Phosphatase, orphan 1

Overview
NamePhosphatase, orphan 1
Smed IDSMED30006531
Length (bp)926
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatase, orphan 1 (SMED30006531) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatase, orphan 1 (SMED30006531) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatase, orphan 1 (SMED30006531) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatase, orphan 1 (SMED30006531) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006531

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006531h1SMcG0003383 SmedASXL_013347SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatase, orphan 1 vs. Ensembl Human
Match: PHOSPHO1 (phosphoethanolamine/phosphocholine phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:16815])

HSP 1 Score: 68.9366 bits (167), Expect = 6.436e-13
Identity = 50/198 (25.25%), Postives = 87/198 (43.94%), Query Frame = 3
Query:   15 RMSCK--RKHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLC 593
            RM+ +   + L  FDFD T++ E SD  I      +    SL         +  +++ V+K +   G   RD   +  ++    GM    +F+ K  +  ++ +ISDAN + + + L  +   ++  F+ I+SN    D  G     P    S   C  CP  +CK  V+   L+    +  +++ + Y GDG  D C
Sbjct:   18 RMAAQGAPRFLLTFDFDETIVDENSDDSIVRAAPGQRLPESLRATYREGF-YNEYMQRVFKYLGEQGVRPRDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSL--RAAGHHSLFRRILSNPSGPDARGLLALRPFHTHS---CARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFC 209          
BLAST of Phosphatase, orphan 1 vs. Ensembl Human
Match: PHOSPHO1 (phosphoethanolamine/phosphocholine phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:16815])

HSP 1 Score: 68.9366 bits (167), Expect = 1.038e-12
Identity = 50/198 (25.25%), Postives = 87/198 (43.94%), Query Frame = 3
Query:   15 RMSCK--RKHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLC 593
            RM+ +   + L  FDFD T++ E SD  I      +    SL         +  +++ V+K +   G   RD   +  ++    GM    +F+ K  +  ++ +ISDAN + + + L  +   ++  F+ I+SN    D  G     P    S   C  CP  +CK  V+   L+    +  +++ + Y GDG  D C
Sbjct:   43 RMAAQGAPRFLLTFDFDETIVDENSDDSIVRAAPGQRLPESLRATYREGF-YNEYMQRVFKYLGEQGVRPRDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSL--RAAGHHSLFRRILSNPSGPDARGLLALRPFHTHS---CARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFC 234          
BLAST of Phosphatase, orphan 1 vs. Ensembl Human
Match: PHOSPHO1 (phosphoethanolamine/phosphocholine phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:16815])

HSP 1 Score: 68.9366 bits (167), Expect = 1.038e-12
Identity = 50/198 (25.25%), Postives = 87/198 (43.94%), Query Frame = 3
Query:   15 RMSCK--RKHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLC 593
            RM+ +   + L  FDFD T++ E SD  I      +    SL         +  +++ V+K +   G   RD   +  ++    GM    +F+ K  +  ++ +ISDAN + + + L  +   ++  F+ I+SN    D  G     P    S   C  CP  +CK  V+   L+    +  +++ + Y GDG  D C
Sbjct:   43 RMAAQGAPRFLLTFDFDETIVDENSDDSIVRAAPGQRLPESLRATYREGF-YNEYMQRVFKYLGEQGVRPRDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSL--RAAGHHSLFRRILSNPSGPDARGLLALRPFHTHS---CARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFC 234          
BLAST of Phosphatase, orphan 1 vs. Ensembl Human
Match: PHOSPHO2 (phosphatase, orphan 2 [Source:HGNC Symbol;Acc:HGNC:28316])

HSP 1 Score: 67.781 bits (164), Expect = 1.237e-12
Identity = 68/247 (27.53%), Postives = 99/247 (40.08%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDR---FLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRN----VGNLKEYSHLITNKCIEVFIWDNGQELIDYFEKL 752
            K L  FDFD T+I + SD  I     NK+    L +       W   +  V+K +   G  E + +  + S+ F  GM     F+ K K   D  IISD+N   I  +LE    +++  F  + +N   F+  G    E     S   C  CP  LCK +V+   +        NY  I Y GDG  D+C    L        VA  R        L   S  +      V +W +G ++I + + L
Sbjct:    2 KILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGF-WTEFMGRVFKYLGDKGVREHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAA--SFHDIFDKVFTNPAAFNSNGHLTVENYHTHS---CNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDGGNDVCPVTFL----KNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDIISHLQFL 238          
BLAST of Phosphatase, orphan 1 vs. Ensembl Human
Match: PHOSPHO2 (phosphatase, orphan 2 [Source:HGNC Symbol;Acc:HGNC:28316])

HSP 1 Score: 67.781 bits (164), Expect = 1.237e-12
Identity = 68/247 (27.53%), Postives = 99/247 (40.08%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDR---FLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRN----VGNLKEYSHLITNKCIEVFIWDNGQELIDYFEKL 752
            K L  FDFD T+I + SD  I     NK+    L +       W   +  V+K +   G  E + +  + S+ F  GM     F+ K K   D  IISD+N   I  +LE    +++  F  + +N   F+  G    E     S   C  CP  LCK +V+   +        NY  I Y GDG  D+C    L        VA  R        L   S  +      V +W +G ++I + + L
Sbjct:    2 KILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGF-WTEFMGRVFKYLGDKGVREHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAA--SFHDIFDKVFTNPAAFNSNGHLTVENYHTHS---CNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDGGNDVCPVTFL----KNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDIISHLQFL 238          
BLAST of Phosphatase, orphan 1 vs. Ensembl Fly
Match: CG12237 (gene:FBgn0031048 transcript:FBtr0074761)

HSP 1 Score: 81.6481 bits (200), Expect = 1.989e-17
Identity = 70/244 (28.69%), Postives = 112/244 (45.90%), Query Frame = 3
Query:   48 FDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFL--LKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKS--ILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVGNLKEYSHLITNKC-----IEVFIWDNGQELIDYFEKL 752
            FDFD T++ + +D V+R L+   E  S+ VN+L  +  W  ++ EV++ +H    SE   R+ +R +  V G  R +  L  + + D+ IISD+N   I   L     N    F  I +N   FD  G+          Q  C +    LCKG V++   I ++   +I  Y  + Y GDG  D+C  L           AC R    +++  HL+ N+       ++ IW +G +L+D    L
Sbjct:   32 FDFDHTIVSQNTDTVVRDLLPT-EVTSAKVNELVENDCWTEYMAEVFRLLHEQQVSEARIRDTIRGIPEVPGFVRLIKHLAKRLHYDLIIISDSNSVFIDEWLRAH--NLADCFVAIFTNPAEFDASGRLMVRAHH--QQSDCKLSASNLCKGRVLEHFVIEQDLRRSI-RYDHVFYVGDGNNDICPVLR----QRACDFACARKGFAMEK--HLLRNRSKLKLRAQLLIWKSGFDLMDQMLAL 263          
BLAST of Phosphatase, orphan 1 vs. Ensembl Fly
Match: CG14212 (gene:FBgn0031045 transcript:FBtr0074742)

