ADP-ribosylation factor

Overview
NameADP-ribosylation factor
Smed IDSMED30006533
Length (bp)784
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ADP-ribosylation factor (SMED30006533) t-SNE clustered cells

Violin plots show distribution of expression levels for ADP-ribosylation factor (SMED30006533) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ADP-ribosylation factor (SMED30006533) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ADP-ribosylation factor (SMED30006533) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006533

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30006533SMESG000052764.1 SMESG000052762.1 SMESG000052759.1 SMESG000052750.1 SMESG000052741.1 SMESG000052739.1 SmedASXL_014866SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30006533SMESG000052764.1 SMESG000052762.1 SMESG000052759.1 SMESG000052750.1 SMESG000052741.1 SMESG000052739.1 dd_Smed_v4_3383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006533SMESG000052764.1 SMESG000052762.1 SMESG000052759.1 SMESG000052750.1 SMESG000052741.1 SMESG000052739.1 dd_Smed_v4_3383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006533SMESG000052764.1 SMESG000052762.1 SMESG000052759.1 SMESG000052750.1 SMESG000052741.1 SMESG000052739.1 dd_Smed_v4_3383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006533SMESG000052764.1 SMESG000052762.1 SMESG000052759.1 SMESG000052750.1 SMESG000052741.1 SMESG000052739.1 dd_Smed_v4_3383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006533SMESG000052764.1 SMESG000052762.1 SMESG000052759.1 SMESG000052750.1 SMESG000052741.1 SMESG000052739.1 Contig14931uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006533SMESG000052764.1 SMESG000052762.1 SMESG000052759.1 SMESG000052750.1 SMESG000052741.1 SMESG000052739.1 Contig14931newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006533SMESG000044682.1 SMESG000044677.1 Contig3899GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006533SMESG000052764.1 SMESG000052762.1 SMESG000052759.1 SMESG000052750.1 SMESG000052741.1 SMESG000052739.1 Contig3899GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30006533SMESG000052764.1 SMESG000052762.1 SMESG000052759.1 SMESG000052750.1 SMESG000052741.1 SMESG000052739.1 dd_Smed_v6_3383_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30006533SMESG000052764.1 SMESG000052762.1 SMESG000052759.1 SMESG000052750.1 SMESG000052741.1 SMESG000052739.1 Contig14931uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30006533SMESG000052764.1 SMESG000052762.1 SMESG000052759.1 SMESG000052750.1 SMESG000052741.1 SMESG000052739.1 Contig14931newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30006533SMESG000052764.1 SMESG000052762.1 SMESG000052759.1 SMESG000052750.1 SMESG000052741.1 SMESG000052739.1 dd_Smed_v4_3383_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30006533SMESG000052764.1 SMESG000052762.1 SMESG000052759.1 SMESG000052750.1 SMESG000052741.1 SMESG000052739.1 dd_Smed_v4_3383_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF3 (ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:HGNC:654])

HSP 1 Score: 204.527 bits (519), Expect = 5.443e-66
Identity = 107/180 (59.44%), Postives = 126/180 (70.00%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            LL  L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+      A  LKN K
Sbjct:    8 LLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWL----ANQLKNKK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF3 (ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:HGNC:654])

HSP 1 Score: 204.527 bits (519), Expect = 5.443e-66
Identity = 107/180 (59.44%), Postives = 126/180 (70.00%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            LL  L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+      A  LKN K
Sbjct:    8 LLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWL----ANQLKNKK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF1 (ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:HGNC:652])

HSP 1 Score: 202.986 bits (515), Expect = 2.218e-65
Identity = 99/155 (63.87%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF1 (ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:HGNC:652])

HSP 1 Score: 202.986 bits (515), Expect = 2.218e-65
Identity = 99/155 (63.87%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF1 (ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:HGNC:652])

HSP 1 Score: 202.986 bits (515), Expect = 2.218e-65
Identity = 99/155 (63.87%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-3 (ADP-Ribosylation Factor related; ADP-ribosylation factor related (20.5 kD) (Arf-3) [Source:UniProtKB/TrEMBL;Acc:G5EFK4])

HSP 1 Score: 204.142 bits (518), Expect = 2.501e-66
Identity = 100/166 (60.24%), Postives = 122/166 (73.49%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            L N L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER++ESR+EL  +   DE+R+  ++V ANKQDLPNAM+   + + L L  L+ + +WYIQA CA  G GLYE L+
Sbjct:    8 LFNRLFGKRQVRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDKERIEESREELHKMLNEDELRDATLLVFANKQDLPNAMTAAELTDKLGLHNLR-SRQWYIQATCATQGHGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 200.675 bits (509), Expect = 7.234e-65
Identity = 97/155 (62.58%), Postives = 117/155 (75.48%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLP AM+   + + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLR-NRSWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 200.675 bits (509), Expect = 7.234e-65
Identity = 97/155 (62.58%), Postives = 117/155 (75.48%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLP AM+   + + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLR-NRSWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 200.675 bits (509), Expect = 7.234e-65
Identity = 97/155 (62.58%), Postives = 117/155 (75.48%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLP AM+   + + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLR-NRSWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-6 (ADP-Ribosylation Factor related [Source:UniProtKB/TrEMBL;Acc:Q9U2S4])

