tRNA 2'-phosphotransferase 1

Overview
NametRNA 2'-phosphotransferase 1
Smed IDSMED30006546
Length (bp)1334
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tRNA 2'-phosphotransferase 1 (SMED30006546) t-SNE clustered cells

Violin plots show distribution of expression levels for tRNA 2'-phosphotransferase 1 (SMED30006546) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tRNA 2'-phosphotransferase 1 (SMED30006546) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tRNA 2'-phosphotransferase 1 (SMED30006546) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006546

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30006546SMESG000068824.1 dd_Smed_v4_5292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006546SMESG000068824.1 dd_Smed_v4_5292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006546SMESG000068824.1 dd_Smed_v6_5292_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006546SMESG000068824.1 dd_Smed_v4_5292_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Human
Match: TRPT1 (tRNA phosphotransferase 1 [Source:HGNC Symbol;Acc:HGNC:20316])

HSP 1 Score: 121.709 bits (304), Expect = 2.911e-31
Identity = 72/222 (32.43%), Postives = 118/222 (53.15%), Query Frame = 2
Query:  353 PKPLELNNDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRY--EIISKNSDELIAALQGHTVAINNTSLVLLSSCD-VTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIK-TKKKLFVNSKSQCEVTS 988
            P+P E + D  + LSK ++  LRHG  + GL +    +V +  LL L  FR F+ ED+++VV+TN K+R+  ++   ++  LI A QGH++ +    L+ L +   +  +  HGTF+ +W SI   GL   GR  IHL      +      +R   EI + +D   A+ DG+ FF++ N ++L  G  +G L P YF +   ++ T+K L +    + E  S
Sbjct:   20 PRPREQDRD--VQLSKALSYALRHGALKLGLPMGADGFVPLGTLLQLPQFRGFSAEDVQRVVDTNRKQRFALQLGDPSTGLLIRANQGHSLQVPKLELMPLETPQALPPMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFIDGPLALADGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTRKPLSLAGDEETECQS 239          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Human
Match: TRPT1 (tRNA phosphotransferase 1 [Source:HGNC Symbol;Acc:HGNC:20316])

HSP 1 Score: 120.553 bits (301), Expect = 9.163e-31
Identity = 72/224 (32.14%), Postives = 118/224 (52.68%), Query Frame = 2
Query:  353 PKPLELNNDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRY--EIISKNSDELIAALQGHTVAINNTSLVLL---SSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIK-TKKKLFVNSKSQCEVTS 988
            P+P E + D  + LSK ++  LRHG  + GL +    +V +  LL L  FR F+ ED+++VV+TN K+R+  ++   ++  LI A QGH++ +    L L+   +   +  +  HGTF+ +W SI   GL   GR  IHL      +      +R   EI + +D   A+ DG+ FF++ N ++L  G  +G L P YF +   ++ T+K L +    + E  S
Sbjct:   20 PRPREQDRD--VQLSKALSYALRHGALKLGLPMGADGFVPLGTLLQLPQFRGFSAEDVQRVVDTNRKQRFALQLGDPSTGLLIRANQGHSLQVGVPKLELMPLETPQALPPMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFIDGPLALADGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTRKPLSLAGDEETECQS 241          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Human
Match: TRPT1 (tRNA phosphotransferase 1 [Source:HGNC Symbol;Acc:HGNC:20316])

HSP 1 Score: 105.145 bits (261), Expect = 1.291e-25
Identity = 59/185 (31.89%), Postives = 98/185 (52.97%), Query Frame = 2
Query:  464 YVKVSDLLNLSSFREFTREDIEKVVNTNGKRRY--EIISKNSDELIAALQGHTVAINNTSLVLLSSCD-VTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIK-TKKKLFVNSKSQCEVTS 988
            +V +  LL L  FR F+ ED+++VV+TN K+R+  ++   ++  LI A QGH++ +    L+ L +   +  +  HGTF+ +W SI   GL   GR  IHL      +      +R   EI + +D   A+ DG+ FF++ N ++L  G  +G L P YF +   ++ T+K L +    + E  S
Sbjct:    6 FVPLGTLLQLPQFRGFSAEDVQRVVDTNRKQRFALQLGDPSTGLLIRANQGHSLQVPKLELMPLETPQALPPMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFIDGPLALADGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTRKPLSLAGDEETECQS 190          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Human
Match: TRPT1 (tRNA phosphotransferase 1 [Source:HGNC Symbol;Acc:HGNC:20316])

HSP 1 Score: 95.5153 bits (236), Expect = 2.351e-22
Identity = 57/174 (32.76%), Postives = 92/174 (52.87%), Query Frame = 2
Query:  353 PKPLELNNDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRY--EIISKNSDELIAALQGHTVAINNTSLVLL---SSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAIKDGM 844
            P+P E + D  + LSK ++  LRHG  + GL +    +V +  LL L  FR F+ ED+++VV+TN K+R+  ++   ++  LI A QGH++ +    L L+   +   +  +  HGTF+ +W SI   GL   GR  IHL      +      +R   EI + +D   A+ DG+
Sbjct:   20 PRPREQDRD--VQLSKALSYALRHGALKLGLPMGADGFVPLGTLLQLPQFRGFSAEDVQRVVDTNRKQRFALQLGDPSTGLLIRANQGHSLQVGVPKLELMPLETPQALPPMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFIDGPLALADGI 191          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Human
Match: TRPT1 (tRNA phosphotransferase 1 [Source:HGNC Symbol;Acc:HGNC:20316])

HSP 1 Score: 91.2781 bits (225), Expect = 1.428e-20
Identity = 55/168 (32.74%), Postives = 89/168 (52.98%), Query Frame = 2
Query:  353 PKPLELNNDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRY--EIISKNSDELIAALQGHTVAINNTSLVLLSSCD-VTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAI 832
            P+P E + D  + LSK ++  LRHG  + GL +    +V +  LL L  FR F+ ED+++VV+TN K+R+  ++   ++  LI A QGH++ +    L+ L +   +  +  HGTF+ +W SI   GL   GR  IHL      +      +R   EI + +D   A+
Sbjct:   20 PRPREQDRD--VQLSKALSYALRHGALKLGLPMGADGFVPLGTLLQLPQFRGFSAEDVQRVVDTNRKQRFALQLGDPSTGLLIRANQGHSLQVPKLELMPLETPQALPPMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFIDGPLAL 185          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Fly
Match: CG33057 (gene:FBgn0053057 transcript:FBtr0344802)