HSP 1 Score: 64.3142 bits (155), Expect = 1.200e-11
Identity = 62/238 (26.05%), Postives = 102/238 (42.86%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSD-GYSERDFRNVMRSVKFVDGMDRFL--LKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVGNL--KEYSHLITNKCIEVFIWDNGQEL 731
            + L   DFD T++++ S   +  L+   ++   L +++     W+S + +V + +H +   +       +RS+  V GM R +  L      ++ I+SDAN + I   L+   I    +   + +N       G+    P  +  Q  C +CP  +CKG V+  +     T    Y+ + Y GD   DLC    L      K VACIR    L  K  +H     C  V  W +G EL
Sbjct:   30 RTLVAIDFDRTIVEQDSYLAVSQLLPTSQR-KELQDQIP-KCGWLSFISQVLQRLHGEHKVNSASVGKRVRSLTAVPGMLRVMRQLARIPELELCIVSDANSFFIGEWLQAYAIEC-LFAGGVFTNPACVQASGELLVLPYQE--QTDCDLCPSNMCKGSVMDEL-----TCSGRYERLIYVGDSCNDLCAIKRL----RQKDVACIRRGFELHGKMTAHGQELAC-SVLTWRDGHEL 252          
BLAST of Phosphatase, orphan 1 vs. Ensembl Zebrafish
Match: phospho2 (phosphatase, orphan 2 [Source:ZFIN;Acc:ZDB-GENE-080204-104])

HSP 1 Score: 71.633 bits (174), Expect = 3.356e-14
Identity = 60/196 (30.61%), Postives = 81/196 (41.33%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSD-YVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDR---FLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNL 608
            K L  FDFD T++ E SD +VIR      +K+   + K      W  ++  V   I          R VM S+ F DGM     F+ + K + D  IISD+N   I   L+   +       D+ SN    D  G      CF      C  CP  LCK  V++   +N   +   Y+ I Y GDG  D C    L
Sbjct:    2 KTLVVFDFDHTIVDENSDTWVIR--CTPDQKLPDWLEKSYQRGRWTEYMGRVLTYIGDQSVRPEHMRAVMESIPFTDGMTELLTFISENKKHIDCIIISDSNTLFIDWALQASGLKSA--VDDVFSNPANIDARGYVSLR-CFHAHA--CKECPVNLCKRRVLRDFTENRAKDGLRYERICYIGDGGNDFCPVKEL 190          
BLAST of Phosphatase, orphan 1 vs. Ensembl Zebrafish
Match: phospho1 (phosphoethanolamine/phosphocholine phosphatase 1 [Source:NCBI gene;Acc:100002812])

HSP 1 Score: 65.0846 bits (157), Expect = 1.018e-11
Identity = 54/203 (26.60%), Postives = 82/203 (40.39%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSD-----YVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLLKYKSNT-DMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKN--YETNINNYKTIAYFGDGFGDLCGCLNL 608
            + L FFDFD TL+ E SD         G++    K +    + N       +++ V   +   G +    R  +  +    G+     FLL   S   ++  +SDAN   I T L  Q + +   F  I +N   FD  G  +  P       +C  CP  +CK +VV+  +     E     Y+ + Y GDG  D C  L L
Sbjct:   35 RFLMFFDFDETLVDECSDDSMVSAAPGGVLPGWLKDTYRPGRYN------EYMQRVLAYLSEQGVTPAAIRATVEKLPPCPGIPALMHFLLSQPSRDFEVVCVSDANTVFIETWL--QYMGFQPLFLRIFTNPAHFDDNGVLQLRPFHS---HECLRCPANMCKAVVVRQYVAQRIRERGGRPYQKVLYMGDGANDFCPSLTL 226          
BLAST of Phosphatase, orphan 1 vs. Ensembl Zebrafish
Match: phospho1 (phosphoethanolamine/phosphocholine phosphatase 1 [Source:NCBI gene;Acc:100002812])

HSP 1 Score: 65.0846 bits (157), Expect = 1.018e-11
Identity = 54/203 (26.60%), Postives = 82/203 (40.39%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSD-----YVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLLKYKSNT-DMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKN--YETNINNYKTIAYFGDGFGDLCGCLNL 608
            + L FFDFD TL+ E SD         G++    K +    + N       +++ V   +   G +    R  +  +    G+     FLL   S   ++  +SDAN   I T L  Q + +   F  I +N   FD  G  +  P       +C  CP  +CK +VV+  +     E     Y+ + Y GDG  D C  L L
Sbjct:   35 RFLMFFDFDETLVDECSDDSMVSAAPGGVLPGWLKDTYRPGRYN------EYMQRVLAYLSEQGVTPAAIRATVEKLPPCPGIPALMHFLLSQPSRDFEVVCVSDANTVFIETWL--QYMGFQPLFLRIFTNPAHFDDNGVLQLRPFHS---HECLRCPANMCKAVVVRQYVAQRIRERGGRPYQKVLYMGDGANDFCPSLTL 226          
BLAST of Phosphatase, orphan 1 vs. Ensembl Xenopus
Match: PHOSPHO1 (phosphatase, orphan 1 [Source:NCBI gene;Acc:100492656])

HSP 1 Score: 80.4925 bits (197), Expect = 3.458e-17
Identity = 66/251 (26.29%), Postives = 109/251 (43.43%), Query Frame = 3
Query:   18 MSCKRKHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVGNLKEYSHLITNKCI---EVFIWDNGQELIDYFEKL 752
            M+   K+L  FDFD T++ E SD  +     N+E    L N +  D  +  ++++V K +   G    D R+V   +    GM    RFL+K +   ++ +ISDAN++ I + L+     ++  F  +ISN    +  G    EP    +   C  CP  +CK  +V   L     +   ++ + Y GDG  D C  + L        VA  R    + +       K     +V  WD+   + DY ++L
Sbjct:    1 MASSLKYLLIFDFDETIVNENSDDCVIQAAPNQELPDWLGNTIQ-DGFYYQYMQKVLKYLGDQGVKLADIRSVYERIPLSPGMPDLFRFLMKKQDRFEIILISDANVFGIESFLKAH--GFHSLFLKVISNHTKVEKNGYLSLEPYHAHT---CPKCPASMCKRKIVTEYLAERSKDGVAFEKVMYVGDGANDFCPSVVL----TSTDVAFSRKNYPMHQLIQKEQQKGTFQAKVVPWDSADIVRDYLQEL 241          
BLAST of Phosphatase, orphan 1 vs. Ensembl Xenopus
Match: cdh10 (cadherin 10, type 2 (T2-cadherin) [Source:Xenbase;Acc:XB-GENE-1012079])

