPVIFVESISIDDGTKSNIVGFVELWFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLVF 107          
BLAST of Serine palmitoyltransferase 1 vs. Planmine SMEST
Match: SMESG000052311.1 (SMESG000052311.1)

HSP 1 Score: 67.781 bits (164), Expect = 3.389e-13
Identity = 40/160 (25.00%), Postives = 80/160 (50.00%), Query Frame = 1
Query:  172 EIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRPV--------IFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            ++E  I+ F+  E+ +++S  +S + S +   +     +F D G S  ++  L+     I  F HND   +D ++   + +  E +  P         I +E + ++ G    +   VEL++K+K+ + ++E LS G LG  GRG+ +   + +T +DL+
Sbjct:  153 KLEDEIANFMNCEESVVYSYGFSTVASAIPAYAKRGDVIFADEGVSFAIQCGLLASRSKIKYFKHND---MDHLVSLLEEQSEEAIKNPAKARITRTFIVIEGLYMNYGDICPLPKIVELKYKYKVRIFLDETLSFGVLGDHGRGVTDHFGVDVTDIDLI 309          
BLAST of Serine palmitoyltransferase 1 vs. Planmine SMEST
Match: SMESG000080769.1 (SMESG000080769.1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.334e-13
Identity = 40/160 (25.00%), Postives = 80/160 (50.00%), Query Frame = 1
Query:  172 EIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRPV--------IFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            ++E  I+ F+  E+ +++S  +S + S +   +     +F D G S  ++  L+     I  F HND   +D ++   + +  E +  P         I +E + ++ G    +   VEL++K+K+ + ++E LS G LG  GRG+ +   + +T +DL+
Sbjct:  153 KLEDEIANFMNCEESVVYSYGFSTVASAIPAYAKRGDVIFADEGVSFAIQCGLLASRSKIKYFKHND---MDHLVSLLEEQSEEAIKNPAKARITRTFIVIEGLYMNYGDICPLPKIVELKYKYKVRIFLDETLSFGVLGDHGRGVTDHFGVDVTDIDLI 309          
BLAST of Serine palmitoyltransferase 1 vs. Planmine SMEST
Match: SMESG000052311.1 (SMESG000052311.1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.334e-13
Identity = 40/160 (25.00%), Postives = 80/160 (50.00%), Query Frame = 1
Query:  172 EIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDAGCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRPV--------IFVESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEESMPMTHVDLV 627
            ++E  I+ F+  E+ +++S  +S + S +   +     +F D G S  ++  L+     I  F HND   +D ++   + +  E +  P         I +E + ++ G    +   VEL++K+K+ + ++E LS G LG  GRG+ +   + +T +DL+
Sbjct:  153 KLEDEIANFMNCEESVVYSYGFSTVASAIPAYAKRGDVIFADEGVSFAIQCGLLASRSKIKYFKHND---MDHLVSLLEEQSEEAIKNPAKARITRTFIVIEGLYMNYGDICPLPKIVELKYKYKVRIFLDETLSFGVLGDHGRGVTDHFGVDVTDIDLI 309          
The following BLAST results are available for this feature:
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SPTLC11.050e-1426.71serine palmitoyltransferase long chain base subuni... [more]
SPTLC37.755e-924.75serine palmitoyltransferase long chain base subuni... [more]
SPTLC25.817e-827.92serine palmitoyltransferase long chain base subuni... [more]
SPTLC27.180e-827.92serine palmitoyltransferase long chain base subuni... [more]
back to top
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptl-15.275e-1524.22Serine palmitoyltransferase 1 [Source:UniProtKB/S... [more]
sptl-15.275e-1524.22Serine palmitoyltransferase 1 [Source:UniProtKB/S... [more]
sptl-15.529e-1524.22Serine palmitoyltransferase 1 [Source:UniProtKB/S... [more]
sptl-15.529e-1524.22Serine palmitoyltransferase 1 [Source:UniProtKB/S... [more]
sptl-15.529e-1524.22Serine palmitoyltransferase 1 [Source:UniProtKB/S... [more]