HSP 1 Score: 111.309 bits (277), Expect = 3.596e-28
Identity = 66/201 (32.84%), Postives = 112/201 (55.72%), Query Frame = 2
Query:  392 LSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSDEL----IAALQGHTVAI---NNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTS-ESRETI---RDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEGENGILKPNYFVDVWDIKTKKKLFVN 961
            LSKK++ +LRHG    G+ I    +V V DL     +  FT E ++++   + K+RY +  + + EL    I A QGH++A+       L  ++      LA HGT+Y +W +I++ GL +M R+ +H   S E+  T+   R   +I+I ++VE+ + DG+  +++ NN+LLC G  G +  +YF  V D KT + L ++
Sbjct:   11 LSKKLSWLLRHGAKTEGITIRADGFVSVPDLQKHPRYLCFTLEKLKEIAAADAKQRYTL--RWNPELGVHEIRANQGHSLAVLEGEAGGLENITHVSQVPLAVHGTYYRHWGAIRSQGLSRMNRNHVHFACSDETNSTLSGFRSDCQILIYLNVEKVLADGIPIYRSSNNVLLCPGIEGFIHSSYFQRVVDKKTGQPLQID 209          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Fly
Match: CG33057 (gene:FBgn0053057 transcript:FBtr0076678)

HSP 1 Score: 111.309 bits (277), Expect = 3.596e-28
Identity = 66/201 (32.84%), Postives = 112/201 (55.72%), Query Frame = 2
Query:  392 LSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSDEL----IAALQGHTVAI---NNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTS-ESRETI---RDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEGENGILKPNYFVDVWDIKTKKKLFVN 961
            LSKK++ +LRHG    G+ I    +V V DL     +  FT E ++++   + K+RY +  + + EL    I A QGH++A+       L  ++      LA HGT+Y +W +I++ GL +M R+ +H   S E+  T+   R   +I+I ++VE+ + DG+  +++ NN+LLC G  G +  +YF  V D KT + L ++
Sbjct:   11 LSKKLSWLLRHGAKTEGITIRADGFVSVPDLQKHPRYLCFTLEKLKEIAAADAKQRYTL--RWNPELGVHEIRANQGHSLAVLEGEAGGLENITHVSQVPLAVHGTYYRHWGAIRSQGLSRMNRNHVHFACSDETNSTLSGFRSDCQILIYLNVEKVLADGIPIYRSSNNVLLCPGIEGFIHSSYFQRVVDKKTGQPLQID 209          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Zebrafish
Match: trpt1 (tRNA phosphotransferase 1 [Source:NCBI gene;Acc:503604])

HSP 1 Score: 121.324 bits (303), Expect = 1.694e-31
Identity = 67/196 (34.18%), Postives = 114/196 (58.16%), Query Frame = 2
Query:  383 EIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSDE--LIAALQGHTVAINNTSLVLLSS--CDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHL---YTSESR--ETIRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEGE-NGILKPNYFVDVWDIKT 940
            ++ LSK ++ +LRHG  + GL++++  +V V +LL    FR F+ +D+E+VV +N K+R+++     D+   I A QGH+V + +  L  +S    D  + A HG++  +W SI++ GL +M R  IHL      E R    +R   ++ + +DV +A+ DG++FF ++N +LL  G+  GIL P YF     +K 
Sbjct:   22 DVRLSKSLSYVLRHGASKMGLQMNSDGFVFVEELLAHQQFRSFSVDDVERVVASNDKQRFKLCKHPEDDRLQIRANQGHSVQVTDLELREISQDDQDYPREAVHGSYMKHWPSIRSQGLSRMNRTHIHLAPGLPGEGRVISGMRQSCDLAVYIDVTKAMSDGIKFFWSENGVLLTPGDAAGILAPCYFSRAQRLKP 217          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Zebrafish
Match: trpt1 (tRNA phosphotransferase 1 [Source:NCBI gene;Acc:503604])

HSP 1 Score: 73.1738 bits (178), Expect = 3.768e-15
Identity = 39/116 (33.62%), Postives = 71/116 (61.21%), Query Frame = 2
Query:  383 EIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSDE--LIAALQGHTVAINNTSLVLLSS--CDVTKLAYHGTFYSNWESIKA 718
            ++ LSK ++ +LRHG  + GL++++  +V V +LL    FR F+ +D+E+VV +N K+R+++     D+   I A QGH+V + +  L  +S    D  + A HG++  +W SI++
Sbjct:   22 DVRLSKSLSYVLRHGASKMGLQMNSDGFVFVEELLAHQQFRSFSVDDVERVVASNDKQRFKLCKHPEDDRLQIRANQGHSVQVTDLELREISQDDQDYPREAVHGSYMKHWPSIRS 137          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Xenopus
Match: trio (trio Rho guanine nucleotide exchange factor [Source:Xenbase;Acc:XB-GENE-922516])

HSP 1 Score: 125.176 bits (313), Expect = 1.364e-32
Identity = 75/206 (36.41%), Postives = 114/206 (55.34%), Query Frame = 2
Query:  374 NDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSDEL--IAALQGHTVAINNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYT---SESRETI---RDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIKTKKKLFVNS 964
             DP++ LSK ++  LRHG    GL +    +V VS LL L  FR F++ DIE+VV+ N K+R+ +    +D    I A QGH++ +    L  L   ++   A HGT++ +W SI+  GL +M R  IHL T    E +E I   R   E+ I +D+ +A+ DG+ FF + N +LL  G  +G+L P YF+    ++ + K F  S
Sbjct:   18 QDPDVHLSKCLSYALRHGAVNLGLPMGTDGFVPVSSLLLLPQFRTFSQVDIERVVSCNDKQRFTLRYSYADGALEIRANQGHSLQV-EVELTPLGE-ELPNQAIHGTYFRHWPSIQQRGLSRMNRTHIHLCTELPGEGQECISGMRRDCEVAIFIDLPKAVADGLLFFWSSNRVLLTPGNADGLLLPKYFLRALQLRPQSKFFCKS 221          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Xenopus
Match: trio (trio Rho guanine nucleotide exchange factor [Source:Xenbase;Acc:XB-GENE-922516])

