26S proteasome non-ATPase regulatory subunit 3

Overview
Name26S proteasome non-ATPase regulatory subunit 3
Smed IDSMED30006521
Length (bp)1682
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 26S proteasome non-ATPase regulatory subunit 3 (SMED30006521) t-SNE clustered cells

Violin plots show distribution of expression levels for 26S proteasome non-ATPase regulatory subunit 3 (SMED30006521) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 26S proteasome non-ATPase regulatory subunit 3 (SMED30006521) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 26S proteasome non-ATPase regulatory subunit 3 (SMED30006521) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006521

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30006521SMESG000066329.1 SMESG000066317.1 dd_Smed_v4_1449_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006521SMESG000066329.1 SMESG000066317.1 dd_Smed_v4_1449_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006521SMESG000066329.1 SMESG000066317.1 dd_Smed_v4_1449_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006521SMESG000066329.1 SMESG000066317.1 dd_Smed_v4_1449_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Human
Match: PSMD3 (proteasome 26S subunit, non-ATPase 3 [Source:HGNC Symbol;Acc:HGNC:9560])

HSP 1 Score: 472.626 bits (1215), Expect = 1.448e-161
Identity = 269/470 (57.23%), Postives = 354/470 (75.32%), Query Frame = 3
Query:  171 KDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXX--XXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            ++++  TLEDI++ +K +EK+V  KE  ++ R +R +    ++LN  V  + V G++ +  + + +   +L E MDT+  L  F PR+ ++ S     EVE +L LL++IF+++++R +E+ K S+ LM+++S  NRR++D+VAAKCY+YH+  YE   KLD +R FL+ARLRT TLR D  GQA ++NLLLRNYL Y+LYDQA KLVSK  +PE+ +NN+ ARYLYY GRIKAIQL+YS A + +T+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR P+LK  L+PYF LTQ VR G+L +FN+VL+ FG KF AD TYTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE  D+YST EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +D+ D F
Sbjct:   65 RELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADL-QFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF 533          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Human
Match: PSMD3 (proteasome 26S subunit, non-ATPase 3 [Source:HGNC Symbol;Acc:HGNC:9560])

HSP 1 Score: 85.5001 bits (210), Expect = 2.455e-19
Identity = 39/72 (54.17%), Postives = 55/72 (76.39%), Query Frame = 3
Query:  504 DNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQA 719
            +++R +E+ K S+ LM+++S  NRR++D+VAAKCY+YH+  YE   KLD +R FL+ARLRT TLR D  GQA
Sbjct:   29 NSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQA 100          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Celegans
Match: rpn-3 (26S proteasome non-ATPase regulatory subunit 3 [Source:UniProtKB/Swiss-Prot;Acc:Q04908])

HSP 1 Score: 304.679 bits (779), Expect = 4.526e-97
Identity = 201/509 (39.49%), Postives = 294/509 (57.76%), Query Frame = 3
Query:  102 MATAVLTSQVEKLPI--VKNNV---ELVKDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXXXXXXXXXXXXX---------XXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHD----KGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            MA     + VEK+ +   K +V   E  KD+N   +E+I++Q+  ++K     E H +TRV++ + + RK++N  V  +LV+ +  +         +YL      D  + P    + +++S    V+                 + L   ++  E++      +  + +++RR++D +AAK  ++  V YE+ G+L   + FL +RLRT TLR     QA +I  LLR YL    Y  A  LVSKV +P+  SNNDLARY+YY GRIKA+QLDY++A  +   A RKAPQ  A+GFKQAV K   V+ LL GE PDR+ FR P  + CL  Y  L++ VR GD+ +FN  LE F  +F AD T TLIVR+R NVIKT ++ ++L+YS I ++ IA KL + +  + E+IVAKAI D  I+A I  D       + + E+ D+Y T EP   F  RIR+CL++HNQ+VKA+RYPPK     +E+ E  REREQQEL+ A  L D++ D F
Sbjct:    1 MAPKTGETVVEKMEVDEAKQDVPATEPAKDLNAIAVENIKEQLAALDKG----EEHLITRVLQVLPKTRKQINDNVLYKLVSSHLSSDAQFAEGMLKYLHYTPAADTEVQPMDTSNVKTKSPKKGVKPVFASPESDCYLRLLVLLHLYAQKKNTEALALGENQLTSIYNFDRRTLDGLAAKTLYFLCVIYEREGRLFDHQGFLNSRLRTATLRNFSESQAVLICWLLRCYLINRQYQSAAHLVSKVAFPDNASNNDLARYMYYQGRIKALQLDYNSAAGYFLQAQRKAPQEGAIGFKQAVQKWVVVIGLLQGEIPDRSVFRQPIYRKCLAHYLDLSRGVRDGDVARFNHNLEQFKTQFEADDTLTLIVRLRQNVIKTAIKQISLAYSRIYIKDIAKKLYITNETETEYIVAKAIADGAIDAVITSDVRDGPRYMQSSETADIYRTSEPQAHFDTRIRYCLELHNQAVKALRYPPK-KKIAVETIEQAREREQQELEFAKELADEDDDDF 504          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Celegans
Match: rpn-3 (26S proteasome non-ATPase regulatory subunit 3 [Source:UniProtKB/Swiss-Prot;Acc:Q04908])

HSP 1 Score: 304.679 bits (779), Expect = 4.526e-97
Identity = 201/509 (39.49%), Postives = 294/509 (57.76%), Query Frame = 3
Query:  102 MATAVLTSQVEKLPI--VKNNV---ELVKDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXXXXXXXXXXXXX---------XXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHD----KGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            MA     + VEK+ +   K +V   E  KD+N   +E+I++Q+  ++K     E H +TRV++ + + RK++N  V  +LV+ +  +         +YL      D  + P    + +++S    V+                 + L   ++  E++      +  + +++RR++D +AAK  ++  V YE+ G+L   + FL +RLRT TLR     QA +I  LLR YL    Y  A  LVSKV +P+  SNNDLARY+YY GRIKA+QLDY++A  +   A RKAPQ  A+GFKQAV K   V+ LL GE PDR+ FR P  + CL  Y  L++ VR GD+ +FN  LE F  +F AD T TLIVR+R NVIKT ++ ++L+YS I ++ IA KL + +  + E+IVAKAI D  I+A I  D       + + E+ D+Y T EP   F  RIR+CL++HNQ+VKA+RYPPK     +E+ E  REREQQEL+ A  L D++ D F
Sbjct:    1 MAPKTGETVVEKMEVDEAKQDVPATEPAKDLNAIAVENIKEQLAALDKG----EEHLITRVLQVLPKTRKQINDNVLYKLVSSHLSSDAQFAEGMLKYLHYTPAADTEVQPMDTSNVKTKSPKKGVKPVFASPESDCYLRLLVLLHLYAQKKNTEALALGENQLTSIYNFDRRTLDGLAAKTLYFLCVIYEREGRLFDHQGFLNSRLRTATLRNFSESQAVLICWLLRCYLINRQYQSAAHLVSKVAFPDNASNNDLARYMYYQGRIKALQLDYNSAAGYFLQAQRKAPQEGAIGFKQAVQKWVVVIGLLQGEIPDRSVFRQPIYRKCLAHYLDLSRGVRDGDVARFNHNLEQFKTQFEADDTLTLIVRLRQNVIKTAIKQISLAYSRIYIKDIAKKLYITNETETEYIVAKAIADGAIDAVITSDVRDGPRYMQSSETADIYRTSEPQAHFDTRIRYCLELHNQAVKALRYPPK-KKIAVETIEQAREREQQELEFAKELADEDDDDF 504          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Fly
Match: Rpn3 (gene:FBgn0261396 transcript:FBtr0336843)