HSP 1 Score: 79.337 bits (194), Expect = 7.947e-17
Identity = 65/245 (26.53%), Postives = 104/245 (42.45%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVGNL--KEYSHLITNKCIEVFIWDNGQELIDYFEKL 752
            K L  FDFD T+I + SD  I   +  K+  + L N       W  ++  V+  +   G  E D + +M ++ +  GM     F+ + K + D  IISD+N   I  IL +   N +  F  + +N   FD  G    +   +     C  CP  LCK  V++  +    +N  +Y  I Y GDG  DLC     P+    K    +   G    K  +  +T     + +W  G E++ + + L
Sbjct:    2 KTLLVFDFDHTIINDNSDTWIVQCVPGKKLPNGLQNSYEKG-KWTEYMGRVFSYLGEQGIREEDMKRIMIAIPYTPGMTDLLHFIGQNKDSFDCIIISDSNTIFIDWILTHA--NVHNVFDKVFTNPAAFDSVGNLTVQ---NFHVHHCTTCPTNLCKKKVLEEFVAKQSSNSAHYSKIVYVGDGGNDLC-----PVTFLKKGDIAMPRAGYTLDKHIAKDVTLVDSTISVWSTGAEILSHLKLL 235          
BLAST of Phosphatase, orphan 1 vs. Ensembl Mouse
Match: Phospho1 (phosphatase, orphan 1 [Source:MGI Symbol;Acc:MGI:2447348])

HSP 1 Score: 73.9442 bits (180), Expect = 7.781e-15
Identity = 51/190 (26.84%), Postives = 85/190 (44.74%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLC 593
            + L  FDFD T++ E SD  I      ++   SL         +  +++ V+K +   G   RD R V  ++    GM    +F+ K  S  ++ +ISDAN + + + L  +   ++  F+ I+SN    D  G     P    S   C  CP  +CK  V+   L+    +  +++ + Y GDG  D C
Sbjct:   26 RFLLTFDFDETIVDENSDDSIVRAAPGQQLPESLRATYREGY-YNEYMQRVFKYLGEQGVRPRDLRAVYETIPLSPGMGDLLQFIAKQGSCFEVILISDANTFGVESAL--RAAGHHSLFRRILSNPSGPDARGLLTLRPFHTHS---CSRCPANMCKHKVLSEYLRERARDGVHFERLFYVGDGANDFC 209          
BLAST of Phosphatase, orphan 1 vs. Ensembl Mouse
Match: Phospho2 (phosphatase, orphan 2 [Source:MGI Symbol;Acc:MGI:1920623])

HSP 1 Score: 69.707 bits (169), Expect = 1.661e-13
Identity = 65/248 (26.21%), Postives = 101/248 (40.73%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFLLKYKSNTDMF---IISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVG-----NLKEYSHLITNKCIEVFIWDNGQELIDYFEKL 752
            K L  FDFD T+I + SD  I     +K+    L +     L W   +  V+K +  +G    + +  + S+ F  GM   L   + N D F   IISD+N   I  +LE     ++  F  + +N   FD  G+   +     S   C  CP  LCK  V+   +         Y  I Y GDG  D+C     P+    K+   +   G      L + S  +      + +W +G E+I + + L
Sbjct:    2 KVLLVFDFDNTIIDDNSDTWIVQCAPDKKLPIELQDSYQKGL-WTEFMGRVFKYLRDEGVKADELKRAVTSLPFTSGMIELLSFLRMNKDRFDCIIISDSNSIFIDWVLEAA--AFHDVFDHVFTNPASFDSSGRLTVKNYHAHS---CTRCPKNLCKNTVLGEFIDKQLQKGVRYTRIVYIGDGGNDVC-----PVTFLKKNDVAMPREGYTLHRTLAKMSQNLEPMESSIVVWSSGVEIISHLQFL 238          
BLAST of Phosphatase, orphan 1 vs. Ensembl Mouse
Match: Phospho2 (phosphatase, orphan 2 [Source:MGI Symbol;Acc:MGI:1920623])

HSP 1 Score: 69.707 bits (169), Expect = 1.661e-13
Identity = 65/248 (26.21%), Postives = 101/248 (40.73%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFLLKYKSNTDMF---IISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVG-----NLKEYSHLITNKCIEVFIWDNGQELIDYFEKL 752
            K L  FDFD T+I + SD  I     +K+    L +     L W   +  V+K +  +G    + +  + S+ F  GM   L   + N D F   IISD+N   I  +LE     ++  F  + +N   FD  G+   +     S   C  CP  LCK  V+   +         Y  I Y GDG  D+C     P+    K+   +   G      L + S  +      + +W +G E+I + + L
Sbjct:    2 KVLLVFDFDNTIIDDNSDTWIVQCAPDKKLPIELQDSYQKGL-WTEFMGRVFKYLRDEGVKADELKRAVTSLPFTSGMIELLSFLRMNKDRFDCIIISDSNSIFIDWVLEAA--AFHDVFDHVFTNPASFDSSGRLTVKNYHAHS---CTRCPKNLCKNTVLGEFIDKQLQKGVRYTRIVYIGDGGNDVC-----PVTFLKKNDVAMPREGYTLHRTLAKMSQNLEPMESSIVVWSSGVEIISHLQFL 238          
BLAST of Phosphatase, orphan 1 vs. Ensembl Mouse
Match: Phospho2 (phosphatase, orphan 2 [Source:MGI Symbol;Acc:MGI:1920623])

HSP 1 Score: 69.707 bits (169), Expect = 1.661e-13
Identity = 65/248 (26.21%), Postives = 101/248 (40.73%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFLLKYKSNTDMF---IISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVG-----NLKEYSHLITNKCIEVFIWDNGQELIDYFEKL 752
            K L  FDFD T+I + SD  I     +K+    L +     L W   +  V+K +  +G    + +  + S+ F  GM   L   + N D F   IISD+N   I  +LE     ++  F  + +N   FD  G+   +     S   C  CP  LCK  V+   +         Y  I Y GDG  D+C     P+    K+   +   G      L + S  +      + +W +G E+I + + L
Sbjct:    2 KVLLVFDFDNTIIDDNSDTWIVQCAPDKKLPIELQDSYQKGL-WTEFMGRVFKYLRDEGVKADELKRAVTSLPFTSGMIELLSFLRMNKDRFDCIIISDSNSIFIDWVLEAA--AFHDVFDHVFTNPASFDSSGRLTVKNYHAHS---CTRCPKNLCKNTVLGEFIDKQLQKGVRYTRIVYIGDGGNDVC-----PVTFLKKNDVAMPREGYTLHRTLAKMSQNLEPMESSIVVWSSGVEIISHLQFL 238          
BLAST of Phosphatase, orphan 1 vs. Ensembl Mouse
Match: Phospho1 (phosphatase, orphan 1 [Source:MGI Symbol;Acc:MGI:2447348])