back to top
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Spt-I5.713e-1527.95gene:FBgn0086532 transcript:FBtr0087731[more]
Spt-I5.713e-1527.95gene:FBgn0086532 transcript:FBtr0087729[more]
Spt-I5.713e-1527.95gene:FBgn0086532 transcript:FBtr0087730[more]
back to top
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptlc11.076e-1325.47serine palmitoyltransferase, long chain base subun... [more]
sptlc11.089e-1325.47serine palmitoyltransferase, long chain base subun... [more]
sptlc11.398e-1325.47serine palmitoyltransferase, long chain base subun... [more]
sptlc2a9.384e-1026.11serine palmitoyltransferase, long chain base subun... [more]
sptlc2b1.697e-927.71serine palmitoyltransferase, long chain base subun... [more]
back to top
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptlc16.527e-1526.71serine palmitoyltransferase, long chain base subun... [more]
sptlc16.565e-1526.71serine palmitoyltransferase, long chain base subun... [more]
sptlc18.430e-1526.71serine palmitoyltransferase, long chain base subun... [more]
sptlc19.062e-1526.71serine palmitoyltransferase, long chain base subun... [more]
sptlc11.296e-1426.71serine palmitoyltransferase, long chain base subun... [more]
back to top
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Sptlc18.981e-1626.71serine palmitoyltransferase, long chain base subun... [more]
Sptlc29.126e-825.00serine palmitoyltransferase, long chain base subun... [more]
Sptlc31.328e-727.61serine palmitoyltransferase, long chain base subun... [more]
Sptlc31.328e-727.61serine palmitoyltransferase, long chain base subun... [more]
back to top
BLAST of Serine palmitoyltransferase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35704|SPTC1_MOUSE6.282e-1526.71Serine palmitoyltransferase 1 OS=Mus musculus OX=1... [more]
sp|O54695|SPTC1_CRIGR9.122e-1526.71Serine palmitoyltransferase 1 OS=Cricetulus griseu... [more]
sp|Q3MHG1|SPTC1_BOVIN9.942e-1527.33Serine palmitoyltransferase 1 OS=Bos taurus OX=991... [more]
sp|D4A2H2|SPTC1_RAT1.868e-1426.71Serine palmitoyltransferase 1 OS=Rattus norvegicus... [more]
sp|O15269|SPTC1_HUMAN5.041e-1426.71Serine palmitoyltransferase 1 OS=Homo sapiens OX=9... [more]
back to top
BLAST of Serine palmitoyltransferase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4SJD63.051e-1728.57Serine palmitoyltransferase 1 OS=Stylophora pistil... [more]
A0A3M6UZP11.223e-1628.57Aminotran_1_2 domain-containing protein OS=Pocillo... [more]
A0A087TAV62.786e-1529.19Serine palmitoyltransferase 1 (Fragment) OS=Stegod... [more]
W5JS922.808e-1531.10Serine palmitoyltransferase i OS=Anopheles darling... [more]
A0A165ZK015.299e-1530.00PLP-dependent transferase OS=Exidia glandulosa HHB... [more]
back to top
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sptlc15.004e-1325.47serine palmitoyltransferase, long chain base subun... [more]
sptlc2a4.684e-826.06serine palmitoyltransferase, long chain base subun... [more]
sptlc2a4.722e-826.06serine palmitoyltransferase, long chain base subun... [more]
sptlc2a4.722e-826.06serine palmitoyltransferase, long chain base subun... [more]
back to top
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sptlc13.682e-923.60serine palmitoyltransferase, long chain base subun... [more]