HSP 1 Score: 408.683 bits (1049), Expect = 1.864e-137
Identity = 243/484 (50.21%), Postives = 333/484 (68.80%), Query Frame = 3
Query:  126 QVEKLPIVKNNVELVKDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSK-QSQSXXXXXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            ++E  P  +   +  K+ ++  +++IR+QI+ IEK V +KES ++ RV+R++   R+KLN +VF  L    YP    ++      L  A++ D T LP  P+ +  +++ + EV+ + +LLLL+ L+D    + +   ++ LM ++S  NRR++D++ AK YFY S   E    L+ IR FL+ARLRT TLR D  GQA +IN LLRNYL Y LYDQA+KLV K  YPE  SNN+ AR+LYYLGRIKA +L+YS AH+HL  ALRK+PQ++A+GF+Q V KL  VVELLLG  P+R  FR   L+  L  YFQLTQ VR+G+L +F  V+  +G KF  D T+TLI+R+RHNVIKT +R + LSYS IS + IA +L L S EDAEFIV+KAI+D VI A +   +  + +KES D+YST EP   FH+RI FCL++HNQSVKAMRYPPK Y K+LESAE+RREREQQ+L+ A  + +D+ DGF
Sbjct:   13 EMEVDPTAETLADEKKNQDVAAVQEIREQIRQIEKGVASKESRFILRVLRNLPNTRRKLNGVVFRNLAQSIYPAGADREAAVA--LMPAVEKDATELPDVPKKQVATKAPIAEVDAYFYLLLLVKLIDASDLKRAGISADALMAKISIQNRRTLDLIGAKSYFYFSRVAELKNSLEGIRSFLHARLRTATLRNDFEGQAVLINCLLRNYLHYALYDQADKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQTVQKLIIVVELLLGNIPERVVFRQAGLRQSLGAYFQLTQAVRLGNLKRFGDVVSQYGPKFQLDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDIAKRLMLDSAEDAEFIVSKAIRDGVIEATLDPAQNFMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEDDEDGF 494          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Fly
Match: Rpn3 (gene:FBgn0261396 transcript:FBtr0302289)

HSP 1 Score: 408.683 bits (1049), Expect = 1.864e-137
Identity = 243/484 (50.21%), Postives = 333/484 (68.80%), Query Frame = 3
Query:  126 QVEKLPIVKNNVELVKDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSK-QSQSXXXXXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            ++E  P  +   +  K+ ++  +++IR+QI+ IEK V +KES ++ RV+R++   R+KLN +VF  L    YP    ++      L  A++ D T LP  P+ +  +++ + EV+ + +LLLL+ L+D    + +   ++ LM ++S  NRR++D++ AK YFY S   E    L+ IR FL+ARLRT TLR D  GQA +IN LLRNYL Y LYDQA+KLV K  YPE  SNN+ AR+LYYLGRIKA +L+YS AH+HL  ALRK+PQ++A+GF+Q V KL  VVELLLG  P+R  FR   L+  L  YFQLTQ VR+G+L +F  V+  +G KF  D T+TLI+R+RHNVIKT +R + LSYS IS + IA +L L S EDAEFIV+KAI+D VI A +   +  + +KES D+YST EP   FH+RI FCL++HNQSVKAMRYPPK Y K+LESAE+RREREQQ+L+ A  + +D+ DGF
Sbjct:   13 EMEVDPTAETLADEKKNQDVAAVQEIREQIRQIEKGVASKESRFILRVLRNLPNTRRKLNGVVFRNLAQSIYPAGADREAAVA--LMPAVEKDATELPDVPKKQVATKAPIAEVDAYFYLLLLVKLIDASDLKRAGISADALMAKISIQNRRTLDLIGAKSYFYFSRVAELKNSLEGIRSFLHARLRTATLRNDFEGQAVLINCLLRNYLHYALYDQADKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQTVQKLIIVVELLLGNIPERVVFRQAGLRQSLGAYFQLTQAVRLGNLKRFGDVVSQYGPKFQLDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDIAKRLMLDSAEDAEFIVSKAIRDGVIEATLDPAQNFMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEDDEDGF 494          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Zebrafish
Match: psmd3 (proteasome 26S subunit, non-ATPase 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1444])

HSP 1 Score: 463.381 bits (1191), Expect = 1.351e-158
Identity = 264/471 (56.05%), Postives = 351/471 (74.52%), Query Frame = 3
Query:  168 VKDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSX--XXXXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
             ++++  TL+DIR+ +K IEK+V  KE  ++ R +R++    ++LN  V  + V+G++    + K +   +L + ++ +  + PF PR+ ++ ++  +PEVE +L LL +++L +N+   E+ K S+ L++++   NRR++D+VAAKCY+YHS  YE   +LD +R FL+ RLRT TLR D  GQA ++NLLLRNYL YNLYDQA KLVSK  +PE  +NN+ ARYLYY GRIKAIQL+YS A + LT+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR P+LK  L+PYF LTQ VR G+L +FN+VL+ FG KF  D TYTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE+ D+YST EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +D+ D F
Sbjct:   33 ARELDQTTLDDIREHVKQIEKAVSGKEPRFVLRALRALPSTSRRLNTNVLHKAVSGFFTANAAGKEFLLGFLEQPVEIEGDV-PFRPRTGKAAAVPLIPEVEAYLQLLTVVYLTNNKHYTEAQKVSDDLLQKIGSQNRRALDLVAAKCYYYHSRVYEFLNQLDVVRSFLHTRLRTATLRHDADGQATLLNLLLRNYLQYNLYDQAEKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYSEARRTLTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGFVQSKETMDIYSTREPQLAFHQRIAFCLDIHNMSVKAMRFPPKAYNKDLESAEERREREQQDLEFAKEMAEDDDDSF 502          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Xenopus
Match: PSMD3 (proteasome 26S subunit, non-ATPase 3 [Source:NCBI gene;Acc:100492563])