HSP 1 Score: 58.151 bits (139), Expect = 9.248e-10
Identity = 36/128 (28.12%), Postives = 59/128 (46.09%), Query Frame = 3
Query:  219 RDFRNVMRSVKFVDGMD---RFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLC 593
            RD R V  ++    GM    +F+ K  S  ++ +ISDAN + + + L  +   ++  F+ I+SN    D  G     P    S   C  CP  +CK  V+   L+    +  +++ + Y GDG  D C
Sbjct:    2 RDLRAVYETIPLSPGMGDLLQFIAKQGSCFEVILISDANTFGVESAL--RAAGHHSLFRRILSNPSGPDARGLLTLRPFHTHS---CSRCPANMCKHKVLSEYLRERARDGVHFERLFYVGDGANDFC 124          
BLAST of Phosphatase, orphan 1 vs. UniProt/SwissProt
Match: sp|Q67YC0|PPSP1_ARATH (Inorganic pyrophosphatase 1 OS=Arabidopsis thaliana OX=3702 GN=PS2 PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.846e-19
Identity = 62/199 (31.16%), Postives = 98/199 (49.25%), Query Frame = 3
Query:   39 LFFFDFDLTLIKETSD-YVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFLLKYKSNTD----MFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFD----PSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNL 608
            +  FDFD T+I   SD +VI  L       + L N+L   + W + ++ + KE+H  G +  + + V+R++       R +   KS  D    + I+SDAN++ I TI+E+  +  +  F +I SN G+ D  G  K  P  D    P    C  CP  +CKG++++ I ++        K + Y GDG GD C  L L
Sbjct:   15 VVVFDFDKTIIDVDSDNWVIDEL-----GFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIKQVLRTIPI---HPRVVPAIKSAHDLGCELRIVSDANMFFIETIVEH--LGISELFSEINSNPGYVDERGTLKISPYHDFTKSPHSCSCGTCPPNMCKGLIIERIQQSLAK--EGKKKMIYLGDGAGDYCPSLKL 201          
BLAST of Phosphatase, orphan 1 vs. UniProt/SwissProt
Match: sp|Q66KD6|PHOP2_XENTR (Probable phosphatase phospho2 OS=Xenopus tropicalis OX=8364 GN=phospho2 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 4.210e-16
Identity = 65/245 (26.53%), Postives = 104/245 (42.45%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVGNL--KEYSHLITNKCIEVFIWDNGQELIDYFEKL 752
            K L  FDFD T+I + SD  I   +  K+  + L N       W  ++  V+  +   G  E D + +M ++ +  GM     F+ + K + D  IISD+N   I  IL +   N +  F  + +N   FD  G    +   +     C  CP  LCK  V++  +    +N  +Y  I Y GDG  DLC     P+    K    +   G    K  +  +T     + +W  G E++ + + L
Sbjct:    2 KTLLVFDFDHTIINDNSDTWIVQCVPGKKLPNGLQNSYEKG-KWTEYMGRVFSYLGEQGIREEDMKRIMIAIPYTPGMTDLLHFIGQNKDSFDCIIISDSNTIFIDWILTHA--NVHNVFDKVFTNPAAFDSVGNLTVQ---NFHVHHCTTCPTNLCKKKVLEEFVAKQSSNSAHYSKIVYVGDGGNDLC-----PVTFLKKGDIAMPRAGYTLDKHIAKDVTLVDSTISVWSTGAEILSHLKLL 235          
BLAST of Phosphatase, orphan 1 vs. UniProt/SwissProt
Match: sp|Q66HC4|PHOP2_RAT (Pyridoxal phosphate phosphatase PHOSPHO2 OS=Rattus norvegicus OX=10116 GN=Phospho2 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.295e-15
Identity = 66/248 (26.61%), Postives = 102/248 (41.13%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFLLKYKSNTDMF---IISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVG-----NLKEYSHLITNKCIEVFIWDNGQELIDYFEKL 752
            K L  FDFD T+I + SD  I     +K+    L +     L W   +  V+K +  +G  E + +  + S+ F  GM   L   + N D F   IISD+N   I  +LE     ++  F  + +N   FD  G+     C   +   C  CP  LCK  V+   +         Y  I Y GDG  D+C     P+    K+   +   G      L + S  +      + +W +G E+I + + L
Sbjct:    2 KVLLVFDFDNTIIDDNSDTWIIQCAPDKKLPIELQDSYQKGL-WTEFMGRVFKYLRDEGVKEEELKRAVTSLPFTSGMIELLSFLRMNKDRFDCIIISDSNSIFIDWVLEAA--AFHDVFDTVFTNPASFDSTGRLTVRNCHTHA---CTRCPKNLCKNTVLGEFIDKQLQKGVRYTRIVYIGDGGNDVC-----PVTFLKKNDVAMPREGYTLHRTLDKMSQNLEPMASSIVVWSSGMEIISHLQFL 238          
BLAST of Phosphatase, orphan 1 vs. UniProt/SwissProt
Match: sp|Q9FZ62|PPSP2_ARATH (Inorganic pyrophosphatase 2 OS=Arabidopsis thaliana OX=3702 GN=At1g17710 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.481e-15
Identity = 60/197 (30.46%), Postives = 91/197 (46.19%), Query Frame = 3
Query:   39 LFFFDFDLTLIKETSD-YVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFLLKYKS----NTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFD--PSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNL 608
            +  FDFD T+I   SD +V+  L       + L N+L   + W S +  + KE+H  G +  + + V+R +       R +   KS      ++ I+SDAN   I TI+E+  +    +F +I +N G  D  G+    P  D   S   C  CP  +CKG+++  I  +        K I Y GDG GD C  L L
Sbjct:    8 VIVFDFDKTIIDVDSDNWVVDEL-----GFTDLFNQLLPTMPWNSLMNRMMKELHDHGKTIEEIKQVLRRIPI---HPRVIPAIKSAHALGCELRIVSDANTLFIETIIEH--LGIGEFFSEINTNPGLVDEQGRLIVSPYHDFTKSSHGCSRCPPNMCKGLIIDRIQASLTKEGKTSKMI-YLGDGAGDYCPSLGL 193          
BLAST of Phosphatase, orphan 1 vs. UniProt/SwissProt
Match: sp|Q8R2H9|PHOP1_MOUSE (Phosphoethanolamine/phosphocholine phosphatase OS=Mus musculus OX=10090 GN=Phospho1 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 5.443e-14
Identity = 51/190 (26.84%), Postives = 85/190 (44.74%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLC 593
            + L  FDFD T++ E SD  I      ++   SL         +  +++ V+K +   G   RD R V  ++    GM    +F+ K  S  ++ +ISDAN + + + L  +   ++  F+ I+SN    D  G     P    S   C  CP  +CK  V+   L+    +  +++ + Y GDG  D C
Sbjct:   26 RFLLTFDFDETIVDENSDDSIVRAAPGQQLPESLRATYREGY-YNEYMQRVFKYLGEQGVRPRDLRAVYETIPLSPGMGDLLQFIAKQGSCFEVILISDANTFGVESAL--RAAGHHSLFRRILSNPSGPDARGLLTLRPFHTHS---CSRCPANMCKHKVLSEYLRERARDGVHFERLFYVGDGANDFC 209          
BLAST of Phosphatase, orphan 1 vs. TrEMBL
Match: N6UE28 (Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae OX=77166 GN=109534241 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 3.685e-21
Identity = 72/248 (29.03%), Postives = 115/248 (46.37%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFL--LKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRN-------VGNLKEYSHLITNKCIEVFIWDNGQELIDYFEK 749
            K+L  FDFD T++   SD  +  L+ +K K    + KL+    W + ++ V+  +H +  +E D   ++R +  V G+   +  L    + D+ IISDAN + I   LE   ++       + SN G F+  G+ + E   D  Q  C +    LCKG +++  +K        Y+ + Y GDG  D C  L L    G   VAC R        V N     H +     +V IW+NGQE++++  K
Sbjct:   25 KNLAVFDFDHTIVDTNSDTAVMDLV-DKSKFPPDLRKLHKSAGWTAFMQAVFNVLHENQVTEPDIAGLIRRLPAVAGIKHLIQTLHDSMDYDVIIISDANTYFINAWLEENGLSSKIL--KVYSNPGAFNEQGRLEIEMFHD--QDSCQLSTRNLCKGQIMQDFIKEQSKRGIVYRKVVYVGDGHNDFCPILRL----GSTGVACCRKAYQCADLVQNAPNTEHRLK---AQVCIWENGQEVLEFLAK 260          
BLAST of Phosphatase, orphan 1 vs. TrEMBL
Match: J3JYP1 (Uncharacterized protein OS=Dendroctonus ponderosae OX=77166 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 4.902e-21
Identity = 72/248 (29.03%), Postives = 115/248 (46.37%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFL--LKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRN-------VGNLKEYSHLITNKCIEVFIWDNGQELIDYFEK 749
            K+L  FDFD T++   SD  +  L+ +K K    + KL+    W + ++ V+  +H +  +E D   ++R +  V G+   +  L    + D+ IISDAN + I   LE   ++       + SN G F+  G+ + E   D  Q  C +    LCKG +++  +K        Y+ + Y GDG  D C  L L    G   VAC R        V N     H +     +V IW+NGQE++++  K
Sbjct:    2 KNLAVFDFDHTIVDTNSDTAVMDLV-DKSKFPPDLRKLHKSAGWTAFMQAVFNVLHENQVTEPDIAGLIRRLPGVAGIKHLIQTLHDSMDYDVIIISDANTYFINAWLEENGLSSKIL--KVYSNPGAFNEQGRLEIEMFHD--QDSCQLSTRNLCKGQIMQDFIKEQSKRGIVYRRVVYVGDGHNDFCPILRL----GSTGVACCRKAYQCADLVQNAPNTEHRLK---AQVCIWENGQEVLEFLAK 237          
BLAST of Phosphatase, orphan 1 vs. TrEMBL
Match: U4UFM8 (Uncharacterized protein OS=Dendroctonus ponderosae OX=77166 GN=D910_10097 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.612e-20
Identity = 72/248 (29.03%), Postives = 115/248 (46.37%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFL--LKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRN-------VGNLKEYSHLITNKCIEVFIWDNGQELIDYFEK 749
            K+L  FDFD T++   SD  +  L+ +K K    + KL+    W + ++ V+  +H +  +E D   ++R +  V G+   +  L    + D+ IISDAN + I   LE   ++       + SN G F+  G+ + E   D  Q  C +    LCKG +++  +K        Y+ + Y GDG  D C  L L    G   VAC R        V N     H +     +V IW+NGQE++++  K
Sbjct:  122 KNLAVFDFDHTIVDTNSDTAVMDLV-DKSKFPPDLRKLHKSAGWTAFMQAVFNVLHENQVTEPDIAGLIRRLPGVAGIKHLIQTLHDSMDYDVIIISDANTYFINAWLEENGLSSKIL--KVYSNPGAFNEQGRLEIEMFHD--QDSCQLSTRNLCKGQIMQDFIKEQSKRGIVYRRVVYVGDGHNDFCPILRL----GSTGVACCRKAYQCADLVQNAPNTEHRLK---AQVCIWENGQEVLEFLAK 357          
BLAST of Phosphatase, orphan 1 vs. TrEMBL
Match: A0A1S3UT89 (inorganic pyrophosphatase 2 OS=Vigna radiata var. radiata OX=3916 GN=LOC106768542 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.809e-20
Identity = 71/232 (30.60%), Postives = 110/232 (47.41%), Query Frame = 3
Query:   48 FDFDLTLIKETSD-YVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFLLKYKS-NTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDP--SQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVGNLKEYSHLITNKCIEVFIWDNGQEL 731
            FDFD T+I + SD ++I  L      ++ L N+L   + W S ++ + +E+HS+G +       ++       +   +    +   D+ IISDAN+++IRTILE+  +     F  I +N GF D  G+ +  P  D   S   C +CP  +CKG+V+  I  ++     N + I Y GDG GD C  L L    G   V   +N     +          EV  W NG+EL
Sbjct:   11 FDFDRTIIDDDSDRWIITEL-----GLTHLFNQLRQTMPWTSLMDRIMEELHSNGITVDHIAECLKRTPLHPNIVSAIKSAHALGCDLRIISDANMFSIRTILEHHGL--LGCFSQINTNPGFVDNEGRLRVTPFHDSAVSPHACSLCPPNMCKGLVIAQIRGSFP---GNERKIIYLGDGIGDYCPTLRL---KGGDFVMPRKNYPLWNQIQSDPKLVAAEVHDWSNGEEL 229          
BLAST of Phosphatase, orphan 1 vs. TrEMBL
Match: V4BEQ9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_136443 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.341e-19
Identity = 75/255 (29.41%), Postives = 118/255 (46.27%), Query Frame = 3
Query:   30 RKHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFL-LKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVGNL-------------KEYSHLITNKCIEVFIWDNGQELIDYFEKL 752
             K L  FDFD T+I + SD  I  L  N +   ++ ++ + D  W  ++  +++ +H +G  E + +  M  +K  +GM++ L L      D  IISD+N   I  ILEN     +  F  + +N   FD  G  K +  F   Q  C +    LCKG +++  +K+ ++N   Y  + Y GDG  DLC  L L    G +   C R   +L              E+ H +     +VF W +G+E+ D  EKL
Sbjct:    3 EKILLAFDFDHTIIDDNSDIHIINLAPNGKLPQAIKDQYDDD-GWTEYMGTIFEYLHENGVQEENIKQNMAEIKLTEGMEKLLDLAKGDKYDSIIISDSNSHFIECILEN--FKLSSVFSKVFTNPASFDDKGCLKIK--FYHKQDYCSLSTINLCKGRILQDFIKDRKSNGVEYSQVVYVGDGSNDLCPGLTL----GAQDYLCARKGFSLWKKLNKAKKSKTKDEFVHSLK---AQVFEWQSGEEIKDLLEKL 245          
BLAST of Phosphatase, orphan 1 vs. Ensembl Cavefish
Match: phospho2 (phosphatase, orphan 2 [Source:NCBI gene;Acc:103024835])