HSP 1 Score: 184.111 bits (466), Expect = 1.916e-58
Identity = 91/166 (54.82%), Postives = 120/166 (72.29%), Query Frame = 3
Query:  174 KLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEAL 671
            K L+++      RILMLGLDAAGKTTILYKLKL ++VTTIPT+GFNVE V+  K +KF +WDVGGQ+KIR LW+HYYT    LI+V+D+ D +R+ E+R EL  I    EM+   I+V ANKQDL +AM P  I + L L++++  + WY+Q  CA +GDGL+E L
Sbjct:    3 KFLSKIFGKKELRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY-KNIKFNVWDVGGQDKIRPLWRHYYTGTQALIFVMDAADRDRVDEARMELHRIINDREMKEAIILVFANKQDLADAMKPHEIQDKLGLTRIRDRN-WYVQPSCASTGDGLHEGL 166          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0332054)

HSP 1 Score: 202.986 bits (515), Expect = 1.185e-65
Identity = 98/155 (63.23%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  +++ ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLR-NRNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0078573)

HSP 1 Score: 202.986 bits (515), Expect = 1.185e-65
Identity = 98/155 (63.23%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  +++ ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLR-NRNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0299906)

HSP 1 Score: 202.986 bits (515), Expect = 1.185e-65
Identity = 98/155 (63.23%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  +++ ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLR-NRNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0299907)

HSP 1 Score: 202.986 bits (515), Expect = 1.185e-65
Identity = 98/155 (63.23%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  +++ ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLR-NRNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0078571)

HSP 1 Score: 202.986 bits (515), Expect = 1.185e-65
Identity = 98/155 (63.23%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  +++ ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLR-NRNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf3b (ADP-ribosylation factor 3b [Source:ZFIN;Acc:ZDB-GENE-030616-356])

HSP 1 Score: 204.527 bits (519), Expect = 3.463e-66
Identity = 107/180 (59.44%), Postives = 126/180 (70.00%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            LL  L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+      A  LKN K
Sbjct:    8 LLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWL----ANQLKNKK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf3b (ADP-ribosylation factor 3b [Source:ZFIN;Acc:ZDB-GENE-030616-356])

HSP 1 Score: 204.527 bits (519), Expect = 3.463e-66
Identity = 107/180 (59.44%), Postives = 126/180 (70.00%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            LL  L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+      A  LKN K
Sbjct:    8 LLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWL----ANQLKNKK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf3a (ADP-ribosylation factor 3a [Source:ZFIN;Acc:ZDB-GENE-040801-176])

HSP 1 Score: 203.756 bits (517), Expect = 5.970e-66
Identity = 106/180 (58.89%), Postives = 126/180 (70.00%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            LL  L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  +++ ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+      A  LKN K
Sbjct:    8 LLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWL----ANQLKNKK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 202.986 bits (515), Expect = 1.411e-65
Identity = 105/180 (58.33%), Postives = 125/180 (69.44%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            L   L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+      +  LKN K
Sbjct:    8 LFKNLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWL----SNQLKNAK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 202.986 bits (515), Expect = 1.411e-65
Identity = 105/180 (58.33%), Postives = 125/180 (69.44%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            L   L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+      +  LKN K
Sbjct:    8 LFKNLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWL----SNQLKNAK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: dcaf7 (DDB1 and CUL4 associated factor 7 [Source:Xenbase;Acc:XB-GENE-973762])

HSP 1 Score: 214.157 bits (544), Expect = 1.015e-69
Identity = 104/184 (56.52%), Postives = 132/184 (71.74%), Query Frame = 3
Query:  168 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCKS 719
            LY++L     +   RI+MLGLDAAGKTT+LYKLK NET+TTIPTIGFNVE V   + + FT+WDVGGQ +IR LWKHY+TN  GL++VVDS D ER +E+R EL AI + +EMR VP VV+ANKQDLP A  P  + E L L K++  H W++Q CCA +GDGL E LE    L  ++ +N +S
Sbjct:    8 LYQILMGFHGTK-ARIIMLGLDAAGKTTVLYKLKFNETITTIPTIGFNVETVEPMRNVSFTVWDVGGQGRIRALWKHYFTNTDGLVFVVDSADCERFQEARLELEAILDAEEMRGVPFVVMANKQDLPGARRPMEVAEELGLPKIQ-GHPWHVQGCCAATGDGLVEGLEVFTNLVKQF-QNTRS 188          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: arf3 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:100145191])

HSP 1 Score: 204.527 bits (519), Expect = 4.934e-66
Identity = 107/180 (59.44%), Postives = 126/180 (70.00%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            LL  L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+      A  LKN K
Sbjct:    8 LLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWL----ANQLKNKK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: arf5 (ADP ribosylation factor 5 [Source:NCBI gene;Acc:394614])

HSP 1 Score: 202.986 bits (515), Expect = 2.078e-65
Identity = 99/155 (63.87%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: fibp (fibroblast growth factor (acidic) intracellular binding protein [Source:Xenbase;Acc:XB-GENE-481175])

HSP 1 Score: 202.216 bits (513), Expect = 4.217e-65
Identity = 99/155 (63.87%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:NCBI gene;Acc:595036])

HSP 1 Score: 194.512 bits (493), Expect = 3.601e-62
Identity = 96/166 (57.83%), Postives = 120/166 (72.29%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            L + L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER++E+ +EL  + + DE+R+  ++V ANKQDLPNAM+   + + L L  L+    WY+QA CA  G GLYE L+
Sbjct:    8 LFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMLQEDELRDAVLLVFANKQDLPNAMAISEMTDKLGLQNLR-NRTWYVQATCATQGTGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf3 (ADP-ribosylation factor 3 [Source:MGI Symbol;Acc:MGI:99432])

HSP 1 Score: 204.527 bits (519), Expect = 3.737e-66
Identity = 107/180 (59.44%), Postives = 126/180 (70.00%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            LL  L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+      A  LKN K
Sbjct:    8 LLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWL----ANQLKNKK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf1 (ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:MGI:99431])