HSP 1 Score: 459.529 bits (1181), Expect = 1.456e-156
Identity = 265/470 (56.38%), Postives = 348/470 (74.04%), Query Frame = 3
Query:  171 KDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXXXXXXXXXXXXXXXX--XDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            K+++  TLEDI++ +K IE++V  KE  ++ R +R++    ++LN  V  + +NG++ +  + + +   +L E MDT+  +  F PR+ ++ S     E+  +L LL+ +  ++++R  E+ K S+ LM+++S  NRR++D+V AKCY+YHS  YE   KLD +R FL+ARLRT TLR D  GQA ++NLLLRNYL YNLYDQA KLVSK  +PE  +NN+ ARYLYY GRIKAIQL+Y+ A + LT+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR  +LK  L+PYF LTQ VR G+L +FN+VLE F  KF +D TYTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE  D+YST EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +D+ DGF
Sbjct:   66 KELDSVTLEDIKEHVKQIERAVSGKEPRFVLRALRALPSTSRRLNPNVVHKAINGFFTSNPTTRDFLLGFLEELMDTEGDV-QFRPRTGKAASTPLLPEVETYLQLLLVIYLMNSKRYTEAQKLSDDLMQKISPQNRRALDLVVAKCYYYHSRIYEFLNKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLQYNLYDQAEKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYTGARRTLTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQHSLKRSLMPYFLLTQAVRTGNLSKFNQVLEQFCEKFQSDGTYTLIIRLRHNVIKTGVRMISLSYSRISLPDIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF 534          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Xenopus
Match: PSMD3 (proteasome 26S subunit, non-ATPase 3 [Source:NCBI gene;Acc:100492563])

HSP 1 Score: 454.136 bits (1167), Expect = 2.071e-155
Identity = 266/461 (57.70%), Postives = 345/461 (74.84%), Query Frame = 3
Query:  198 DIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXX--XXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            DI++ +K IE++V  KE  ++ R +R++    ++LN  V  + +NG++ +  + + +   +L E MDT+  +  F PR+ ++ S     EVE +L LLL+I+L++++R  E+ K S+ LM+++S  NRR++D+V AKCY+YHS  YE   KLD +R FL+ARLRT TLR D  GQA ++NLLLRNYL YNLYDQA KLVSK  +PE  +NN+ ARYLYY GRIKAIQL+Y+ A + LT+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR  +LK  L+PYF LTQ VR G+L +FN+VLE F  KF +D TYTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE  D+YST EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +D+ DGF
Sbjct:    4 DIKEHVKQIERAVSGKEPRFVLRALRALPSTSRRLNPNVVHKAINGFFTSNPTTRDFLLGFLEELMDTEGDV-QFRPRTGKAASTPLLPEVETYLQLLLVIYLMNSKRYTEAQKLSDDLMQKISPQNRRALDLVVAKCYYYHSRIYEFLNKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLQYNLYDQAEKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYTGARRTLTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQHSLKRSLMPYFLLTQAVRTGNLSKFNQVLEQFCEKFQSDGTYTLIIRLRHNVIKTGVRMISLSYSRISLPDIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF 463          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Xenopus
Match: PSMD3 (proteasome 26S subunit, non-ATPase 3 [Source:NCBI gene;Acc:100492563])

HSP 1 Score: 453.751 bits (1166), Expect = 4.515e-155
Identity = 268/466 (57.51%), Postives = 347/466 (74.46%), Query Frame = 3
Query:  186 PTLED-IRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXX--XXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            P L D I++ +K IE++V  KE  ++ R +R++    ++LN  V  + +NG++ +  + + +   +L E MDT+  +  F PR+ ++ S     EVE +L LLL+I+L++++R  E+ K S+ LM+++S  NRR++D+V AKCY+YHS  YE   KLD +R FL+ARLRT TLR D  GQA ++NLLLRNYL YNLYDQA KLVSK  +PE  +NN+ ARYLYY GRIKAIQL+Y+ A + LT+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR  +LK  L+PYF LTQ VR G+L +FN+VLE F  KF +D TYTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE  D+YST EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +D+ DGF
Sbjct:   17 PQLTDNIKEHVKQIERAVSGKEPRFVLRALRALPSTSRRLNPNVVHKAINGFFTSNPTTRDFLLGFLEELMDTEGDV-QFRPRTGKAASTPLLPEVETYLQLLLVIYLMNSKRYTEAQKLSDDLMQKISPQNRRALDLVVAKCYYYHSRIYEFLNKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLQYNLYDQAEKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYTGARRTLTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQHSLKRSLMPYFLLTQAVRTGNLSKFNQVLEQFCEKFQSDGTYTLIIRLRHNVIKTGVRMISLSYSRISLPDIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF 481          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Xenopus
Match: PSMD3 (proteasome 26S subunit, non-ATPase 3 [Source:NCBI gene;Acc:100492563])

HSP 1 Score: 452.21 bits (1162), Expect = 3.008e-154
Identity = 265/460 (57.61%), Postives = 344/460 (74.78%), Query Frame = 3
Query:  201 IRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXX--XXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            I++ +K IE++V  KE  ++ R +R++    ++LN  V  + +NG++ +  + + +   +L E MDT+  +  F PR+ ++ S     EVE +L LLL+I+L++++R  E+ K S+ LM+++S  NRR++D+V AKCY+YHS  YE   KLD +R FL+ARLRT TLR D  GQA ++NLLLRNYL YNLYDQA KLVSK  +PE  +NN+ ARYLYY GRIKAIQL+Y+ A + LT+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR  +LK  L+PYF LTQ VR G+L +FN+VLE F  KF +D TYTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE  D+YST EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +D+ DGF
Sbjct:   31 IKEHVKQIERAVSGKEPRFVLRALRALPSTSRRLNPNVVHKAINGFFTSNPTTRDFLLGFLEELMDTEGDV-QFRPRTGKAASTPLLPEVETYLQLLLVIYLMNSKRYTEAQKLSDDLMQKISPQNRRALDLVVAKCYYYHSRIYEFLNKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLQYNLYDQAEKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYTGARRTLTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQHSLKRSLMPYFLLTQAVRTGNLSKFNQVLEQFCEKFQSDGTYTLIIRLRHNVIKTGVRMISLSYSRISLPDIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF 489          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Xenopus
Match: PSMD3 (proteasome 26S subunit, non-ATPase 3 [Source:NCBI gene;Acc:100492563])

HSP 1 Score: 434.106 bits (1115), Expect = 5.291e-148
Identity = 256/429 (59.67%), Postives = 325/429 (75.76%), Query Frame = 3
Query:  294 KKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXX--XXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            ++LN  V  + +NG++ +  + + +   +L E MDT+  +  F PR+ ++ S     EVE +L LLL+I+L++++R  E+ K S+ LM+++S  NRR++D+V AKCY+YHS  YE   KLD +R FL+ARLRT TLR D  GQA ++NLLLRNYL YNLYDQA KLVSK  +PE  +NN+ ARYLYY GRIKAIQL+Y+ A + LT+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR  +LK  L+PYF LTQ VR G+L +FN+VLE F  KF +D TYTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE  D+YST EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +D+ DGF
Sbjct:    8 RRLNPNVVHKAINGFFTSNPTTRDFLLGFLEELMDTEGDV-QFRPRTGKAASTPLLPEVETYLQLLLVIYLMNSKRYTEAQKLSDDLMQKISPQNRRALDLVVAKCYYYHSRIYEFLNKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLQYNLYDQAEKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYTGARRTLTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQHSLKRSLMPYFLLTQAVRTGNLSKFNQVLEQFCEKFQSDGTYTLIIRLRHNVIKTGVRMISLSYSRISLPDIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF 435          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Mouse
Match: Psmd3 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 [Source:MGI Symbol;Acc:MGI:98858])