HSP 1 Score: 122.479 bits (306), Expect = 8.373e-32
Identity = 72/202 (35.64%), Postives = 114/202 (56.44%), Query Frame = 2
Query:  374 NDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSDEL--IAALQGHTVAINNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYT---SESRETI---RDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIKTKKKL 952
             DP++ LSK ++  LRHG    GL +    +V VS LL L  FR F++ DIE+VV+ N K+R+ +    +D    I A QGH++ +    L  L   ++   A HGT++ +W SI+  GL +M R  IHL T    E +E I   R   E+ I +D+ +A+ DG+ FF + N +LL  G  +G+L P YF+    ++ ++++
Sbjct:   18 QDPDVHLSKCLSYALRHGAVNLGLPMGTDGFVPVSSLLLLPQFRTFSQVDIERVVSCNDKQRFTLRYSYADGALEIRANQGHSLQV-EVELTPLGE-ELPNQAIHGTYFRHWPSIQQRGLSRMNRTHIHLCTELPGEGQECISGMRRDCEVAIFIDLPKAVADGLLFFWSSNRVLLTPGNADGLLLPKYFLRALQLRPQRQM 217          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Mouse
Match: Trpt1 (tRNA phosphotransferase 1 [Source:MGI Symbol;Acc:MGI:1333115])

HSP 1 Score: 115.546 bits (288), Expect = 3.292e-29
Identity = 70/215 (32.56%), Postives = 108/215 (50.23%), Query Frame = 2
Query:  374 NDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIIS--KNSDELIAALQGHTVAINNTSLVLLSSCDVTKLAY-HGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIK-TKKKLFVNSKSQCEVTS 988
             D  + LSK ++  LRHG  + GL +    +V +  LL L  F  F+ ED++ VVNTN K+R+ +     ++  LI A QGH++ +    L  L +     L   HGTF+ +W SI   GL + GR  IHL +    +      IR   E+ + +D   A+ DG+ FF + N ++L  G   G L P YF +   ++ T+K L +    + E  S
Sbjct:   20 QDRNVQLSKALSYALRHGALKLGLPMRADGFVPLQALLQLPQFHSFSIEDVQLVVNTNEKQRFTLQPGEPSTGLLIRANQGHSLQVPELELTPLETPQALPLTLVHGTFWKHWPSILLKGLSRQGRTHIHLASGLPGDPGVISGIRPNCEVAVFIDGPLALTDGIPFFCSANGVILTPGNAEGFLLPKYFKEALQLRPTRKPLSLAGDKETETQS 234          
BLAST of tRNA 2'-phosphotransferase 1 vs. UniProt/SwissProt
Match: sp|Q5EAR5|TRPT1_DANRE (tRNA 2'-phosphotransferase 1 OS=Danio rerio OX=7955 GN=trpt1 PE=2 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 1.279e-30
Identity = 67/196 (34.18%), Postives = 114/196 (58.16%), Query Frame = 2
Query:  383 EIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSDE--LIAALQGHTVAINNTSLVLLSS--CDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHL---YTSESR--ETIRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEGE-NGILKPNYFVDVWDIKT 940
            ++ LSK ++ +LRHG  + GL++++  +V V +LL    FR F+ +D+E+VV +N K+R+++     D+   I A QGH+V + +  L  +S    D  + A HG++  +W SI++ GL +M R  IHL      E R    +R   ++ + +DV +A+ DG++FF ++N +LL  G+  GIL P YF     +K 
Sbjct:   22 DVRLSKSLSYVLRHGASKMGLQMNSDGFVFVEELLAHQQFRSFSVDDVERVVASNDKQRFKLCKHPEDDRLQIRANQGHSVQVTDLELREISQDDQDYPREAVHGSYMKHWPSIRSQGLSRMNRTHIHLAPGLPGEGRVISGMRQSCDLAVYIDVTKAMSDGIKFFWSENGVLLTPGDAAGILAPCYFSRAQRLKP 217          
BLAST of tRNA 2'-phosphotransferase 1 vs. UniProt/SwissProt
Match: sp|Q86TN4|TRPT1_HUMAN (tRNA 2'-phosphotransferase 1 OS=Homo sapiens OX=9606 GN=TRPT1 PE=1 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 1.398e-30
Identity = 72/222 (32.43%), Postives = 118/222 (53.15%), Query Frame = 2
Query:  353 PKPLELNNDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRY--EIISKNSDELIAALQGHTVAINNTSLVLLSSCD-VTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIK-TKKKLFVNSKSQCEVTS 988
            P+P E + D  + LSK ++  LRHG  + GL +    +V +  LL L  FR F+ ED+++VV+TN K+R+  ++   ++  LI A QGH++ +    L+ L +   +  +  HGTF+ +W SI   GL   GR  IHL      +      +R   EI + +D   A+ DG+ FF++ N ++L  G  +G L P YF +   ++ T+K L +    + E  S
Sbjct:   20 PRPREQDRD--VQLSKALSYALRHGALKLGLPMGADGFVPLGTLLQLPQFRGFSAEDVQRVVDTNRKQRFALQLGDPSTGLLIRANQGHSLQVPKLELMPLETPQALPPMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFIDGPLALADGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTRKPLSLAGDEETECQS 239          
BLAST of tRNA 2'-phosphotransferase 1 vs. UniProt/SwissProt
Match: sp|Q8K3A2|TRPT1_MOUSE (tRNA 2'-phosphotransferase 1 OS=Mus musculus OX=10090 GN=Trpt1 PE=2 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 2.302e-28
Identity = 70/215 (32.56%), Postives = 108/215 (50.23%), Query Frame = 2
Query:  374 NDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIIS--KNSDELIAALQGHTVAINNTSLVLLSSCDVTKLAY-HGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIK-TKKKLFVNSKSQCEVTS 988
             D  + LSK ++  LRHG  + GL +    +V +  LL L  F  F+ ED++ VVNTN K+R+ +     ++  LI A QGH++ +    L  L +     L   HGTF+ +W SI   GL + GR  IHL +    +      IR   E+ + +D   A+ DG+ FF + N ++L  G   G L P YF +   ++ T+K L +    + E  S
Sbjct:   20 QDRNVQLSKALSYALRHGALKLGLPMRADGFVPLQALLQLPQFHSFSIEDVQLVVNTNEKQRFTLQPGEPSTGLLIRANQGHSLQVPELELTPLETPQALPLTLVHGTFWKHWPSILLKGLSRQGRTHIHLASGLPGDPGVISGIRPNCEVAVFIDGPLALTDGIPFFCSANGVILTPGNAEGFLLPKYFKEALQLRPTRKPLSLAGDKETETQS 234          
BLAST of tRNA 2'-phosphotransferase 1 vs. UniProt/SwissProt
Match: sp|Q3ZBM7|TRPT1_BOVIN (tRNA 2'-phosphotransferase 1 OS=Bos taurus OX=9913 GN=TRPT1 PE=2 SV=3)