HSP 1 Score: 202.986 bits (515), Expect = 1.523e-65
Identity = 99/155 (63.87%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf1 (ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:MGI:99431])

HSP 1 Score: 202.986 bits (515), Expect = 1.523e-65
Identity = 99/155 (63.87%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf2 (ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:MGI:99595])

HSP 1 Score: 202.986 bits (515), Expect = 1.698e-65
Identity = 101/167 (60.48%), Postives = 120/167 (71.86%), Query Frame = 3
Query:  174 KLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            KL   L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V  NKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:    7 KLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQ-RNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf2 (ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:MGI:99595])

HSP 1 Score: 202.986 bits (515), Expect = 1.698e-65
Identity = 101/167 (60.48%), Postives = 120/167 (71.86%), Query Frame = 3
Query:  174 KLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            KL   L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V  NKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:    7 KLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQ-RNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|P91924|ARF_DUGJA (ADP-ribosylation factor OS=Dugesia japonica OX=6161 PE=2 SV=3)

HSP 1 Score: 209.534 bits (532), Expect = 2.721e-67
Identity = 104/170 (61.18%), Postives = 125/170 (73.53%), Query Frame = 3
Query:  165 LLYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            L+  LL+ L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+P  I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:    4 LVTHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLR-NRSWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|P0CM16|ARF_CRYNJ (ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ARF PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 1.735e-66
Identity = 104/167 (62.28%), Postives = 123/167 (73.65%), Query Frame = 3
Query:  174 KLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            KLLN L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  G+I+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE LE
Sbjct:    7 KLLNGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRERITEAREELQRMLSEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQ-RSWYIQAACATSGDGLYEGLE 171          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|P0CM17|ARF_CRYNB (ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ARF PE=3 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 1.735e-66
Identity = 104/167 (62.28%), Postives = 123/167 (73.65%), Query Frame = 3
Query:  174 KLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            KLLN L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  G+I+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE LE
Sbjct:    7 KLLNGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRERITEAREELQRMLSEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQ-RSWYIQAACATSGDGLYEGLE 171          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|O48920|ARF_VIGUN (ADP-ribosylation factor OS=Vigna unguiculata OX=3917 GN=ARF PE=2 SV=3)

HSP 1 Score: 207.223 bits (526), Expect = 2.043e-66
Identity = 102/167 (61.08%), Postives = 123/167 (73.65%), Query Frame = 3
Query:  174 KLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            KL + L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND +R+ E+RDEL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+  H WYIQ+ CA SG+GLYE LE
Sbjct:    7 KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-WYIQSTCATSGEGLYEGLE 171          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|Q06396|ARF1_ORYSJ (ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0813400 PE=2 SV=3)

HSP 1 Score: 207.223 bits (526), Expect = 2.229e-66
Identity = 102/167 (61.08%), Postives = 123/167 (73.65%), Query Frame = 3
Query:  174 KLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            KL + L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+RDEL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+  H WYIQ+ CA SG+GLYE L+
Sbjct:    7 KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-WYIQSTCATSGEGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A1S3I8S2 (ADP-ribosylation factor OS=Lingula unguis OX=7574 GN=LOC106161789 PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.277e-77
Identity = 115/200 (57.50%), Postives = 148/200 (74.00%), Query Frame = 3
Query:  123 NLMQFKITINIQSFLLYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCKSF 722
             L+  KI   +Q F ++K        DP RILMLGLDAAGKTTILYK+KLNE V+TIPTIGFNVE VS  KGL FT+WDVGGQ+KIR LW+HYY N  GLIYVVDS+D ERL ES +ELF I E  EM+ VP+VVIANKQDLP A+S  ++++ L+L KL   +KW++QA CA + DG+YEA++   +L  ++ K+ +++
Sbjct:    2 GLLLSKIAQALQGFEMFK-------DDPARILMLGLDAAGKTTILYKVKLNENVSTIPTIGFNVETVSPCKGLSFTVWDVGGQDKIRPLWRHYYQNTEGLIYVVDSSDRERLAESSEELFGIMESPEMKGVPVVVIANKQDLPGALSAAQVIDKLQLRKLPRENKWHVQAACATTADGIYEAMDELARLVKDFKKHGRAY 194          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: K1RG92 (ADP-ribosylation factor 1 OS=Crassostrea gigas OX=29159 GN=CGI_10015931 PE=3 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 2.489e-76
Identity = 111/183 (60.66%), Postives = 137/183 (74.86%), Query Frame = 3
Query:  168 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            L  L    S   P RI+MLGLDAAGKTTILYK+KLNE V+TIPTIGFNVE VS  KG+ FT+WD+GGQ+KIR LWKHY+ N  GL+YVVDSND ER+ ESR+ELF I   DEMR VP+VVIANKQDLPNA+S  ++ + + L KL  + KWYIQA CA +G+G++EA++    +  EY K  +
Sbjct:    8 LKDLFETFSSGSPARIVMLGLDAAGKTTILYKIKLNEIVSTIPTIGFNVETVSPVKGVTFTVWDIGGQDKIRPLWKHYFNNTEGLVYVVDSNDRERILESREELFGILNSDEMRGVPVVVIANKQDLPNALSTSKVADLMSLHKLT-SRKWYIQAACATTGEGIFEAMKELSSMVKEYKKGMR 189          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A1S3I7L6 (ADP-ribosylation factor-like OS=Lingula unguis OX=7574 GN=LOC106161787 PE=3 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 2.294e-74
Identity = 111/192 (57.81%), Postives = 144/192 (75.00%), Query Frame = 3
Query:  162 FLLYKLLN-----ELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCKSF 722
            FLL KL       E+ + DP +ILMLGLDAAGKTTILY++KL++++TT+PTIGFNVE VS  KGL FT+WDVGGQEK R LWKHYY N  GLIYVVDS+D ERL E+R+ELF I E  EM+ VP+VVIANKQDLP A+S  +++E L+L  L   +KW++QA CA +  GLYEAL+   +L  ++  + +++
Sbjct:    3 FLLSKLAEALQGFEMFKDDPAKILMLGLDAAGKTTILYRVKLSDSITTLPTIGFNVETVSPCKGLTFTVWDVGGQEKFRHLWKHYYQNTQGLIYVVDSSDRERLDEAREELFGIMESPEMKGVPVVVIANKQDLPGALSTAQMIESLQLRMLPRENKWHVQAACAPTAQGLYEALDEMARLVKKFRNHNRAY 194          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A409V6R0 (Adp-ribosylation 1 factor (Fragment) OS=Mytilus galloprovincialis OX=29158 GN=AM593_07800 PE=3 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 5.770e-74
Identity = 110/181 (60.77%), Postives = 134/181 (74.03%), Query Frame = 3
Query:  168 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKN 710
            LY + +E S S P RILMLGLDAAGKTTILYK+KLNE+V TIPTIGFNVE VS  KG+ FT+WDVGGQEKIR LW+HYY N  GL+Y+VDSND ERL E++DEL  I   DEMR VP+VV+ANKQDLP +MSP  + +GL L K+    KWYI   CA + +G++E+++    L     KN
Sbjct:    8 LYDVFSEFSGSTPARILMLGLDAAGKTTILYKIKLNESVHTIPTIGFNVETVSPVKGVSFTVWDVGGQEKIRRLWQHYYQNTEGLVYIVDSNDKERLSEAKDELDGILNSDEMRGVPVVVVANKQDLPRSMSPSEVADGLGLPKMT-GRKWYIHGACATTCEGIFESMKEMANLVKNNKKN 187          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A210QTY7 (ADP-ribosylation factor 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10272 PE=3 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 6.802e-74
Identity = 108/181 (59.67%), Postives = 137/181 (75.69%), Query Frame = 3
Query:  168 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKN 710
            L  ++   S   P RILMLGLDAAGKTT+LYK+KLNE V TIPTIGFNVEEVS  KG+ FT+WDVGGQEKIR LW+HY+ N  GL++VVDSND ER+ E+R+ELF I + DEMR VP+VV+ANKQDLP AM+   I E + L+KL    KW++Q  CA++G+G+YE ++   +L+ E  KN
Sbjct:    8 LADVMQSFSSGSPSRILMLGLDAAGKTTVLYKIKLNENVCTIPTIGFNVEEVSPCKGVSFTVWDVGGQEKIRALWRHYFQNTEGLVFVVDSNDRERINEAREELFGILDNDEMRGVPVVVLANKQDLPYAMNTSDIAEKMCLTKL-TGRKWFVQGACAMTGEGIYEGMKEMARLTKENKKN 187          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf2a (ADP-ribosylation factor 1-like [Source:NCBI gene;Acc:103045652])