HSP 1 Score: 469.544 bits (1207), Expect = 1.404e-160
Identity = 268/470 (57.02%), Postives = 354/470 (75.32%), Query Frame = 3
Query:  171 KDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXX--XXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            ++++  TLEDI++ ++ +EK+V  KE  ++ R +R +    ++LN  V  + V+G++ +  + + +   +L E MDT+  L  F PR+ ++ S     EVE +L LL++IFL++++R +E+ K S+ LM+++S  NRR++D+VAAKCY+YH+  YE   KLD +R FL+ARLRT TLR D  GQA ++NLLLRNYL Y+LYDQA KLVSK  +PE+ +NN+ ARYLYY GRIKAIQL+YS A + +T+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR P+LK  L+PYF LTQ VR G+L +FN+VL+ FG KF  D TYTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE  D+YST EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +D+ D F
Sbjct:   61 RELDTVTLEDIKEHVRQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVHGFFTSNNATRDFLLPFLEEPMDTEADL-QFRPRTGKAASAPLLPEVEAYLQLLMVIFLMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF 529          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Mouse
Match: Psmd3 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 [Source:MGI Symbol;Acc:MGI:98858])

HSP 1 Score: 235.728 bits (600), Expect = 6.683e-74
Identity = 133/219 (60.73%), Postives = 159/219 (72.60%), Query Frame = 3
Query:  642 KLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQA------------------------VHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCI 1226
            KLD +R FL+ARLRT TLR D  GQA ++NLLLRNYL Y+LYDQA KLVSK  +PE+ +NN+ ARYLYY GRIKAIQL+YS A + +T+ALRKAPQ++AVGFKQ                         VHKL  VVELLLGE PDR  FR P+LK  L+PYF LTQ VR G+L +FN+VL+ FG KF  D TYTLI+R+RHNVIKTGVR+++LSYS I
Sbjct:    4 KLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTSPGTVFSLAHGCAPPTVLLSRPMQVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRI 222          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. UniProt/SwissProt
Match: sp|O43242|PSMD3_HUMAN (26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2)

HSP 1 Score: 472.626 bits (1215), Expect = 6.952e-161
Identity = 269/470 (57.23%), Postives = 354/470 (75.32%), Query Frame = 3
Query:  171 KDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXX--XXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            ++++  TLEDI++ +K +EK+V  KE  ++ R +R +    ++LN  V  + V G++ +  + + +   +L E MDT+  L  F PR+ ++ S     EVE +L LL++IF+++++R +E+ K S+ LM+++S  NRR++D+VAAKCY+YH+  YE   KLD +R FL+ARLRT TLR D  GQA ++NLLLRNYL Y+LYDQA KLVSK  +PE+ +NN+ ARYLYY GRIKAIQL+YS A + +T+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR P+LK  L+PYF LTQ VR G+L +FN+VL+ FG KF AD TYTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE  D+YST EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +D+ D F
Sbjct:   65 RELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADL-QFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF 533          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. UniProt/SwissProt
Match: sp|Q2KJ46|PSMD3_BOVIN (26S proteasome non-ATPase regulatory subunit 3 OS=Bos taurus OX=9913 GN=PSMD3 PE=2 SV=1)

HSP 1 Score: 471.855 bits (1213), Expect = 1.171e-160
Identity = 270/470 (57.45%), Postives = 355/470 (75.53%), Query Frame = 3
Query:  171 KDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXX--XXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            ++++  TLEDI++ +K +EK+V  KE  ++ R +R +    ++LN  V  + V+G++ +  + + +   +L E MDT+  L  F PR+ ++ S     EVE +L LL++IFL++++R +E+ K S+ LM+++S  NRR++D+VAAKCY+YH+  YE   KLD +R FL+ARLRT TLR D  GQA ++NLLLRNYL Y+LYDQA KLVSK  +PE+ +NN+ ARYLYY GRIKAIQL+YS A + +T+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR P+LK  L+PYF LTQ VR G+L +FN+VL+ FG KF AD TYTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE  D+YST EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +D+ D F
Sbjct:   65 RELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVHGFFTSNNATRDFLLPFLEEPMDTEADL-QFRPRTGKAASAPLLPEVEAYLQLLMVIFLMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDTDGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF 533          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. UniProt/SwissProt
Match: sp|P14685|PSMD3_MOUSE (26S proteasome non-ATPase regulatory subunit 3 OS=Mus musculus OX=10090 GN=Psmd3 PE=1 SV=3)

HSP 1 Score: 469.544 bits (1207), Expect = 9.820e-160
Identity = 268/470 (57.02%), Postives = 354/470 (75.32%), Query Frame = 3
Query:  171 KDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXX--XXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            ++++  TLEDI++ ++ +EK+V  KE  ++ R +R +    ++LN  V  + V+G++ +  + + +   +L E MDT+  L  F PR+ ++ S     EVE +L LL++IFL++++R +E+ K S+ LM+++S  NRR++D+VAAKCY+YH+  YE   KLD +R FL+ARLRT TLR D  GQA ++NLLLRNYL Y+LYDQA KLVSK  +PE+ +NN+ ARYLYY GRIKAIQL+YS A + +T+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR P+LK  L+PYF LTQ VR G+L +FN+VL+ FG KF  D TYTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE  D+YST EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +D+ D F
Sbjct:   61 RELDTVTLEDIKEHVRQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVHGFFTSNNATRDFLLPFLEEPMDTEADL-QFRPRTGKAASAPLLPEVEAYLQLLMVIFLMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF 529          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. UniProt/SwissProt
Match: sp|Q9U5Z8|PSMD3_ANOST (Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Anopheles stephensi OX=30069 GN=DOXA2 PE=3 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 1.325e-140
Identity = 252/472 (53.39%), Postives = 328/472 (69.49%), Query Frame = 3
Query:  171 KDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYP----NTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXXXXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            KD  L  +++IRD  + I+K+V++KE  ++ RV+RS+   R+KL  +V   L    YP       +Q  Y  +Y   A + +    P S +S  +Q +     + L + LL    D     ++ KCS  LM ++   NRRS+D++AAKCYFYHS   E +  L++IR FL++RLRT TLR D  GQA +IN LLRNYL Y+LYDQA+KLV+K  +PE  SNN+ AR+LYYLGRIKA +L+YS AH+ L  ALRKAPQ +AVGF+Q V KL  VVELLLG+ P+R  FR  AL+  L PYFQLTQ VR+G+L +F +VLENFG +F  D T+TLI+R+RHNVIKT +R + L+YS IS + IA KL L SPEDAEFIVAKAI+D VI+A +  +KG + TKES D+YST EP   FHQRI FCLD+HNQSVKAMRYPPK Y KELESAE+RREREQQ+L+ A  + +++ D F
Sbjct:   33 KDAELLAVQEIRDHARQIDKAVVSKEPRFILRVLRSLPTTRRKLALVVVGSLAVQLYPAGPERDGNQWAYIEDYPAGAQEPEGLHDPGSDKSPFAQEVDAYFHLLLLVRLL----DKNDLPKATKCSQDLMAKIVGQNRRSLDLIAAKCYFYHSRVSELNNDLESIRSFLHSRLRTATLRNDFEGQAVLINCLLRNYLHYSLYDQADKLVNKSVFPETASNNECARFLYYLGRIKAAKLEYSVAHKQLVQALRKAPQQAAVGFRQTVQKLVIVVELLLGDIPERKVFRQAALRRSLGPYFQLTQAVRMGNLQRFGEVLENFGEQFRQDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDIARKLGLDSPEDAEFIVAKAIRDGVIDATLDPEKGYMRTKESTDIYSTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKELESAEERREREQQDLELAKEMAEEDDDDF 500          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. UniProt/SwissProt
Match: sp|O61470|PSMD3_ANOGA (Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Anopheles gambiae OX=7165 GN=Dox-A2 PE=3 SV=2)