HSP 1 Score: 70.4774 bits (171), Expect = 8.330e-14
Identity = 67/247 (27.13%), Postives = 107/247 (43.32%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSD-YVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDR---FLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLP---LIHGIKSVACIRNVGNLKEYSHLITNKCIEVFIWDNGQELIDYFEKL 752
            K L  FDFD TL+ + SD +VIR     ++ + + +        W  ++  V   +          R+VM ++ F DGM     F+ + KS  D  I+SD+N   I  IL+ + +        + +N    +  G    + CF   Q  C  CP  LCK  V+    +N   +  +Y+ + Y GDG  D C    L    L+   K     + +  LK  S  +  K  +V  W NG E+++  +KL
Sbjct:    2 KTLVVFDFDHTLVDDNSDTWVIR--CAPEQSLPAWLKNSYEKGRWTEYMGRVLSYLRDQSVQPDTIRSVMETIPFTDGMVELLTFISQSKSEIDCIIVSDSNTLFIDWILQARGLKNA--IDSVFTNPASVNNEGCIGVQ-CFHLHQ--CDHCPVNLCKQKVLSDFTENQANSGIHYQAVCYVGDGGNDFCPVKVLKETDLVMPRKGYTLEKLL--LKASSENVALK-PQVVPWSNGNEILEQLQKL 238          
BLAST of Phosphatase, orphan 1 vs. Ensembl Cavefish
Match: ENSAMXT00000026317.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000255.1:69123:73416:-1 gene:ENSAMXG00000025591.2 transcript:ENSAMXT00000026317.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 7.400e-12
Identity = 57/251 (22.71%), Postives = 104/251 (41.43%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDR---FLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINN-YKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRN-------VGNLKEYSHLITNKCIEVFIWDNGQELIDYFEKL 752
            + L  FDFD T+I E+SD  +  +   +     L N       +  H + +   +   G  E   R  +  +    G+     FL  ++ + +  ++SDAN + I T L  + +     F +I +N   F+  G+    P       +C  CP  +CK ++++  L    +     ++ + Y GDG  D+C  L L    G K  A  R        + ++K     I      V  W +G+++I+  +K+
Sbjct:   19 RFLMLFDFDETMIAESSDDAMIRIAPGQSIPDWLKNSFRPG-RYNEHSQRILAYLAQQGVKEGAIREAIEGIPPAPGLLALLGFLRSHQQDFECAVLSDANTYFIETWL--RKVGTRQLFSEIFTNPASFNKDGRLVLLPF---HAHECTQCPENMCKQVILRDYLARRASERGKPFQKVFYIGDGANDICPTLAL----GQKDTAFPRRDFPMHRIIQDMKTAQPGIYKPT--VVPWAHGEDVINCLKKV 257          
BLAST of Phosphatase, orphan 1 vs. Ensembl Cavefish
Match: phospho1 (phosphoethanolamine/phosphocholine phosphatase 1 [Source:NCBI gene;Acc:100002812])