HSP 1 Score: 202.986 bits (515), Expect = 1.196e-65
Identity = 105/180 (58.33%), Postives = 125/180 (69.44%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            L   L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+      +  LKN K
Sbjct:    8 LFKNLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWL----SNQLKNAK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf1 (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103038497])

HSP 1 Score: 202.216 bits (513), Expect = 2.040e-65
Identity = 99/155 (63.87%), Postives = 117/155 (75.48%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R   ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   18 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELREAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLD 170          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf3a (ADP-ribosylation factor 3a [Source:ZFIN;Acc:ZDB-GENE-040801-176])

HSP 1 Score: 203.756 bits (517), Expect = 2.320e-65
Identity = 102/166 (61.45%), Postives = 121/166 (72.89%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            LL  L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   55 LLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLD 218          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf2b (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103047326])

HSP 1 Score: 201.83 bits (512), Expect = 3.920e-65
Identity = 100/166 (60.24%), Postives = 120/166 (72.29%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            L   L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  +++ ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:    8 LFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHALRH-RNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf2b (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103047326])

HSP 1 Score: 201.06 bits (510), Expect = 5.046e-65
Identity = 98/155 (63.23%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  +++ ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   12 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHALRH-RNWYIQATCATSGDGLYEGLD 164          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 206.838 bits (525), Expect = 8.109e-68
Identity = 102/167 (61.08%), Postives = 122/167 (73.05%), Query Frame = 3
Query:  174 KLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            +L + L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+RN  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:    7 RLFDTLVGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRNAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQ-RNWYIQATCATSGDGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf1 (ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GENE-010724-5])

HSP 1 Score: 205.297 bits (521), Expect = 3.031e-67
Identity = 101/169 (59.76%), Postives = 123/169 (72.78%), Query Frame = 3
Query:  168 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            L+ +  +L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:    4 LFSVFKDLLGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLD 170          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011118.1 (pep scaffold:Pmarinus_7.0:GL482736:15659:16189:-1 gene:ENSPMAG00000010091.1 transcript:ENSPMAT00000011118.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.815 bits (486), Expect = 5.092e-62
Identity = 94/166 (56.63%), Postives = 120/166 (72.29%), Query Frame = 3
Query:  174 KLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEAL 671
            K L+++  +   RILMLGLDAAGKTTILYKLKL + VTTIPT+GFNVE V+  K ++F +WDVGGQ+KIR LW+HYYT   GLI+VVD  D +R+ E+R EL  I    EMR+  I+V ANKQDL +AM P  + E L L++++    WY+Q  CA +GDGLYE L
Sbjct:    4 KFLSKMFGNKEMRILMLGLDAAGKTTILYKLKLGQPVTTIPTVGFNVETVTY-KNVRFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRVDEARQELHRIINDREMRDAIILVFANKQDLTDAMRPHEVQEKLGLTRVRD-RNWYVQPACASTGDGLYEGL 167          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 191.815 bits (486), Expect = 5.423e-62
Identity = 97/155 (62.58%), Postives = 116/155 (74.84%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA   V GDGLYE L+
Sbjct:   19 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR-HRNWYIQATPPV-GDGLYEGLD 170          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf4a (ADP-ribosylation factor 4a [Source:ZFIN;Acc:ZDB-GENE-040801-109])