HSP 1 Score: 412.535 bits (1059), Expect = 6.722e-138
Identity = 255/472 (54.03%), Postives = 334/472 (70.76%), Query Frame = 3
Query:  171 KDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQK---TYFTEYLPEAMDTDLTLLPFSPRSKQS-QSXXXXXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            KD  L  +++IRD  + I+K+V++KE  ++ RV+RS+   R+KL  +V   L    YP    +     Y  +Y   A + +L      PR + + +S +PEV+ + HLLLL+ L+D     ++ KCS  LM ++   NRRS+D++AAK YFYHS   E +  L++IR FL++RLRT TLR D  GQA +IN LLRNYL Y+LYDQA+KLV+K  +PE  SNN+ AR+LYYLGRIKA +L+YS AH+ L  ALRKAPQ +AVGF+Q V KL  VVELLLG+ P+R  FR  AL+  L PYFQLTQ VR+G+L +F +VL NFG +F  D T+TLI+R+RHNVIKT +R + L+YS IS + IA KL L SPEDAEFIVAKAI+D VI A +  +KG + +KES D+YST EP   FHQRI FCLD+HNQSVKAMRYPPK Y KELESAE+RREREQQ+L+ A  + +++ DGF
Sbjct:   31 KDAELLAVQEIRDHARQIDKAVVSKEPRFILRVLRSLPTTRRKLALVVVRSLAVQLYPAGPERDGIMAYIEDYPAGAQEPEL------PRPRAAIKSPVPEVDAYFHLLLLVRLLDKNDLPKATKCSQDLMAKVVGQNRRSLDLIAAKSYFYHSRVAELNNDLESIRSFLHSRLRTATLRNDFEGQAVLINCLLRNYLHYSLYDQADKLVNKSVFPETASNNECARFLYYLGRIKAAKLEYSVAHKQLVQALRKAPQQAAVGFRQTVQKLVIVVELLLGDIPERKVFRQAALRRSLGPYFQLTQAVRMGNLQRFGEVLVNFGEQFRQDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDIARKLGLDSPEDAEFIVAKAIRDGVIEATLDPEKGYMRSKESTDIYSTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKELESAEERREREQQDLELAKEMAEEDDDGF 496          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. TrEMBL
Match: A0A5J4NLG5 (26S proteasome regulatory subunit N3 OS=Paragonimus westermani OX=34504 GN=DEA37_0003601 PE=4 SV=1)

HSP 1 Score: 542.347 bits (1396), Expect = 0.000e+0
Identity = 293/469 (62.47%), Postives = 375/469 (79.96%), Query Frame = 3
Query:  171 KDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXXXXXXXXXXXXXXXXXDNER-KEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            KDV+  TLEDIR+QI+ IEK+V TKE +Y+TRVVR+I  +R+KLN  V   LV GY+PN   QKTYF E+LPEAMDTD ++ PF PRS +  + L         LLL+  + +E+  +E+ +CSNLLM+RL+  NRRSM ++A++CY+YHS +YE  G+L+A+RPFL+ARL T T+R +   QA +INLLLRNYL Y L++QA KLVS+V +PE+  NN+ ARYLYY+GRIKAIQL+YSAAH HL SALRKAPQ++AVGFKQA+HKLNTVVELLLG+QPDR+ FR  + K+ L PYFQLTQ++  GDL +F++V+   G +F AD+TYTLI+R+RHNVIKTGVR ++LSYS ISL SIA KLQLG+ +DAE+IVAKAI+D VI+A I H++  V+TKE+ D+YST EP  QFHQRIRFCL IHNQ+VKAMRYPPK Y K++ESAE+RREREQQEL+SA  L++D+FDGF
Sbjct:   34 KDVDQLTLEDIREQIRYIEKAVATKEINYITRVVRTITSLRRKLNHNVLRGLVQGYFPNPSPQKTYFMEFLPEAMDTDCSVSPFRPRSAKPNAQLLPEVEVYLHLLLLIFLIDEKLHDEATRCSNLLMDRLNLTNRRSMAVLASRCYYYHSRSYELVGRLEAVRPFLHARLCTATIRSNSDTQAVLINLLLRNYLHYQLHEQAYKLVSRVVFPEQAPNNEWARYLYYIGRIKAIQLEYSAAHDHLVSALRKAPQHTAVGFKQALHKLNTVVELLLGDQPDRSIFRQASFKAALQPYFQLTQSIHAGDLARFSEVVRVHGAQFSADRTYTLIIRLRHNVIKTGVRRISLSYSRISLASIAEKLQLGNSKDAEYIVAKAIRDGVIDASINHEQQYVTTKETLDLYSTREPFNQFHQRIRFCLGIHNQAVKAMRYPPKQYSKDMESAEERREREQQELESAKELSEDDFDGF 502          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. TrEMBL
Match: A0A4S2LIY0 (PCI domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006913 PE=4 SV=1)

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 305/469 (65.03%), Postives = 384/469 (81.88%), Query Frame = 3
Query:  171 KDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRS-KQSQSXXXXXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            KDV+  TLEDIR+QI+ IEK+V TKE +Y+TRV+RS+  +R+KLN  V   LV GY+P+   QK YF E+LPEAMDTD  + PF PRS KQ+  LLPEVE +LHLLLLIFL+D +  +E+ +CS+LLMER++  NRRSM ++A++CY+YHS +YE   +L+A+RPFL+ARL T TLR +   QA +INLLLRNYL Y L++QA KLVS+V +PE   NN+ ARYLYYLGRIKAIQLDYSAAH+HL +ALRKAPQN+A+GFKQA+HKLNTVVELLLG+QPDR+ FR    K+ L PYFQLTQ++  GDLG+F++V+   G +F AD+TYTLI+R+RHNVIKTGVR ++LSYS ISL SIA KLQLG+ +DAE+IVAKAI+D VI+A I H+K  V+TKE+ D+YST EP  QFHQRIRFCL IHNQ+VKAMRYPPK Y+K++ESAE+RREREQQEL+SA  L++D+FDGF
Sbjct:   34 KDVDQLTLEDIREQIRYIEKAVATKELNYITRVIRSLTSVRRKLNHNVLRGLVQGYFPSPSPQKAYFMEFLPEAMDTDCAVSPFRPRSGKQNVPLLPEVEAYLHLLLLIFLIDEKHYKEATRCSDLLMERINLTNRRSMALLASRCYYYHSRSYELVERLEAVRPFLHARLCTATLRSNYESQAVLINLLLRNYLHYQLHEQAFKLVSRVVFPESAPNNEWARYLYYLGRIKAIQLDYSAAHEHLVAALRKAPQNTAIGFKQALHKLNTVVELLLGDQPDRSVFRQAHFKAALQPYFQLTQSIHAGDLGRFSEVVRVHGAQFSADRTYTLIIRLRHNVIKTGVRRISLSYSRISLASIAEKLQLGNAKDAEYIVAKAIRDGVIDASINHEKQYVTTKETLDLYSTREPFDQFHQRIRFCLGIHNQAVKAMRYPPKQYNKDVESAEERREREQQELESAKELSEDDFDGF 502          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. TrEMBL
Match: A0A075A1S0 (PCI domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_00810 PE=4 SV=1)