HSP 1 Score: 115.161 bits (287), Expect = 4.598e-28
Identity = 64/202 (31.68%), Postives = 106/202 (52.48%), Query Frame = 2
Query:  371 NNDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIIS--KNSDELIAALQGHTVAINNTSLVLLSSCDVTKLAY-HGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIKTKKK 949
            + D ++ LSK ++  LRHG  + GL +    +V +  LL L  FR F+ ED+++VV+TN K+R+ +     ++  LI A QGH++ +    L  L +     L   HGTF  +W SI   GL   GR  IHL      +      +R   E+ + ++   A+ DG+ FF++ N ++L  G  +G+L P YF +   ++  +K
Sbjct:   25 DQDRDVQLSKALSYALRHGALKLGLPMGADGFVPLDALLQLPQFRSFSAEDVQRVVDTNVKQRFALQPGDPSTGPLIRANQGHSLQVPELELEPLETPQALPLMLVHGTFRQHWPSILLKGLSCRGRTHIHLAPGLPGDPGVISGMRPNCEVAVFINGPLALADGIPFFRSTNGVILTPGNADGVLPPKYFKEALQLRPTRK 226          
BLAST of tRNA 2'-phosphotransferase 1 vs. UniProt/SwissProt
Match: sp|Q8XP22|KPTA_CLOPE (Probable RNA 2'-phosphotransferase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=kptA PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.732e-20
Identity = 62/176 (35.23%), Postives = 96/176 (54.55%), Query Frame = 2
Query:  371 NNDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNL--SSFREFTREDIEKVVNTNGKRRYEIISKNSDELIAALQGHTVAINNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRETI---RDGAEIVIEVDVERAIKDGMRFFKAKNNILLCE 883
            NND +I  SK ++ ILRH     GL++    Y+ V DL+     S++ F+ +D+E++V  + K RY      S   I A QGH++ ++    + L +    K+ YHGT     ESI  NGL K  R ++HL       +I   R G  +++EVD E   KDG++F+ +KNN+ LC+
Sbjct:    3 NNDSKI--SKYISLILRHKPEEIGLKLDEHGYLGVLDLIEGLNKSYKGFSMDDLERIVREDSKGRYSFNEDKSK--IRANQGHSIKVD----LGLEAIKPPKVLYHGTGRKYIESILKNGLIKKERQYVHLSKDIETASIVGKRHGDLVILEVDSESMFKDGIKFYLSKNNVWLCD 170          
BLAST of tRNA 2'-phosphotransferase 1 vs. TrEMBL
Match: A0A3Q0KEL2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 2.346e-54
Identity = 104/249 (41.77%), Postives = 150/249 (60.24%), Query Frame = 2
Query:  230 MIEDILKSDTFTNKVITVDDVIRAVHEDPDIRFSVRGFKIRPKPLELNNDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSDEL--IAALQGHTVAINNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIKTKKKL 952
            +I++I++   F  +  T D++I  VH D  +RFSVRG K+R KP ELN DP++ILSKK+A ILRHG    G++   G Y+ V  +L L  F+    EDI +VVN+N K+RYE+ +   + L  I A QGHTV I    + L+ + +      HGT++ NW+SI+  GLK+M R  IH    E  ET     +R  AEI+I +D+ +AI DG +F+ +KNN++LCEG + G L   YF   +    + KL
Sbjct:   49 LIDEIIQLPEFKKEHCTYDEIIDVVHNDALLRFSVRGSKVRLKPPELNKDPDVILSKKLAWILRHGAENVGMKYEPGGYLYVDKILQLKPFQGVRLEDISRVVNSNDKKRYELSTNPENGLLRIRAYQGHTVTIEGLDIALIENPEDYPTVIHGTYFRNWDSIRKEGLKRMQRTHIHFAPGEVGETGVISGMRSSAEIIIYIDLIKAINDGYKFYISKNNVILCEGNKEGCLPTTYFRAAYQRNPRLKL 297          
BLAST of tRNA 2'-phosphotransferase 1 vs. TrEMBL
Match: A0A5K4ECQ7 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 8.748e-54
Identity = 104/249 (41.77%), Postives = 150/249 (60.24%), Query Frame = 2
Query:  230 MIEDILKSDTFTNKVITVDDVIRAVHEDPDIRFSVRGFKIRPKPLELNNDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSDEL--IAALQGHTVAINNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIKTKKKL 952
            +I++I++   F  +  T D++I  VH D  +RFSVRG K+R KP ELN DP++ILSKK+A ILRHG    G++   G Y+ V  +L L  F+    EDI +VVN+N K+RYE+ +   + L  I A QGHTV I    + L+ + +      HGT++ NW+SI+  GLK+M R  IH    E  ET     +R  AEI+I +D+ +AI DG +F+ +KNN++LCEG + G L   YF   +    + KL
Sbjct:   94 LIDEIIQLPEFKKEHCTYDEIIDVVHNDALLRFSVRGSKVRLKPPELNKDPDVILSKKLAWILRHGAENVGMKYEPGGYLYVDKILQLKPFQGVRLEDISRVVNSNDKKRYELSTNPENGLLRIRAYQGHTVTIEGLDIALIENPEDYPTVIHGTYFRNWDSIRKEGLKRMQRTHIHFAPGEVGETGVISGMRSSAEIIIYIDLIKAINDGYKFYISKNNVILCEGNKEGCLPTTYFRAAYQRNPRLKL 342          
BLAST of tRNA 2'-phosphotransferase 1 vs. TrEMBL
Match: A0A094ZM13 (tRNA 2'-phosphotransferase 1 OS=Schistosoma haematobium OX=6185 GN=MS3_03942 PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 3.017e-53
Identity = 104/249 (41.77%), Postives = 150/249 (60.24%), Query Frame = 2
Query:  230 MIEDILKSDTFTNKVITVDDVIRAVHEDPDIRFSVRGFKIRPKPLELNNDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIIS--KNSDELIAALQGHTVAINNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIKTKKKL 952
            +I++I++   F  +  T D++I  VH D  +RFSVRG K+R KP ELN DP++ILSKK+A ILRHG    G++   G Y+ V  +L L  F+    EDI +VVN+N K+RYE+ +  +N    I A QGHTV I    + L+ + +      HGT++ NW+SI+  GLK+M R  IH    E  ET     +R  AEI+I +D+ +AI DG +F+ +KNN++LCEG + G L   YF   +    + KL
Sbjct:   94 LIDEIIQLPEFKKEHCTYDEIIDVVHNDALLRFSVRGSKVRLKPPELNKDPDVILSKKLAWILRHGAENVGMKYEPGGYLYVDKILQLKPFQGVRLEDISRVVNSNDKKRYELSTNPENGRLRIRAYQGHTVTIEGLDISLIENPEDYPTVIHGTYFRNWDSIRREGLKRMQRTHIHFAPGEVGETGVISGMRSSAEIIIYIDLIKAINDGYKFYLSKNNVILCEGNKEGCLPTKYFRAAYQRNPRLKL 342          
BLAST of tRNA 2'-phosphotransferase 1 vs. TrEMBL
Match: A0A430QE53 (2'-phosphotransferase OS=Schistosoma bovis OX=6184 GN=DC041_0009050 PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 8.418e-53
Identity = 102/237 (43.04%), Postives = 146/237 (61.60%), Query Frame = 2
Query:  230 MIEDILKSDTFTNKVITVDDVIRAVHEDPDIRFSVRGFKIRPKPLELNNDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIIS--KNSDELIAALQGHTVAINNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYF 916
            +I++I++   F  +  T D++I  VH D  +RFSVRG K+R KP ELN DP++ILSKK+A ILRHG    G++   G Y+ V  +L L  F+    EDI +VVN+N K+RYE+ +  +N    I A QGHTV I    + L+ + +      HGT++ NW+SI+  GLK+M R  IH    E  ET     +R  AEI+I +D+ +AI DG +F+ +KNN++LCEG + G L   YF
Sbjct:   71 LIDEIIQLPEFKKEHCTYDEIIDVVHNDALLRFSVRGSKVRLKPPELNKDPDVILSKKLAWILRHGAENVGMKYEPGGYLYVDKILQLKPFQGVRLEDISRVVNSNDKKRYELSTNPENGRLRIRAYQGHTVTIEGLDISLIENPEDYPTVIHGTYFRNWDSIRREGLKRMQRTHIHFAPGEVGETGVISGMRSSAEIIIYIDLIKAINDGYKFYVSKNNVILCEGNKEGCLPTKYF 307          
BLAST of tRNA 2'-phosphotransferase 1 vs. TrEMBL
Match: A0A4Z2D798 (tRNA 2'-phosphotransferase 1 isoform 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_003804 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 4.929e-52
Identity = 108/284 (38.03%), Postives = 161/284 (56.69%), Query Frame = 2
Query:  149 CEQEDLLKCLEGYFHKNNNESNKIEFQMIED-------ILKSDTFTNKVITVDDVIRAVHEDPDIRFSVRGFKIRPKPLELNNDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIIS--KNSDELIAALQGHTVAINNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRET-----IRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIKTKKKLF 955
            C  E +L  LE +F      S  I+F ++ D       I+    F  +  T +++  AVH D  +RFS RG K+R KP ELN +P++ILSKK+A ILRH     G+    G Y+ V  +L L  F+    EDI +VVN+N K+RYE+ +  +N    I A QGH+V I+   + L+ + +      HGT++ NWESI+  GLK+M R  IH    E  E+     +R  AEI+I +D+ +A+KDG +F+ +KNN++LCEG  +G L   YF+  +    +K +F
Sbjct:   39 CRNEVILNLLEQFFKGELQYS--IKFTVLPDGYYSLDEIVNLPEFKKENCTAEEIAEAVHSDLLLRFSTRGSKVRLKPPELNKNPDVILSKKLACILRHAAENVGMNYEPGGYLYVDKILQLKPFQGVRVEDILRVVNSNDKKRYEVSTNPENGRLKIRAFQGHSVPIDGLDITLIENPENYPNVIHGTYFRNWESIRKEGLKRMRRTHIHFAPGEIGESGVISGLRSSAEILIYIDLAKAMKDGYKFYISKNNVILCEGNADGCLPTKYFLAAYQRYPRKCIF 320          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Cavefish
Match: trpt1 (tRNA phosphotransferase 1 [Source:NCBI gene;Acc:103041850])