HSP 1 Score: 59.3066 bits (142), Expect = 7.998e-10
Identity = 50/199 (25.13%), Postives = 83/199 (41.71%), Query Frame = 3
Query:   30 RKHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLL-KYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVK--SILKNYETNINNYKTIAYFGDGFGDLCGCLNL 608
            R+ L FFDFD TL+ E SD  +  +         L +       +  +++ V   +     +     N +  +    G+    RFL+ +   + ++  +SDAN   I   L+N  + +   F  I +N   FD  G+ +  P    +   C  CP  +CK  VV+  +  +  E     Y+ + Y GDG  D C  L L
Sbjct:   39 RRFLIFFDFDETLVDECSDDAVVKVAPGGSLPGWLKDTYRPG-RYNEYMQRVLAYLAEQQVTPETIINTIERLPPCPGIPALLRFLVSRPPRDFEVVCVSDANTVFIEAWLQN--LGFRQLFLRIFANPAHFDENGQLQLRPFHTHT---CMRCPVNMCKAEVVRQYTAQRVRERGGRRYQKVLYVGDGANDFCPSLIL 231          
BLAST of Phosphatase, orphan 1 vs. Ensembl Nematostella
Match: EDO48917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHV1])

HSP 1 Score: 81.2629 bits (199), Expect = 4.728e-18
Identity = 64/243 (26.34%), Postives = 111/243 (45.68%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNID-LDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFLLKYKS-NTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSIL-KNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVGNLKEYSHLITNKCIEVFIWDNGQELIDYFEKL 752
            KHL  FDFD TL+   +D  I  L     K   L+ +   D   W   ++  ++ +H++G+++ DF     S++F++GM    +  K       IISD+N + I  +L    ++    F D+ +N  ++   G    E   + +   C +CP  LCK   +K+ + K        + +I Y GDG GD C  + L     + +      +  L E S  +     EV  W++G E++D+ + L
Sbjct:    8 KHLAVFDFDHTLVDGNTDTWITKLYP---KTMELIRRCRKDGWCWTDIMDSAFQLLHANGFTQADFNKCFESLQFMEGMKETCIFLKEVGVQCIIISDSNTYFIEHLLLRDKLDSC--FTDVFTNPAWWGQKGCLHVEHYHNHT---CRMCPKNLCKMQALKTFINKQLAKGDGPFDSIVYLGDGSGDYCPSVGLEKGDYVFAREGYTLLKKLNEASPGVA---AEVVPWNSGIEVLDFLQTL 239          
BLAST of Phosphatase, orphan 1 vs. Ensembl Medaka
Match: ENSORLT00000005686.2 (pep primary_assembly:ASM223467v1:19:5120091:5122907:-1 gene:ENSORLG00000004521.2 transcript:ENSORLT00000005686.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 1.113e-14
Identity = 54/252 (21.43%), Postives = 114/252 (45.24%), Query Frame = 3
Query:   39 LFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINN--YKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRN-------VGNLKEYSHLITNKCIEVFIWDNGQELIDYFEKLDG 758
            L  FDFD T+I E SD+     + +++  + L N    +  +  H +++   +   G S+   R+ +  +    G+    +FL  ++ + ++ ++SDAN + I T L++  +     F+ I +N   FD  G+    P    S   C  CP  +CK  +++  ++  +       ++ + Y GDG  D+C    L    G +  A  R        + ++++ ++   N    +  W +G+++++   K+ G
Sbjct:   25 LVLFDFDETIIGENSDHAAVRTLPDQQLPAWLRNSYR-EGHYNEHTQKILAYMADQGVSKESIRSAVEKIPPAPGLLNLFQFLRSHQHDFELVVVSDANTYFIETWLQHAGV--RELFRKIFTNPASFDASGRLVLLPFHSHS---CPRCPDNMCKQTILREYVRGRQKERGGVPFQRVFYVGDGANDVCPTQAL----GPQDTAFPRRDFPMHQLLLDMQQSANFKAN----MVPWVSGEDIVESLRKILG 262          
BLAST of Phosphatase, orphan 1 vs. Ensembl Medaka
Match: phospho2 (pyridoxal phosphate phosphatase PHOSPHO2 [Source:NCBI gene;Acc:101174256])