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 305/469 (65.03%), Postives = 384/469 (81.88%), Query Frame = 3
Query:  171 KDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRS-KQSQSXXXXXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            KDV+  TLEDIR+QI+ IEK+V TKE +Y+TRV+RS+  +R+KLN  V   LV GY+P+   QK YF E+LPEAMDTD  + PF PRS KQ+  LLPEVE +LHLLLLIFL+D +  +E+ +CS+LLMER++  NRRSM ++A++CY+YHS +YE   +L+A+RPFL+ARL T TLR +   QA +INLLLRNYL Y L++QA KLVS+V +PE   NN+ ARYLYYLGRIKAIQLDYSAAH+HL +ALRKAPQN+A+GFKQA+HKLNTVVELLLG+QPDR+ FR    K+ L PYFQLTQ++  GDLG+F++V+   G +F AD+TYTLI+R+RHNVIKTGVR ++LSYS ISL SIA KLQLG+ +DAE+IVAKAI+D VI+A I H+K  V+TKE+ D+YST EP  QFHQRIRFCL IHNQ+VKAMRYPPK Y+K++ESAE+RREREQQEL+SA  L++D+FDGF
Sbjct:   34 KDVDQLTLEDIREQIRYIEKAVATKELNYITRVIRSLTSVRRKLNHNVLRGLVQGYFPSPSPQKAYFMEFLPEAMDTDCAVSPFRPRSGKQNVPLLPEVEAYLHLLLLIFLIDEKHYKEATRCSDLLMERINMTNRRSMALLASRCYYYHSRSYELVERLEAVRPFLHARLCTATLRSNYESQAVLINLLLRNYLHYQLHEQAFKLVSRVVFPESAPNNEWARYLYYLGRIKAIQLDYSAAHEHLVAALRKAPQNAAIGFKQALHKLNTVVELLLGDQPDRSVFRQAHFKAALQPYFQLTQSIHAGDLGRFSEVVRVHGAQFSADRTYTLIIRLRHNVIKTGVRRISLSYSRISLASIAEKLQLGNAKDAEYIVAKAIRDGVIDASINHEKQYVTTKETLDLYSTREPFDQFHQRIRFCLGIHNQAVKAMRYPPKQYNKDVESAEERREREQQELESAKELSEDDFDGF 502          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. TrEMBL
Match: A0A4Z2CRH2 (26S proteasome non-ATPase regulatory subunit 3 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_008130 PE=4 SV=1)

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 306/472 (64.83%), Postives = 374/472 (79.24%), Query Frame = 3
Query:  162 ELVKDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRS-KQSQSXXXXXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            E +KD +   LEDIRDQI+ IEKSV+TKE +YMTRVVR +  IR++LNC V   LV GY+PN   QK YF E LPEAMDTD  +  F PR+ K +  LLPEVE++LHLLL+IFL+D    EE+ KCSNLLM+RL+  NRRSM ++A++CY+YHS ++E  G+LD++R F +ARL T TLR +   +A +INLLLRNYL Y L++QA+KLVS+V +PE   NN+ ARYLYYLGRIKAIQLDYSAAH+HL SALRKAPQ++A GFKQA+HKLNTVVELLLGEQPDR+ FR    K  L PYFQLTQ +R GDL +FN VL   G +F ADKTYTLI+R+ HNVIKTGVR ++LSYS ISL  +A KLQL S EDAE+IVAKAI+D VI+A I H+KG V+T E+ D+YST EP  QFHQRI+FCL IHNQ+VKAMRYPPK Y K++ESAE+RREREQQEL++A  L++DEFDGF
Sbjct:   29 ETLKDTDELVLEDIRDQIRYIEKSVMTKELYYMTRVVRGLSSIRRRLNCNVLRGLVQGYFPNPSPQKAYFLELLPEAMDTDCPISSFRPRTGKLNTPLLPEVEVYLHLLLVIFLIDENHLEEACKCSNLLMDRLNATNRRSMALLASRCYYYHSRSFELVGRLDSVRSFFHARLSTATLRSNFDTKAVLINLLLRNYLHYQLHEQAHKLVSRVIFPESAPNNEWARYLYYLGRIKAIQLDYSAAHEHLVSALRKAPQHTATGFKQALHKLNTVVELLLGEQPDRSIFRQTTFKDALQPYFQLTQAIRAGDLSKFNDVLRVHGAQFSADKTYTLIIRLHHNVIKTGVRRISLSYSRISLADVAKKLQLDSTEDAEYIVAKAIRDGVIDAVINHEKGFVTTNETLDLYSTCEPFNQFHQRIKFCLGIHNQAVKAMRYPPKQYSKDIESAEERREREQQELENAKELSEDEFDGF 500          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. TrEMBL
Match: Q5DF74 (SJCHGC06456 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 304/472 (64.41%), Postives = 373/472 (79.03%), Query Frame = 3
Query:  162 ELVKDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRS-KQSQSXXXXXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            E +KD +   LEDIRDQI+ IEKSV+TKE +YMTRVVR +  IR++LNC V   LV GY+PN   QK YF E LPEAMDTD  +  F PR+ K +  LLPEVE++LHLLL+IFL+D    EE+ KCSNLLM+RL+  NRRSM ++A++CY+YHS ++E  G+LD++R F +ARL T TLR +   +A +INLLLR+YL Y L++QA+KLVS+  +PE   NN+ ARYLYYLGRIKAIQLDYSAAH+HL SALRKAPQ++A GFKQA+HKLNTVVELLLGEQPDR+ FR    K  L PYFQLTQ +R GDL +FN VL   G +F ADKTYTLI+R+ HNVIKTGVR ++LSYS ISL  +A KLQL S EDAE+IVAKAI+D VI+A I H+KG V+T E+ D+YST EP  QFHQRI+FCL IHNQ+VKAMRYPPK Y K++ESAE+RREREQQEL++A  L++DEFDGF
Sbjct:   29 ETLKDTDELVLEDIRDQIRYIEKSVMTKELYYMTRVVRGLSSIRRRLNCNVLRGLVQGYFPNPSPQKAYFLELLPEAMDTDCPISSFRPRTGKLNTPLLPEVEVYLHLLLVIFLIDENHLEEACKCSNLLMDRLNATNRRSMALLASRCYYYHSRSFELVGRLDSVRSFFHARLSTATLRSNFDTKAVLINLLLRHYLHYQLHEQAHKLVSRGIFPESAPNNEWARYLYYLGRIKAIQLDYSAAHEHLVSALRKAPQHTATGFKQALHKLNTVVELLLGEQPDRSIFRQTTFKDALQPYFQLTQAIRAGDLSKFNDVLRVHGAQFSADKTYTLIIRLHHNVIKTGVRRISLSYSRISLADVAKKLQLDSTEDAEYIVAKAIRDGVIDAVINHEKGFVTTNETLDLYSTCEPFNQFHQRIKFCLGIHNQAVKAMRYPPKQYSKDIESAEERREREQQELENAKELSEDEFDGF 500          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Cavefish
Match: psmd3 (proteasome 26S subunit, non-ATPase 3 [Source:NCBI gene;Acc:103037840])