HSP 1 Score: 119.398 bits (298), Expect = 1.728e-30
Identity = 67/199 (33.67%), Postives = 113/199 (56.78%), Query Frame = 2
Query:  383 EIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEI--ISKNSDELIAALQGHTVAINNTSL--VLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYT-----SESRETIRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEGEN-GILKPNYFVDVWDIKTKKK 949
            ++ LSK M+  LRHG  + GL + +  ++ V +LL    F  F+ ED+E+VV TN K+R+++   S+N    I A QGH+V + +  L  V L + D  + A HG++  +W SI++ GL +M R  IHL       S+    +R   ++ + ++V +A+ DG+ F+ ++N +LL  G+  G+L P YF     +K  +K
Sbjct:   24 DVRLSKSMSYALRHGAGKMGLHMSSDGFIFVDELLAHPQFSSFSLEDLERVVATNDKQRFKLHPHSENGRLQIRANQGHSVQVEDLELRAVALDAPDCPQEAVHGSYVKHWASIRSQGLSRMNRTHIHLAPGLPGDSQVISGMRQNCDLAVYINVPKALSDGIEFYWSENGVLLTPGDKEGLLLPRYFSRAQRLKPSRK 222          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Cavefish
Match: trpt1 (tRNA phosphotransferase 1 [Source:NCBI gene;Acc:103041850])