HSP 1 Score: 184.496 bits (467), Expect = 4.300e-59
Identity = 91/169 (53.85%), Postives = 121/169 (71.60%), Query Frame = 3
Query:  168 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            + ++L  L  +   RILM+GLDAAGKTTILYKLKL E VTTIPT  FNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER++E+ +EL  + + D++++  ++V+ANKQDLPNAM+   + E L L  L+    W++QA CA  G GL E L+
Sbjct:    5 ISRVLAALLGTKAMRILMVGLDAAGKTTILYKLKLGEIVTTIPTTRFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMMQEDDLKDAALLVLANKQDLPNAMAIGELTEKLGLHGLR-NRAWFVQATCAPQGTGLCEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARF1 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated vesicle formation in intracellular trafficking within the Golgi; ARF1 has a paralog, ARF2, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002351])

HSP 1 Score: 195.282 bits (495), Expect = 1.777e-63
Identity = 95/167 (56.89%), Postives = 118/167 (70.66%), Query Frame = 3
Query:  174 KLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            KL + L  +   RILM+GLD AGKTT+LYKLKL E +TTIPTIGFNVE V   K + FT+WDVGGQ++IR LW+HYY N  G+I+VVDSND  R+ E+R+ +  +   DE+RN   +V ANKQDLP AMS   I E L L  ++    W+IQA CA SG+GLYE LE
Sbjct:    7 KLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQY-KNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSIR-NRPWFIQATCATSGEGLYEGLE 171          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARF2 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; ARF2 has a paralog, ARF1, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002296])

HSP 1 Score: 192.586 bits (488), Expect = 2.055e-62
Identity = 93/167 (55.69%), Postives = 118/167 (70.66%), Query Frame = 3
Query:  174 KLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            KL + L  +   RILM+GLD AGKTT+LYKLKL E +TTIPTIGFNVE V   K + FT+WDVGGQ++IR LW+HYY N  G+I+V+DSND  R+ E+R+ +  +   DE+RN   +V ANKQDLP AMS   I E L L  ++    W+IQ+ CA SG+GLYE LE
Sbjct:    7 KLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQY-KNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIR-NRPWFIQSTCATSGEGLYEGLE 171          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 165.622 bits (418), Expect = 8.382e-52
Identity = 83/168 (49.40%), Postives = 115/168 (68.45%), Query Frame = 3
Query:  168 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEAL 671
            + K+L +L  S   +ILMLGLD AGKTTILYKLKLN+  T+ PT+GFNVE V+  K +KF +WDVGGQ+++R LW+HY+     LI+V+DS+   R++E+++EL++I    EM NV ++V ANKQDL +AM P  + + LEL K      W +    A+SG GL E L
Sbjct:    5 ISKVLGKLFGSKEMKILMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTY-KNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGL 171          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARL1 (Soluble GTPase with a role in regulation of membrane traffic; regulates potassium influx; role in membrane organization at trans-Golgi network; required for delivery of Atg9p to the phagophore assembly site during autophagy under high temperature stress; required with Ypt6p for starvation-induced autophagy; required for the CVT pathway under non-starvation conditions; G protein of the Ras superfamily, similar to ADP-ribosylation factor [Source:SGD;Acc:S000000368])

HSP 1 Score: 146.747 bits (369), Expect = 1.500e-44
Identity = 73/155 (47.10%), Postives = 103/155 (66.45%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RIL+LGLD AGKTTILY+L++ E VTT PTIGFNVE +S  K LK  +WD+GGQ  IR  W+ YY +   +I+VVDS D +R+  +  EL  + + +E+++  ++V ANKQD P A+S   + + L L +LK    W I A  A+ G+G+ E L+
Sbjct:   20 RILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSY-KNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKD-RSWSIVASSAIKGEGITEGLD 172          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARL3 (ARF-like small GTPase of the RAS superfamily; required for recruitment of Arl1p, a GTPase that regulates membrane traffic, to the Golgi apparatus; NatC-catalyzed N-terminal acetylation regulates Golgi membrane association mediated by interaction with membrane receptor, Sys1p; similar to ADP-ribosylation factor and orthologous to mammalian ARFRP1 [Source:SGD;Acc:S000005972])

HSP 1 Score: 111.694 bits (278), Expect = 7.887e-31
Identity = 63/177 (35.59%), Postives = 97/177 (54.80%), Query Frame = 3
Query:  165 LLYKLLNELSQSDPKRILMLGLDAAGKTTIL------YKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGL-ELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            L+  L N  ++ +   IL+LGLD AGKTT L      Y L         PT+G NV  + +        WDVGGQE +R +W  YY+ CHG+I++VDS+D ERL E    L ++   +E+  VPI+++ANKQD  + M    I E   ++++        +    A++G+G+ +A+E
Sbjct:    4 LVKGLYNNWNKKEQYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQILKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMDEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDSRVLPISALTGEGVKDAIE 180          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO42156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S214])