HSP 1 Score: 468.774 bits (1205), Expect = 1.041e-160
Identity = 269/464 (57.97%), Postives = 348/464 (75.00%), Query Frame = 3
Query:  189 TLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSX--XXXXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            TLEDIR+ +K IEK+V  KE  ++ R +R++    ++LN  V  + ++G+Y +  + K +   +L E MDT+  +  F PR+ ++ +   +PEVE +L LLL+++L +N+R  E+ K S+ L++++S  NRR++D+VAAKCY+YH   YE   +LDA+R FL+ RLRT TLR D  GQA ++NLLLRNYL YNLYDQA KLVSK  +PE  +NN+ ARYLYY GRIKAIQL+YS A + LT+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR P+LK  L+PYF LTQ VR G+L +FN+ L+ FG KF  D TYTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE+ D+Y T EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +D+ D F
Sbjct:   45 TLEDIREHVKQIEKAVSGKEPRFVLRALRALPSTSRRLNPNVLHKAISGFYTSNAASKEFLLGFLEEPMDTEGDV-QFRPRTGKAAATPLIPEVEAYLQLLLVVYLTNNKRYNEAQKVSDNLLQKISSQNRRALDLVAAKCYYYHCRVYEFLNQLDAVRSFLHTRLRTATLRHDSDGQATLLNLLLRNYLQYNLYDQAEKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYSEARRTLTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQALDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKETMDIYGTREPQLAFHQRISFCLDIHNMSVKAMRFPPKAYNKDLESAEERREREQQDLEFAKEMAEDDDDSF 507          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Cavefish
Match: psmd3 (proteasome 26S subunit, non-ATPase 3 [Source:NCBI gene;Acc:103037840])

HSP 1 Score: 437.573 bits (1124), Expect = 9.366e-149
Identity = 245/426 (57.51%), Postives = 315/426 (73.94%), Query Frame = 3
Query:  189 TLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSX--XXXXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMR 1460
            TLEDIR+ +K IEK+V  KE  ++ R +R++    ++LN  V  + ++G+Y +  + K +   +L E MDT+  +  F PR+ ++ +   +PEVE +L LLL+++L +N+R  E+ K S+ L++++S  NRR++D+VAAKCY+YH   YE   +LDA+R FL+ RLRT TLR D  GQA ++NLLLRNYL YNLYDQA KLVSK  +PE  +NN+ ARYLYY GRIKAIQL+YS A + LT+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR P+LK  L+PYF LTQ VR G+L +FN+ L+ FG KF  D TYTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE+ D+Y T EP   FHQRI FCLDIHN SVK  R
Sbjct:   46 TLEDIREHVKQIEKAVSGKEPRFVLRALRALPSTSRRLNPNVLHKAISGFYTSNAASKEFLLGFLEEPMDTEGDV-QFRPRTGKAAATPLIPEVEAYLQLLLVVYLTNNKRYNEAQKVSDNLLQKISSQNRRALDLVAAKCYYYHCRVYEFLNQLDAVRSFLHTRLRTATLRHDSDGQATLLNLLLRNYLQYNLYDQAEKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYSEARRTLTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQALDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKETMDIYGTREPQLAFHQRISFCLDIHNMSVKERR 470          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Sea Lamprey
Match: psmd3 (proteasome 26S subunit, non-ATPase 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1444])

HSP 1 Score: 442.195 bits (1136), Expect = 8.147e-151
Identity = 266/482 (55.19%), Postives = 352/482 (73.03%), Query Frame = 3
Query:  159 VELVKDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQS--QSXXXXXXXXXXXXXXXXXXDNER---KEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLG---RIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQ--TVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            V   K+ +   LED+++Q++ IEKSV +KE  ++ RV+R++   R+KLN  V  + + G        +     +  E MD +  +  F PR+ ++  Q LLPE E +L  L +++L+D++R    +++ KCS+ LM++++  NRR++D +AA+CYFYHS  YE   +LD+IR FL +RLRT TLR D  GQA ++NLLLRNYL YNLY+QA KLVSK  +PE+ +NN+ ARYLYY G   RIKAIQL+YS A + LT+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR P+LK  L+PYF LTQ   VR G+L +FN+VLE FG+KF  D  YTLI+R+RHNVIKTGVR+++LSYS ISL  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE+ D+Y+T EP   FHQRI FCL++HN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +++ DGF
Sbjct:   41 VRTQKETDALALEDLKEQVRQIEKSVSSKEPRFVLRVLRALPSTRRKLNAHVLRKALAG--SGAAPARDLLLTFFDEPMDAEGEVT-FRPRTGKAAAQPLLPETETYLQHLCVVYLLDSKRYDDAKQAQKCSDDLMQKIASQNRRTLDQLAARCYFYHSRVYEFLDRLDSIRSFLQSRLRTATLRHDTDGQATLLNLLLRNYLHYNLYEQAGKLVSKSLFPEQANNNEWARYLYYTGVAGRIKAIQLEYSEARRTLTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQGTAVRTGNLSKFNQVLEQFGDKFQTDFAYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKETIDIYATREPQLAFHQRIAFCLEMHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEEDDDGF 519          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Yeast
Match: RPN3 (Essential non-ATPase regulatory subunit of the 26S proteasome lid; similar to the p58 subunit of the human 26S proteasome; temperature-sensitive alleles cause metaphase arrest, suggesting a role for the proteasome in cell cycle control [Source:SGD;Acc:S000000823])

HSP 1 Score: 222.631 bits (566), Expect = 2.445e-66
Identity = 126/352 (35.80%), Postives = 213/352 (60.51%), Query Frame = 3
Query:  567 YNRRSMDMVAAKCYFY----HSVAYEKSGKLDA------IRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDL-ARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNS-AVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAE----DXXXXXXXXLDSANNLTDDEFDGF 1574
            YN RS++++ AK +FY    H      S ++++      +R  +   L+  +L+ D   +A +INL+LR++L     D A+  +SK+ YP    ++ L ARY +YL +I AIQLDYS A++++ +A+RKAP NS ++GF Q  +KL+  ++LL+G+ P+ + F    ++  LLPY+ LT+ V++GDL +F   +  +    L D TY L VR+R NVIKTG+R+++L+Y  ISL  I  KL L S +  E++V++AI+D VI A+I H+ G + T E  ++Y + +P   F +RI+F   +H++ + +MRYP     ++ E +E    D    +   +D  ++++D +  GF
Sbjct:  171 YNLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKAMLINLILRDFLNNGEVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMGDIPELSFFHQSNMQKSLLPYYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLRDICLKLNLDSEQTVEYMVSRAIRDGVIEAKINHEDGFIETTELLNIYDSEDPQQVFDERIKFANQLHDEYLVSMRYPEDKKTQQNEKSENGENDDDTLDGDLMDDMSDISDLDDLGF 522          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Nematostella
Match: EDO33969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQQ7])