HSP 1 Score: 116.701 bits (291), Expect = 5.693e-30
Identity = 66/196 (33.67%), Postives = 111/196 (56.63%), Query Frame = 2
Query:  383 EIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEI--ISKNSDELIAALQGHTVAINNTSL--VLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYT-----SESRETIRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEGE-NGILKPNYFVDVWDIKT 940
            ++ LSK M+  LRHG  + GL + +  ++ V +LL    F  F+ ED+E+VV TN K+R+++   S+N    I A QGH+V + +  L  V L + D  + A HG++  +W SI++ GL +M R  IHL       S+    +R   ++ + ++V +A+ DG+ F+ ++N +LL  G+  G+L P YF     +K 
Sbjct:   24 DVRLSKSMSYALRHGAGKMGLHMSSDGFIFVDELLAHPQFSSFSLEDLERVVATNDKQRFKLHPHSENGRLQIRANQGHSVQVEDLELRAVALDAPDCPQEAVHGSYVKHWASIRSQGLSRMNRTHIHLAPGLPGDSQVISGMRQNCDLAVYINVPKALSDGIEFYWSENGVLLTPGDKEGLLLPRYFSRAQRLKP 219          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Sea Lamprey
Match: trpt1 (tRNA phosphotransferase 1 [Source:NCBI gene;Acc:503604])

HSP 1 Score: 117.087 bits (292), Expect = 6.479e-31
Identity = 64/199 (32.16%), Postives = 108/199 (54.27%), Query Frame = 2
Query:  383 EIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSDE--LIAALQGHTVAINNTSL--VLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESR-----ETIRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIKTKKK 949
            ++ LSK ++  LRHG HR GL + +  +V V +LL   S   +   D+ +VV +N K+R+ + +  +     I A QGH++ +    L  + L   D+ + A HGTF  +W SI  +GL + GR  IH+   E         +R   EI I +D+E+A++DG+ F+++ N ++L  G   G+L   YF  V  ++ ++K
Sbjct:    1 DVRLSKTLSYALRHGAHRLGLHMGSDGFVDVQELLAQRSLAGYEEADLRRVVESNDKQRFALRAHPTTGSLQIRANQGHSLQVEELDLQPITLHGSDLPECAVHGTFARHWPSILRDGLSRRGRAHIHMAPGEPGAEGVISGMRGNCEIAIYIDIEKALQDGIPFYRSANGVILSSGNAQGVLPRQYFQRVMQLQPERK 199          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Yeast
Match: TPT1 (tRNA 2'-phosphotransferase that catalyzes final step in tRNA splicing: the transfer of the 2'-PO(4) from the splice junction to NAD(+) to form ADP-ribose 1''-2''cyclic phosphate and nicotinamide [Source:SGD;Acc:S000005462])

HSP 1 Score: 55.8398 bits (133), Expect = 2.192e-9
Identity = 46/179 (25.70%), Postives = 91/179 (50.84%), Query Frame = 2
Query:  383 EIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFR--EFTREDIEKVVNTNGKRRYEIISKNSD-ELIAALQGHTV-AINNTSLVLLSSCDVTKLAY---HGT-FYSNWESIKANGLKKMGRDFIH-----LYTSESRETIRDGAEIVIEVDVERAI-KDGMRFFKAKNNILL 877
            ++ LSK ++ +LRH   +  L I +  Y  + +LL+ +  +  + T +DI ++V  N K+R+ I +  +D E I A QGH++ +I  +  VL+   + ++L     HGT   S  + I++  +  M R+ +H     L+       +R  + + I +D    +    ++ F++ NN+ L
Sbjct:   11 DVQLSKALSYLLRHTAVKEKLTIDSNGYTPLKELLSHNRLKTHKCTVDDIHRIVKENDKQRFHIKTLGADEEWICATQGHSIKSIQPSDEVLVPITEASQLPQELIHGTNLQSVIKIIESGAISPMSRNHVHLSPGMLHAKGVISGMRSSSNVYIFIDCHSPLFFQTLKMFRSLNNVYL 189          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Nematostella
Match: EDO48485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIZ2])