HSP 1 Score: 205.297 bits (521), Expect = 4.682e-67
Identity = 108/184 (58.70%), Postives = 131/184 (71.20%), Query Frame = 3
Query:  165 LLYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            +  KL   L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+   +WYIQA CA SGDGLYE L+    LS++ LKN K
Sbjct:    4 MFAKLFAGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELNRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR-NRQWYIQATCATSGDGLYEGLDW---LSSQ-LKNAK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO48359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJD9])

HSP 1 Score: 201.83 bits (512), Expect = 1.103e-65
Identity = 99/166 (59.64%), Postives = 121/166 (72.89%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            L   L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLIYVVDSND ER+ ES++EL  + + DE+++  ++V+ANKQDLPNA+S   I E L L  ++   +WYIQA CA  G GLYE L+
Sbjct:    8 LFTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERVNESKEELNKMLQEDELKDAVVLVMANKQDLPNALSVSEITEKLGLQSIRD-RQWYIQAACATQGTGLYEGLD 171          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO38139 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDV1])

HSP 1 Score: 202.216 bits (513), Expect = 1.213e-65
Identity = 96/181 (53.04%), Postives = 126/181 (69.61%), Query Frame = 3
Query:  159 SFLLYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEY 701
              +L ++L   S +   RILMLGLDAAGKTTILYKLKL ETV T+PT+ FNVE +S  K + F++WD+GGQ+KIR LW+HY+    G+I+VVDS D ER+ E R+EL  + +  E+  VP+VV+ANKQDL  A+ PD++ E L L K    + W IQ  CA +GDGLYEA+EA  K+   Y
Sbjct:    2 GLVLSRILKLFSGNQKVRILMLGLDAAGKTTILYKLKLKETVNTVPTVAFNVETISPCKNITFSVWDIGGQDKIRRLWRHYFQGAEGIIFVVDSADKERIFEVREELTRVLQHSELNGVPVVVVANKQDLLGAIGPDKMAEELSLYK-HTKNPWRIQGTCATAGDGLYEAMEALAKMVKAY 181          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO48360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJE1])

HSP 1 Score: 201.445 bits (511), Expect = 3.759e-65
Identity = 102/175 (58.29%), Postives = 126/175 (72.00%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE-AAGKLSAE 698
            L   L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLIYVVDSND ER+ ES++EL  + + DE+++  ++V+ANKQDLPNA+S   I E L L  ++   +WYIQA CA  G GLYE L+  + +LS E
Sbjct:    8 LFTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERVNESKEELNKMLQEDELKDAVVLVMANKQDLPNALSVSEITEKLGLQSIRD-RQWYIQAACATQGTGLYEGLDWLSNELSKE 180          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO40902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S615])

HSP 1 Score: 193.356 bits (490), Expect = 2.405e-62
Identity = 93/167 (55.69%), Postives = 125/167 (74.85%), Query Frame = 3
Query:  174 KLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            KLL+++  +   RILMLGLDAAGKTTILYKLKL ++VTTIPT+GFNVE V+  K +KF +WDVGGQ+KIR LW+HY+    GLI+VVD  D +R+ E+R EL  I    EM++V I++ ANKQDLP+AM P  I E + L++++  + WY+Q  CA +GDGLY+ L+
Sbjct:    3 KLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTFQK-VKFNVWDVGGQDKIRPLWRHYFAGSQGLIFVVDCADRDRIDEARKELQRIINDREMKDVIILIFANKQDLPDAMKPHEIQEKMGLTRIRDRN-WYVQPSCATTGDGLYDGLK 167          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000042909.1 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:101170343])

HSP 1 Score: 204.527 bits (519), Expect = 2.916e-66
Identity = 107/180 (59.44%), Postives = 126/180 (70.00%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            LL  L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+      A  LKN K
Sbjct:    8 LLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWL----ANQLKNKK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: arf3b (ADP-ribosylation factor 3 [Source:NCBI gene;Acc:101174416])

HSP 1 Score: 204.527 bits (519), Expect = 2.916e-66
Identity = 107/180 (59.44%), Postives = 126/180 (70.00%), Query Frame = 3
Query:  177 LLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCK 716
            LL  L      RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+      A  LKN K
Sbjct:    8 LLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWL----ANQLKNKK 181          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000030860.1 (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:101167961])

HSP 1 Score: 200.675 bits (509), Expect = 7.995e-65
Identity = 98/155 (63.23%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+++EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   18 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEF-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAKEELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLCLHSLRH-RNWYIQATCATSGDGLYEGLD 170          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: arf2b (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:101155726])

HSP 1 Score: 201.06 bits (510), Expect = 1.577e-64
Identity = 99/155 (63.87%), Postives = 118/155 (76.13%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER+ E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   I + L L  L+    WYIQA CA SGDGLYE L+
Sbjct:   47 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELSRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHALRQ-RSWYIQATCATSGDGLYEGLD 199          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000005690.2 (ADP ribosylation factor 1 [Source:NCBI gene;Acc:101175109])

HSP 1 Score: 199.904 bits (507), Expect = 1.698e-64
Identity = 97/155 (62.58%), Postives = 117/155 (75.48%), Query Frame = 3
Query:  210 RILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALE 674
            RILM+GLDAAGKTTILYKLKL E VTTIPTIGFNVE V   K + FT+WDVGGQ+KIR LW+HY+ N  GLI+VVDSND ER  E+R+EL  +   DE+R+  ++V ANKQDLPNAM+   + + L L  L+    WYIQA CA +GDGLYE L+
Sbjct:   14 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERCGEAREELLRMLAEDELRDAVLLVFANKQDLPNAMNAAELTDKLNLHSLR-NRNWYIQATCATTGDGLYEGLD 166          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052759.1 (SMESG000052759.1)