sptlc2a7.092e-824.87serine palmitoyltransferase, long chain base subun... [more]
back to top
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
LCB15.291e-924.34Component of serine palmitoyltransferase; responsi... [more]
LCB25.628e-727.33Component of serine palmitoyltransferase; responsi... [more]
back to top
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO360828.055e-1325.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429902.432e-726.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine palmitoyltransferase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptlc16.545e-1324.84serine palmitoyltransferase long chain base subuni... [more]
sptlc2b7.005e-924.62serine palmitoyltransferase 2 [Source:NCBI gene;Ac... [more]
ENSORLT00000013273.21.032e-724.72serine palmitoyltransferase 2-like [Source:NCBI ge... [more]
ENSORLT00000042858.11.176e-724.72serine palmitoyltransferase 2-like [Source:NCBI ge... [more]
ENSORLT00000022091.21.179e-725.00serine palmitoyltransferase 2-like [Source:NCBI ge... [more]
back to top
BLAST of Serine palmitoyltransferase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071514.11.607e-13893.75SMESG000071514.1[more]
SMESG000071514.12.679e-7299.07SMESG000071514.1[more]
SMESG000052311.13.389e-1325.00SMESG000052311.1[more]
SMESG000080769.14.334e-1325.00SMESG000080769.1[more]
SMESG000052311.14.334e-1325.00SMESG000052311.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006553 ID=SMED30006553|Name=Serine palmitoyltransferase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=631bp
ATGATTTTTAAAGAATTTCTAACTGTTGCTTTAATTACAAATTCTGGACA
ATCTAACGGTGAACTTGGTGATTACGATCAAAATTATAAATTATGCTTTA
CTTCTGAAATTTCCAATTTCTTTTGCACAAATGAAGCCGATTCTAATTCG
GTTATTGGGAATTTATATAATGAAATTGAGTTGACAATATCCCAATTTCT
GAAACTAGAGGATTGTTTAATATTTTCAGATGCTTATTCAGCATTATTTA
GCAATCTTTTGATTATTTCCAACAGCTGTCAGGCTGTATTTCTTGACGCC
GGATGTTCTATGGTTTTGAAAACGAGCTTGATGAGACATGTGGATAACAT
AATTGTATTTCCGCATAATGATTGTGAGAGTCTTGATAGGATGCTTGGGT
ATTTTGATAGGAGAGATTGTGAGTATCTGTTGCGGCCGGTGATTTTTGTG
GAAAGCATTTCCATTGATGACGGCACCAAGTCTAACATTGTCGGTTTTGT
TGAATTGCGGTTTAAACACAAACTCAATTTGGTAATTAATGAGCAACTAT
CGATTGGCTGTCTCGGTCTTTTTGGTCGAGGCCTGATTGAGGAGGAATCA
ATGCCAATGACACACGTGGACTTAGTTTTTG
back to top

protein sequence of SMED30006553-orf-1

>SMED30006553-orf-1 ID=SMED30006553-orf-1|Name=SMED30006553-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=210bp
MIFKEFLTVALITNSGQSNGELGDYDQNYKLCFTSEISNFFCTNEADSNS
VIGNLYNEIELTISQFLKLEDCLIFSDAYSALFSNLLIISNSCQAVFLDA
GCSMVLKTSLMRHVDNIIVFPHNDCESLDRMLGYFDRRDCEYLLRPVIFV
ESISIDDGTKSNIVGFVELRFKHKLNLVINEQLSIGCLGLFGRGLIEEES
MPMTHVDLVF
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR015421PyrdxlP-dep_Trfase_major
IPR015424PyrdxlP-dep_Trfase
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016740transferase activity
GO:0030170pyridoxal phosphate binding
Vocabulary: biological process
TermDefinition
GO:0009058biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 43..210
e-value: 2.5E-16
score: 61.5
NoneNo IPR availablePANTHERPTHR13693:SF2SERINE PALMITOYLTRANSFERASE 1coord: 58..209
NoneNo IPR availablePANTHERPTHR13693CLASS II AMINOTRANSFERASE/8-AMINO-7-OXONONANOATE SYNTHASEcoord: 58..209
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 54..208