HSP 1 Score: 105.145 bits (261), Expect = 2.073e-26
Identity = 69/200 (34.50%), Postives = 107/200 (53.50%), Query Frame = 2
Query:  383 EIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIIS-KNSDEL-IAALQGHTVAINNTSLVLLSSCDVTKLAY--HGTFYSNWESIKANGLKKMGRDFIHLYTSESRETIRDGAEIVIEVDVER----------AIKDGMRFFKAKNNILLCEGE-NGILKPNYFVDVWDIK 937
            +I LSK ++ I RHG  + GL+++ G  + V ++L L  F +FT ED+ +VV  N K+R+ + + ++S  L +AA QGHT+ +    L  ++  D+ K     HGT+ ++W+SIK   L    R F+      +R  I+DGA     VD  R             DG  FF + NN++LC G  +G+L P YF  V  +K
Sbjct:    1 DIKLSKALSYICRHGAAKEGLQMNFGGLIFVDEILKLRQFCQFTEEDVRRVVKDNDKQRFVLATDQDSGRLQVAASQGHTMEVEGLDLSPITDKDIDKYPTVIHGTYLNSWQSIKKQKL----RPFLRSLPGPTRLKIQDGAR-SPNVDGFRNNNTDFCFVCLFLDGYEFFTSTNNVILCPGNVDGLLPPCYFDQVIQLK 195          
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Medaka
Match: trpt1 (tRNA phosphotransferase 1 [Source:NCBI gene;Acc:101156179])

HSP 1 Score: 121.324 bits (303), Expect = 1.322e-31
Identity = 70/203 (34.48%), Postives = 110/203 (54.19%), Query Frame = 2
Query:  377 DPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIIS--KNSDELIAALQGHTVAINNTSL--VLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRE-----TIRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG-ENGILKPNYFVDVWDIKTKKKLF 955
            D ++ LSK M+  LRHG  + GL++    ++ V DLL    F  +T ED+E+VV TN K+R+++ S  +N    I A QGH++ + +  L  VL  S D    A HGT+  NW SI+ +GL +M R  IHL      E      +R   ++ + +DV  A+ DG+ FF+++N + L  G   G L P YF+    ++  + + 
Sbjct:   17 DRDVHLSKAMSYALRHGAKQLGLQMSTDGFLFVEDLLAHPQFCSYTVEDVERVVATNDKQRFKLRSHPENGRLQIRANQGHSIQVTDLELRPVLAGSADCPAEAVHGTYLRNWPSIQQHGLSRMNRTHIHLAPGLPGEDGIISGMRKNCDLAVFIDVPMALADGIEFFRSENGVYLTAGNAEGKLLPKYFIRTLRLRPTRSVL 219          
BLAST of tRNA 2'-phosphotransferase 1 vs. Planmine SMEST
Match: SMESG000068824.1 (SMESG000068824.1)