HSP 1 Score: 385.956 bits (990), Expect = 7.131e-138
Identity = 186/186 (100.00%), Postives = 186/186 (100.00%), Query Frame = 3
Query:  168 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCKSFR 725
            LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCKSFR
Sbjct:    8 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCKSFR 193          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052764.1 (SMESG000052764.1)

HSP 1 Score: 384.03 bits (985), Expect = 4.076e-137
Identity = 185/186 (99.46%), Postives = 186/186 (100.00%), Query Frame = 3
Query:  168 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCKSFR 725
            LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLK+CKSFR
Sbjct:    8 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKDCKSFR 193          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052739.1 (SMESG000052739.1)

HSP 1 Score: 380.563 bits (976), Expect = 1.046e-135
Identity = 183/186 (98.39%), Postives = 185/186 (99.46%), Query Frame = 3
Query:  168 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCKSFR 725
            LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSP RIVEGLELSKLKPTHKW+IQACCAVSGDGLYEALEAAGKLSAEYLK+CKSFR
Sbjct:    8 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPSRIVEGLELSKLKPTHKWHIQACCAVSGDGLYEALEAAGKLSAEYLKDCKSFR 193          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052741.1 (SMESG000052741.1)

HSP 1 Score: 377.867 bits (969), Expect = 1.302e-134
Identity = 181/186 (97.31%), Postives = 185/186 (99.46%), Query Frame = 3
Query:  168 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCKSFR 725
            LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSP RIVEGLELSKLKPTHKW+IQACCAVSGDGLY+ALE+AGKLSAEYLK+CKSFR
Sbjct:    8 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPSRIVEGLELSKLKPTHKWHIQACCAVSGDGLYKALESAGKLSAEYLKDCKSFR 193          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052762.1 (SMESG000052762.1)