HSP 1 Score: 72.0182 bits (175), Expect = 2.355e-14
Identity = 55/190 (28.95%), Postives = 81/190 (42.63%), Query Frame = 3
Query:   33 KHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLC 593
            + L  FDFD TL+ E SD  +   + +    +S+ N     L W+ ++  V K I   G      R+VM ++ F DGM     F+ + KS  D  +ISDAN   I  +L  Q          + +N   F+  G  +           C  CP  +CK  V++  L         Y+ + Y GDG  DLC
Sbjct:    2 RFLMVFDFDHTLVDENSDLWVVRCLPDGRLPASIENSHRGGL-WMEYMCRVMKFIGDQGIGPDRIRSVMETIPFADGMADLLAFISENKSAVDCIVISDANSLFINWVL--QAAGLGEAVDKVFTNPAAFNEAGHMEVR---RHHSHDCSECPPNICKRKVLERYLSERAEEGVRYERVFYVGDGSNDLC 185          
BLAST of Phosphatase, orphan 1 vs. Ensembl Medaka
Match: phospho1 (phosphoethanolamine/phosphocholine phosphatase 1 [Source:NCBI gene;Acc:100002812])

HSP 1 Score: 70.4774 bits (171), Expect = 1.116e-13
Identity = 63/257 (24.51%), Postives = 110/257 (42.80%), Query Frame = 3
Query:   15 RMSCKRKHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMD---RFLL-KYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKS-ILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRN---VGNLKEYSHLITN---KCIEVFIWDNGQELIDYFEKL 752
            R+   ++ L FFDFD T++ ETSD ++      +     L +       +  +++ V   +   G +E D R+VM  +    GM    +FL  +   + ++ ++SDAN + I + L          F  I +N   F+  G+    P        C  CP  +CK +VV+  + +  +     ++ + Y GDG  D C  L+L    G + VA  R    +  L   +H       K + V  W + +E++    KL
Sbjct:   10 RICPDKRFLIFFDFDETIVDETSDDMVVQAAPGQYLPGWLKDTYQPGR-YNEYMQRVLAYLAEQGVTECDIRSVMEKIPATPGMPTLFQFLRNRPPQDFEVVLVSDANTFFIESWLRR--AGARQLFHRIFTNPATFNKDGRLVMRPF---HSHDCQRCPDNMCKQVVVRDYVARRTQERGRPFQRVFYVGDGANDFCPALSL----GPRDVAFPRRDFPMHRLITETHEAMPGEFKAVTV-PWVSAEEVVQRLRKL 255          
BLAST of Phosphatase, orphan 1 vs. Planmine SMEST
Match: SMESG000018684.1 (SMESG000018684.1)

HSP 1 Score: 355.14 bits (910), Expect = 4.446e-125
Identity = 172/174 (98.85%), Postives = 174/174 (100.00%), Query Frame = 3
Query:  237 MRSVKFVDGMDRFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVGNLKEYSHLITNKCIEVFIWDNGQELIDYFEKLDG 758
            MRSVKFVDGMDRFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQ+KCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLP+IHGIKSVACIRNVGNLKEYSHLITNKCIEVFIWDNGQELIDYFEKLDG
Sbjct:    1 MRSVKFVDGMDRFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQIKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPVIHGIKSVACIRNVGNLKEYSHLITNKCIEVFIWDNGQELIDYFEKLDG 174          
BLAST of Phosphatase, orphan 1 vs. Planmine SMEST
Match: SMESG000035134.1 (SMESG000035134.1)