HSP 1 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 292/296 (98.65%), Postives = 294/296 (99.32%), Query Frame = 2
Query:  137 MIDKCEQEDLLKCLEGYFHKNNNESNKIEFQMIEDILKSDTFTNKVITVDDVIRAVHEDPDIRFSVRGFKIRPKPLELNNDPEIILSKKMAAILRHGLHRSGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSDELIAALQGHTVAINNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRETIRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEGENGILKPNYFVDVWDIKTKKKLFVNSKSQCEVTSPIPMYQRFCRMI 1024
            MIDKCEQEDLLKCLEGYFHKNNNESNK+EFQMIEDILKSD F NKVITVDDVIRAVHEDPDIRFSVRGFKIRPKPLELNNDPEIILSKKMAAILRHGLHRSGLEIH+GCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSDELIAALQGHTVAINNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRETIRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEGENGILKPNYFVDVWDIKTKKKLFVNSKSQCEVTSPIPMYQRFCRMI
Sbjct:    1 MIDKCEQEDLLKCLEGYFHKNNNESNKLEFQMIEDILKSDIFINKVITVDDVIRAVHEDPDIRFSVRGFKIRPKPLELNNDPEIILSKKMAAILRHGLHRSGLEIHSGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSDELIAALQGHTVAINNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKMGRDFIHLYTSESRETIRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEGENGILKPNYFVDVWDIKTKKKLFVNSKSQCEVTSPIPMYQRFCRMI 296          
The following BLAST results are available for this feature:
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPT12.911e-3132.43tRNA phosphotransferase 1 [Source:HGNC Symbol;Acc:... [more]
TRPT19.163e-3132.14tRNA phosphotransferase 1 [Source:HGNC Symbol;Acc:... [more]
TRPT11.291e-2531.89tRNA phosphotransferase 1 [Source:HGNC Symbol;Acc:... [more]
TRPT12.351e-2232.76tRNA phosphotransferase 1 [Source:HGNC Symbol;Acc:... [more]
TRPT11.428e-2032.74tRNA phosphotransferase 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG330573.596e-2832.84gene:FBgn0053057 transcript:FBtr0344802[more]
CG330573.596e-2832.84gene:FBgn0053057 transcript:FBtr0076678[more]
back to top
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trpt11.694e-3134.18tRNA phosphotransferase 1 [Source:NCBI gene;Acc:50... [more]
trpt13.768e-1533.62tRNA phosphotransferase 1 [Source:NCBI gene;Acc:50... [more]
back to top
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trio1.364e-3236.41trio Rho guanine nucleotide exchange factor [Sourc... [more]
trio8.373e-3235.64trio Rho guanine nucleotide exchange factor [Sourc... [more]
back to top
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Trpt13.292e-2932.56tRNA phosphotransferase 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of tRNA 2'-phosphotransferase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5EAR5|TRPT1_DANRE1.279e-3034.18tRNA 2'-phosphotransferase 1 OS=Danio rerio OX=795... [more]
sp|Q86TN4|TRPT1_HUMAN1.398e-3032.43tRNA 2'-phosphotransferase 1 OS=Homo sapiens OX=96... [more]
sp|Q8K3A2|TRPT1_MOUSE2.302e-2832.56tRNA 2'-phosphotransferase 1 OS=Mus musculus OX=10... [more]
sp|Q3ZBM7|TRPT1_BOVIN4.598e-2831.68tRNA 2'-phosphotransferase 1 OS=Bos taurus OX=9913... [more]
sp|Q8XP22|KPTA_CLOPE2.732e-2035.23Probable RNA 2'-phosphotransferase OS=Clostridium ... [more]
back to top
BLAST of tRNA 2'-phosphotransferase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KEL22.346e-5441.77Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4ECQ78.748e-5441.77Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A094ZM133.017e-5341.77tRNA 2'-phosphotransferase 1 OS=Schistosoma haemat... [more]
A0A430QE538.418e-5343.042'-phosphotransferase OS=Schistosoma bovis OX=6184... [more]
A0A4Z2D7984.929e-5238.03tRNA 2'-phosphotransferase 1 isoform 4 OS=Schistos... [more]
back to top
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trpt11.728e-3033.67tRNA phosphotransferase 1 [Source:NCBI gene;Acc:10... [more]
trpt15.693e-3033.67tRNA phosphotransferase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trpt16.479e-3132.16tRNA phosphotransferase 1 [Source:NCBI gene;Acc:50... [more]
back to top
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TPT12.192e-925.70tRNA 2'-phosphotransferase that catalyzes final st... [more]
back to top
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO484852.073e-2634.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tRNA 2'-phosphotransferase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trpt11.322e-3134.48tRNA phosphotransferase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of tRNA 2'-phosphotransferase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000068824.10.000e+098.65SMESG000068824.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006546 ID=SMED30006546|Name=tRNA 2'-phosphotransferase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1334bp
CCCACTTTTTAAATTTTACAGTTGAATCATCTTAACTATAACAACATTGA
TAATTTATAATTTAATTGAGTTCAAATTTATAATCTATATTTTATTTTTT
GTTTCATTTAATTACATCGATAGGTATTTTATTTTTATGATTGATAAGTG
TGAACAAGAAGATTTATTAAAATGTCTGGAAGGATATTTTCATAAAAATA
ACAATGAATCAAACAAGATTGAATTTCAAATGATAGAAGATATACTGAAA
AGTGACACATTTACTAACAAAGTAATTACAGTAGACGATGTAATCAGAGC
TGTTCACGAAGATCCTGATATTAGATTCAGTGTCAGAGGATTTAAAATCC
GACCAAAACCGTTGGAATTGAATAATGATCCAGAAATTATATTATCAAAA
AAAATGGCAGCTATTCTTCGGCATGGGTTACATAGGTCGGGCTTGGAAAT
ACACAATGGTTGTTATGTGAAGGTGAGTGACTTATTGAATCTATCCTCTT
TCCGAGAATTCACGAGAGAAGATATTGAAAAAGTCGTTAACACAAATGGG
AAGCGACGGTATGAAATAATAAGCAAAAATAGCGATGAATTAATTGCAGC
CCTCCAAGGCCACACTGTTGCAATCAACAATACCAGTCTCGTGCTTCTAA
GCTCTTGTGATGTAACCAAGCTTGCTTACCATGGTACATTTTATAGTAAT
TGGGAATCGATCAAAGCAAATGGACTCAAAAAAATGGGCAGGGATTTTAT
ACATCTATATACATCAGAATCACGAGAAACTATCCGGGATGGAGCGGAAA
TAGTGATAGAGGTGGATGTCGAACGAGCAATTAAAGATGGAATGCGGTTT
TTTAAAGCAAAGAATAATATACTTCTATGTGAAGGAGAAAATGGGATATT
AAAACCAAACTATTTCGTAGATGTGTGGGATATAAAAACTAAAAAAAAGT
TATTTGTCAACTCAAAATCTCAATGCGAAGTTACTTCTCCAATACCAATG
TATCAGCGATTCTGTCGAATGATTTAAACAAATTATTATTTTATGAAAAC
TATTCGGCACTTTCTACAAAAATAGAATGAAAATGTGATATGATATTTTA
TTGTGAATTTTTCTGAAATAATTTCCTTTGACCCTAGTCAAGACAAACTT
TTTCATTAATTTTGATTGTAATAGATTATTTTTCTAATTATATCGGACAC
AAAGTTTATTTATTTTTACCTTTACTATGCCTGGCATATATTTATATATT
TTATTGATTTATTTCCGCAATCAATCCACTCGATATCTTTTATTGATTAT
CGAATATTATTATAGTTTTATTTTATTATATTTC
back to top

protein sequence of SMED30006546-orf-1

>SMED30006546-orf-1 ID=SMED30006546-orf-1|Name=SMED30006546-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=297bp
MIDKCEQEDLLKCLEGYFHKNNNESNKIEFQMIEDILKSDTFTNKVITVD
DVIRAVHEDPDIRFSVRGFKIRPKPLELNNDPEIILSKKMAAILRHGLHR
SGLEIHNGCYVKVSDLLNLSSFREFTREDIEKVVNTNGKRRYEIISKNSD
ELIAALQGHTVAINNTSLVLLSSCDVTKLAYHGTFYSNWESIKANGLKKM
GRDFIHLYTSESRETIRDGAEIVIEVDVERAIKDGMRFFKAKNNILLCEG
ENGILKPNYFVDVWDIKTKKKLFVNSKSQCEVTSPIPMYQRFCRMI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042081RNA_2'-PTrans_C
IPR042080RNA_2'-PTrans_N
IPR012317Poly(ADP-ribose)pol_cat_dom
IPR002745Ptrans_KptA/Tpt1
Vocabulary: biological process
TermDefinition
GO:0006388tRNA splicing, via endonucleolytic cleavage and ligation
Vocabulary: molecular function
TermDefinition
GO:0016772transferase activity, transferring phosphorus-containing groups
GO:0003950NAD+ ADP-ribosyltransferase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002745Phosphotransferase KptA/Tpt1PFAMPF01885PTS_2-RNAcoord: 83..250
e-value: 5.5E-43
score: 147.1
IPR002745Phosphotransferase KptA/Tpt1PANTHERPTHR12684PUTATIVE PHOSPHOTRANSFERASEcoord: 79..268
IPR042081RNA 2'-phosphotransferase, C-terminal domainGENE3DG3DSA:3.20.170.30coord: 179..256
e-value: 1.6E-11
score: 45.9
IPR042080RNA 2'-phosphotransferase, N-terminal domainGENE3DG3DSA:1.10.10.970coord: 83..150
e-value: 2.4E-10
score: 42.5
NoneNo IPR availableSUPERFAMILYSSF56399ADP-ribosylationcoord: 86..252