HSP 1 Score: 377.096 bits (967), Expect = 3.128e-134
Identity = 181/186 (97.31%), Postives = 184/186 (98.92%), Query Frame = 3
Query:  168 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCKSFR 725
            LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQ +IRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSP RIVEGLELSKLKPTHKW+IQACCAVSGDGLYEALEAAGKLSAEYLK+CKSFR
Sbjct:    8 LYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQGRIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPSRIVEGLELSKLKPTHKWHIQACCAVSGDGLYEALEAAGKLSAEYLKDCKSFR 193          
The following BLAST results are available for this feature:
BLAST of ADP-ribosylation factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARF35.443e-6659.44ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:... [more]
ARF35.443e-6659.44ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:... [more]
ARF12.218e-6563.87ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:... [more]
ARF12.218e-6563.87ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:... [more]
ARF12.218e-6563.87ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf-32.501e-6660.24ADP-Ribosylation Factor related; ADP-ribosylation ... [more]
arf-1.27.234e-6562.58ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.27.234e-6562.58ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.27.234e-6562.58ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-61.916e-5854.82ADP-Ribosylation Factor related [Source:UniProtKB... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arf79F1.185e-6563.23gene:FBgn0010348 transcript:FBtr0332054[more]
Arf79F1.185e-6563.23gene:FBgn0010348 transcript:FBtr0078573[more]
Arf79F1.185e-6563.23gene:FBgn0010348 transcript:FBtr0299906[more]
Arf79F1.185e-6563.23gene:FBgn0010348 transcript:FBtr0299907[more]
Arf79F1.185e-6563.23gene:FBgn0010348 transcript:FBtr0078571[more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf3b3.463e-6659.44ADP-ribosylation factor 3b [Source:ZFIN;Acc:ZDB-GE... [more]
arf3b3.463e-6659.44ADP-ribosylation factor 3b [Source:ZFIN;Acc:ZDB-GE... [more]
arf3a5.970e-6658.89ADP-ribosylation factor 3a [Source:ZFIN;Acc:ZDB-GE... [more]
arf2a1.411e-6558.33ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
arf2a1.411e-6558.33ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcaf71.015e-6956.52DDB1 and CUL4 associated factor 7 [Source:Xenbase;... [more]
arf34.934e-6659.44ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
arf52.078e-6563.87ADP ribosylation factor 5 [Source:NCBI gene;Acc:39... [more]
fibp4.217e-6563.87fibroblast growth factor (acidic) intracellular bi... [more]
arf43.601e-6257.83ADP ribosylation factor 4 [Source:NCBI gene;Acc:59... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arf33.737e-6659.44ADP-ribosylation factor 3 [Source:MGI Symbol;Acc:M... [more]
Arf11.523e-6563.87ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:M... [more]
Arf11.523e-6563.87ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:M... [more]
Arf21.698e-6560.48ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:M... [more]
Arf21.698e-6560.48ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P91924|ARF_DUGJA2.721e-6761.18ADP-ribosylation factor OS=Dugesia japonica OX=616... [more]
sp|P0CM16|ARF_CRYNJ1.735e-6662.28ADP-ribosylation factor OS=Cryptococcus neoformans... [more]
sp|P0CM17|ARF_CRYNB1.735e-6662.28ADP-ribosylation factor OS=Cryptococcus neoformans... [more]
sp|O48920|ARF_VIGUN2.043e-6661.08ADP-ribosylation factor OS=Vigna unguiculata OX=39... [more]
sp|Q06396|ARF1_ORYSJ2.229e-6661.08ADP-ribosylation factor 1 OS=Oryza sativa subsp. j... [more]
back to top
BLAST of ADP-ribosylation factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3I8S23.277e-7757.50ADP-ribosylation factor OS=Lingula unguis OX=7574 ... [more]
K1RG922.489e-7660.66ADP-ribosylation factor 1 OS=Crassostrea gigas OX=... [more]
A0A1S3I7L62.294e-7457.81ADP-ribosylation factor-like OS=Lingula unguis OX=... [more]
A0A409V6R05.770e-7460.77Adp-ribosylation 1 factor (Fragment) OS=Mytilus ga... [more]
A0A210QTY76.802e-7459.67ADP-ribosylation factor 3 OS=Mizuhopecten yessoens... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf2a1.196e-6558.33ADP-ribosylation factor 1-like [Source:NCBI gene;A... [more]
arf12.040e-6563.87ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
arf3a2.320e-6561.45ADP-ribosylation factor 3a [Source:ZFIN;Acc:ZDB-GE... [more]
arf2b3.920e-6560.24ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
arf2b5.046e-6563.23ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf2a8.109e-6861.08ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
arf13.031e-6759.76ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000011118.15.092e-6256.63pep scaffold:Pmarinus_7.0:GL482736:15659:16189:-1 ... [more]
arf2a5.423e-6262.58ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
arf4a4.300e-5953.85ADP-ribosylation factor 4a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ARF11.777e-6356.89ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF22.055e-6255.69ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF38.382e-5249.40Glucose-repressible ADP-ribosylation factor; GTPas... [more]
ARL11.500e-4447.10Soluble GTPase with a role in regulation of membra... [more]
ARL37.887e-3135.59ARF-like small GTPase of the RAS superfamily; requ... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO421564.682e-6758.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483591.103e-6559.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381391.213e-6553.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483603.759e-6558.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409022.405e-6255.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000042909.12.916e-6659.44ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
arf3b2.916e-6659.44ADP-ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000030860.17.995e-6563.23ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
arf2b1.577e-6463.87ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000005690.21.698e-6462.58ADP ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052759.17.131e-138100.00SMESG000052759.1[more]
SMESG000052764.14.076e-13799.46SMESG000052764.1[more]
SMESG000052739.11.046e-13598.39SMESG000052739.1[more]
SMESG000052741.11.302e-13497.31SMESG000052741.1[more]
SMESG000052762.13.128e-13497.31SMESG000052762.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006533 ID=SMED30006533|Name=ADP-ribosylation factor|organism=Schmidtea mediterranea sexual|type=transcript|length=784bp
ATTCTACATATATCGTTTAGGTCTGTAATAGTTTGGCATCAATTATTCCG
AATAACCAATAAGAAAAGTTTAAATTTTGTTACTATTTTTAGAAACGGCT
TGTCATTCAATCCACGCTGGAGAATTTGATGCAATTCAAAATCACTATAA
ATATTCAATCTTTTCTATTATACAAATTATTAAACGAGTTGTCTCAATCT
GATCCTAAGAGAATCCTAATGTTGGGATTGGATGCTGCTGGTAAAACAAC
AATTCTATACAAATTGAAACTCAATGAAACTGTGACAACGATTCCAACAA
TCGGATTCAATGTGGAGGAAGTTTCAATAGGTAAAGGTTTGAAATTCACA
ATTTGGGATGTCGGAGGTCAAGAAAAGATTCGGTTGTTATGGAAACATTA
CTATACGAATTGCCATGGATTGATTTATGTGGTCGACAGCAATGACGCGG
AAAGGTTGAAGGAATCAAGAGATGAATTATTTGCGATTGCAGAATGTGAC
GAGATGAGAAATGTTCCAATAGTGGTGATTGCAAACAAGCAAGATTTACC
GAATGCAATGTCACCAGACAGAATTGTGGAAGGGTTGGAACTATCGAAAC
TGAAGCCGACTCACAAATGGTACATTCAGGCGTGTTGTGCAGTTTCCGGT
GACGGACTGTACGAGGCATTGGAAGCGGCAGGGAAATTATCAGCAGAATA
CTTGAAGAATTGTAAATCATTTCGGTAGATTGTTGGAAAGGTTTTCTGAA
GAGAGATTGCGAGAGTTATTTTCAATAAAATTAT
back to top

protein sequence of SMED30006533-orf-1

>SMED30006533-orf-1 ID=SMED30006533-orf-1|Name=SMED30006533-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=200bp
MQFKITINIQSFLLYKLLNELSQSDPKRILMLGLDAAGKTTILYKLKLNE
TVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIY
VVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIV
EGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEYLKNCKSFR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000421tail
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR006689Small_GTPase_ARF/SAR
IPR027417P-loop_NTPase
IPR024156Small_GTPase_ARF
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006689Small GTPase superfamily, ARF/SAR typePRINTSPR00328SAR1GTPBPcoord: 84..109
score: 40.05
coord: 28..51
score: 56.37
coord: 129..150
score: 40.91
IPR006689Small GTPase superfamily, ARF/SAR typePFAMPF00025Arfcoord: 16..182
e-value: 3.1E-66
score: 222.1
NoneNo IPR availableSMARTSM00177arf_sub_2coord: 10..196
e-value: 1.1E-76
score: 270.7
NoneNo IPR availableSMARTSM00178sar_sub_1coord: 13..192
e-value: 4.2E-25
score: 99.4
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 28..190
e-value: 2.7E-4
score: -56.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 27..186
e-value: 2.6E-63
score: 214.5
NoneNo IPR availablePANTHERPTHR11711:SF331coord: 14..193
NoneNo IPR availablePANTHERPTHR11711ADP RIBOSYLATION FACTOR-RELATEDcoord: 14..193
NoneNo IPR availablePROSITEPS51417ARFcoord: 20..192
score: 21.643
NoneNo IPR availableCDDcd00878Arf_Arlcoord: 28..182
e-value: 1.02392E-87
score: 252.883
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 26..150
e-value: 9.0E-24
score: 82.1
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 26..186