HSP 1 Score: 141.354 bits (355), Expect = 2.252e-40
Identity = 83/240 (34.58%), Postives = 132/240 (55.00%), Query Frame = 3
Query:   39 LFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWVSHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFLLKYKSNTDMFIISDANLWNIRTILENQDINYNYWFKDIISNKGFF--DICGKFKFEPCFDPSQVKCFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLIHGIKSVACIRNVGNLKEYSHLITNKCIEVFIWDNGQELIDYFEKL 752
            L  FDFD T+I+E SD  I  L+ +K KI  L  +      W  H+  V+ E++  GY + DF +V+  + +V G++  + KY+ N+ ++I+SD+N W I   L N+ IN   +FK+I +N   F  +   +   +P  +P Q  C  CP  +CKG +VK I+         Y+ + YFGDG GDLC C N+     +KS A +R    L+++ +LI    +EVF+W NG ++++    L
Sbjct:    9 LMIFDFDHTIIEENSDIEIINLLDSKSKIQ-LNKEYKSKGGWTEHMNNVFSELYIQGYKKSDFESVLLPMNYVVGIEELISKYQ-NSKLYIVSDSNSWIIDFYLTNKGINVRNFFKEIFTNSANFLDNNEDRIIIQPYHNPPQKFCDKCPENMCKGSIVKEIMSRNSA----YEAVCYFGDGKGDLCACCNIQS-PNVKSFAFVRKNFQLEKFKNLIEKNSVEVFLWTNGFDIMNILNSL 241          
The following BLAST results are available for this feature:
BLAST of Phosphatase, orphan 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PHOSPHO16.436e-1325.25phosphoethanolamine/phosphocholine phosphatase 1 [... [more]
PHOSPHO11.038e-1225.25phosphoethanolamine/phosphocholine phosphatase 1 [... [more]
PHOSPHO11.038e-1225.25phosphoethanolamine/phosphocholine phosphatase 1 [... [more]
PHOSPHO21.237e-1227.53phosphatase, orphan 2 [Source:HGNC Symbol;Acc:HGNC... [more]
PHOSPHO21.237e-1227.53phosphatase, orphan 2 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Phosphatase, orphan 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphatase, orphan 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG122371.989e-1728.69gene:FBgn0031048 transcript:FBtr0074761[more]
CG142121.200e-1126.05gene:FBgn0031045 transcript:FBtr0074742[more]
back to top
BLAST of Phosphatase, orphan 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
phospho23.356e-1430.61phosphatase, orphan 2 [Source:ZFIN;Acc:ZDB-GENE-08... [more]
phospho11.018e-1126.60phosphoethanolamine/phosphocholine phosphatase 1 [... [more]
phospho11.018e-1126.60phosphoethanolamine/phosphocholine phosphatase 1 [... [more]
back to top
BLAST of Phosphatase, orphan 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PHOSPHO13.458e-1726.29phosphatase, orphan 1 [Source:NCBI gene;Acc:100492... [more]
cdh107.947e-1726.53cadherin 10, type 2 (T2-cadherin) [Source:Xenbase;... [more]
back to top
BLAST of Phosphatase, orphan 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Phospho17.781e-1526.84phosphatase, orphan 1 [Source:MGI Symbol;Acc:MGI:2... [more]
Phospho21.661e-1326.21phosphatase, orphan 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Phospho21.661e-1326.21phosphatase, orphan 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Phospho21.661e-1326.21phosphatase, orphan 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Phospho19.248e-1028.13phosphatase, orphan 1 [Source:MGI Symbol;Acc:MGI:2... [more]
back to top
BLAST of Phosphatase, orphan 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q67YC0|PPSP1_ARATH1.846e-1931.16Inorganic pyrophosphatase 1 OS=Arabidopsis thalian... [more]
sp|Q66KD6|PHOP2_XENTR4.210e-1626.53Probable phosphatase phospho2 OS=Xenopus tropicali... [more]
sp|Q66HC4|PHOP2_RAT1.295e-1526.61Pyridoxal phosphate phosphatase PHOSPHO2 OS=Rattus... [more]
sp|Q9FZ62|PPSP2_ARATH1.481e-1530.46Inorganic pyrophosphatase 2 OS=Arabidopsis thalian... [more]
sp|Q8R2H9|PHOP1_MOUSE5.443e-1426.84Phosphoethanolamine/phosphocholine phosphatase OS=... [more]
back to top
BLAST of Phosphatase, orphan 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
N6UE283.685e-2129.03Uncharacterized protein (Fragment) OS=Dendroctonus... [more]
J3JYP14.902e-2129.03Uncharacterized protein OS=Dendroctonus ponderosae... [more]
U4UFM81.612e-2029.03Uncharacterized protein OS=Dendroctonus ponderosae... [more]
A0A1S3UT898.809e-2030.60inorganic pyrophosphatase 2 OS=Vigna radiata var. ... [more]
V4BEQ91.341e-1929.41Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Phosphatase, orphan 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
phospho28.330e-1427.13phosphatase, orphan 2 [Source:NCBI gene;Acc:103024... [more]
ENSAMXT00000026317.27.400e-1222.71pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
phospho17.998e-1025.13phosphoethanolamine/phosphocholine phosphatase 1 [... [more]
back to top
BLAST of Phosphatase, orphan 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphatase, orphan 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphatase, orphan 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489174.728e-1826.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatase, orphan 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000005686.21.113e-1421.43pep primary_assembly:ASM223467v1:19:5120091:512290... [more]
phospho22.355e-1428.95pyridoxal phosphate phosphatase PHOSPHO2 [Source:N... [more]
phospho11.116e-1324.51phosphoethanolamine/phosphocholine phosphatase 1 [... [more]
back to top
BLAST of Phosphatase, orphan 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000018684.14.446e-12598.85SMESG000018684.1[more]
SMESG000035134.12.252e-4034.58SMESG000035134.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006531 ID=SMED30006531|Name=Phosphatase, orphan 1|organism=Schmidtea mediterranea sexual|type=transcript|length=926bp
GCTTATTTTAACATAGAATGTCATGTAAAAGAAAACATTTGTTTTTTTTC
GATTTTGATTTGACCTTAATAAAAGAAACCTCAGATTATGTTATAAGAGG
TCTAATTAAAAATAAAGAAAAGATTTCTAGTCTTGTAAATAAGTTGAATA
TTGATTTAGATTGGGTAAGTCATCTTGAAGAAGTTTACAAAGAAATTCAT
TCTGATGGTTATAGTGAAAGAGATTTTAGAAATGTAATGCGCTCTGTAAA
GTTTGTTGATGGAATGGATCGGTTTTTACTTAAATATAAATCTAATACTG
ATATGTTTATAATTTCTGATGCGAATTTGTGGAATATTCGTACTATTTTA
GAAAATCAAGATATTAATTATAATTATTGGTTTAAAGATATTATAAGCAA
TAAAGGGTTTTTCGACATATGTGGAAAGTTTAAATTTGAACCTTGTTTTG
ATCCTAGTCAAGTTAAATGTTTTATATGTCCTGGTAGATTATGTAAAGGC
ATCGTGGTGAAATCCATTTTAAAAAATTATGAAACAAATATTAATAATTA
TAAAACGATTGCTTATTTTGGTGATGGATTTGGAGATTTATGTGGTTGCT
TAAATTTACCTCTAATACATGGAATAAAATCTGTTGCATGTATACGAAAT
GTTGGAAATTTAAAGGAATATTCCCATCTTATAACAAATAAATGTATTGA
AGTTTTTATTTGGGATAATGGGCAAGAATTGATTGACTATTTCGAAAAGC
TTGATGGTTAAATCTAACAATTCAAAATTTTAGGAGTTATAAGAATTAAA
AATGGTTCAAGCCCAGTTTAGTGGATGCCTGAAAACTTTGACCTAAAAAT
AAATTTAAATTGGTGATAAAGTAATGTTCATACATTTTTAATGTTATGTT
TATTGCAAATAAAACTTCAATCTGTC
back to top

protein sequence of SMED30006531-orf-1

>SMED30006531-orf-1 ID=SMED30006531-orf-1|Name=SMED30006531-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=248bp
MSCKRKHLFFFDFDLTLIKETSDYVIRGLIKNKEKISSLVNKLNIDLDWV
SHLEEVYKEIHSDGYSERDFRNVMRSVKFVDGMDRFLLKYKSNTDMFIIS
DANLWNIRTILENQDINYNYWFKDIISNKGFFDICGKFKFEPCFDPSQVK
CFICPGRLCKGIVVKSILKNYETNINNYKTIAYFGDGFGDLCGCLNLPLI
HGIKSVACIRNVGNLKEYSHLITNKCIEVFIWDNGQELIDYFEKLDG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0016791phosphatase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036412HAD-like_sf
IPR016965Pase_PHOSPHO-typ
IPR023214HAD_sf
Vocabulary: biological process
TermDefinition
GO:0016311dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTIGRFAMTIGR01488TIGR01488coord: 8..194
e-value: 7.1E-16
score: 56.6
NoneNo IPR availablePANTHERPTHR20889:SF12LP01149Pcoord: 5..244
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 1..200
e-value: 1.1E-14
score: 56.6
IPR016965Phosphatase PHOSPHO-typePIRSFPIRSF031051PLP_phosphatas_PHOSPHO2coord: 1..247
e-value: 7.5E-39
score: 131.0
IPR016965Phosphatase PHOSPHO-typePFAMPF06888Put_Phosphatasecoord: 8..242
e-value: 6.8E-36
score: 123.8
IPR016965Phosphatase PHOSPHO-typePANTHERPTHR20889PHOSPHATASE, ORPHAN 1, 2coord: 5..244
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 5..216