HSP 1 Score: 448.743 bits (1153), Expect = 1.511e-153
Identity = 261/462 (56.49%), Postives = 332/462 (71.86%), Query Frame = 3
Query:  192 LEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXXXXXXXX--XXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLT--DDEF 1565
            LED+++ +K IEK+V  KE  +M R +R+I   RKKL   +  +L+ GY P   S +     YL E MDT+ + L F PRS ++ SL    E+    HLL++I L+D +   ++++CSN LM++    NRRSMD + AKCYF+HS AYE + +L  IR FL+++LRT TLR D  GQA+++NLLLRNYL YNLYDQA+KLVSK ++P   S N  ARYLYY G IKAIQLDY+ AH++L  A+RKAPQN A GFKQ  HK   VVELLLGE PDRA FR P L+  L+PYFQLT+ V  GDL  FN+V+E F  +FL +KTYT+I+R+RHNVIK GVR++ LSYS IS   IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE+ D+YST EP   FHQRI FCLDI+NQSVKAMR+PPK Y K LES E++RERE+Q+++ A  +   DD+F
Sbjct:   33 LEDMKEHVKCIEKAVSAKEPRFMLRAMRAIPGTRKKLKHSILRKLICGYMPIASSNRDSLLAYLDEPMDTEESGLAFRPRSAKAASLPLLPELDTYFHLLIVIHLLDTKCYNKALECSNDLMQKTQGMNRRSMDALLAKCYFFHSRAYEVTDRLKDIRSFLHSKLRTATLRHDDEGQASLLNLLLRNYLHYNLYDQADKLVSKSSFPTTASTNAWARYLYYTGIIKAIQLDYTEAHKNLLQAIRKAPQNFAYGFKQTAHKFAIVVELLLGEIPDRAIFRQPFLRKTLMPYFQLTKAVLNGDLKVFNQVVEKFKERFLEEKTYTIIIRLRHNVIKAGVRMINLSYSKISFVDIAQKLQLDSPEDAEFIVAKAIRDGVIEASIDHEKGTVQSKENVDIYSTNEPQGAFHQRISFCLDIYNQSVKAMRFPPKSYSKNLESFEEQREREKQDMELAKEMAEEDDDF 494          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Medaka
Match: psmd3 (proteasome 26S subunit, non-ATPase 3 [Source:NCBI gene;Acc:101170162])

HSP 1 Score: 456.833 bits (1174), Expect = 6.235e-156
Identity = 257/464 (55.39%), Postives = 339/464 (73.06%), Query Frame = 3
Query:  189 TLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXXXXXXXX--XXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            TLEDI++ +K IEK+V  KE  ++ R +R++    ++LN  V  + V G++ ++ S + +   +L E M+     + F PR+ ++ +     E+     LLL++ L  N+R  E+ + S+ LM+++S    R++D++AAKCY++H+  YE   +L AIR FL++RLRT TLR D  GQA ++NLLLRNYL ++LYDQA KLVSK  +PE  +NN+ ARYLYY GRIKAIQL+YS A + LT+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR P+LK  L+PYF LTQ VR G+L +FN+VL+ FG KF AD TYTLI+R+RHNVIKTGVR+++LSYS I L  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE+ D+Y T EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+RREREQQ+L+ A  + +D+ D F
Sbjct:   52 TLEDIKEHVKQIEKAVSGKEPRFVLRALRALPSTSRRLNANVLHKTVCGFFTSSASTREFLLGFLEEPMELADGDIQFRPRTGKAAASPLLPEVEAYLQLLLVVHLTTNKRYAEAQRASDDLMQKISSKKSRALDLIAAKCYYHHARVYELLQQLHAIRSFLHSRLRTATLRHDADGQAVLLNLLLRNYLHFSLYDQAEKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYSEARRTLTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRIFLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGFVQSKETMDIYGTREPQLAFHQRISFCLDIHNMSVKAMRFPPKAYNKDLESAEERREREQQDLEFAKEMAEDDDDSF 515          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Medaka
Match: psmd3 (proteasome 26S subunit, non-ATPase 3 [Source:NCBI gene;Acc:101170162])

HSP 1 Score: 453.366 bits (1165), Expect = 8.496e-155
Identity = 246/441 (55.78%), Postives = 322/441 (73.02%), Query Frame = 3
Query:  189 TLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXXXXXXXX--XXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAED 1505
            TLEDI++ +K IEK+V  KE  ++ R +R++    ++LN  V  + V G++ ++ S + +   +L E  D D+    F PR+ ++ +     E+     LLL++ L  N+R  E+ + S+ LM+++S    R++D++AAKCY++H+  YE   +L AIR FL++RLRT TLR D  GQA ++NLLLRNYL ++LYDQA KLVSK  +PE  +NN+ ARYLYY GRIKAIQL+YS A + LT+ALRKAPQ++AVGFKQ VHKL  VVELLLGE PDR  FR P+LK  L+PYF LTQ VR G+L +FN+VL+ FG KF AD TYTLI+R+RHNVIKTGVR+++LSYS I L  IA KLQL SPEDAEFIVAKAI+D VI A I H+KG V +KE+ D+Y T EP   FHQRI FCLDIHN SVKAMR+PPK Y+K+LESAE+
Sbjct:   52 TLEDIKEHVKQIEKAVSGKEPRFVLRALRALPSTSRRLNANVLHKTVCGFFTSSASTREFLLGFLEELADGDIQ---FRPRTGKAAASPLLPEVEAYLQLLLVVHLTTNKRYAEAQRASDDLMQKISSKKSRALDLIAAKCYYHHARVYELLQQLHAIRSFLHSRLRTATLRHDADGQAVLLNLLLRNYLHFSLYDQAEKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYSEARRTLTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRIFLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGFVQSKETMDIYGTREPQLAFHQRISFCLDIHNMSVKAMRFPPKAYNKDLESAEN 489          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Planmine SMEST
Match: SMESG000066329.1 (SMESG000066329.1)

HSP 1 Score: 919.457 bits (2375), Expect = 0.000e+0
Identity = 490/491 (99.80%), Postives = 490/491 (99.80%), Query Frame = 3
Query:  102 MATAVLTSQVEKLPIVKNNVELVKDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXXXXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            MATAVLT QVEKLPIVKNNVELVKDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSLLPEVEMFLHLLLLIFLVDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIINLLLRNYLTYNLYDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDRREREQQELDSANNLTDDEFDGF
Sbjct:    1 MATAVLTPQVEKLPIVKNNVELVKDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSLLPEVEMFLHLLLLIFLVDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIINLLLRNYLTYNLYDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDRREREQQELDSANNLTDDEFDGF 491          
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Planmine SMEST
Match: SMESG000066317.1 (SMESG000066317.1)

HSP 1 Score: 879.396 bits (2271), Expect = 0.000e+0
Identity = 470/491 (95.72%), Postives = 476/491 (96.95%), Query Frame = 3
Query:  102 MATAVLTSQVEKLPIVKNNVELVKDVNLPTLEDIRDQIKLIEKSVLTKESHYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDTDLTLLPFSPRSKQSQSXXXXXXXXXXXXXXXXXXDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRKDCHGQAAIIXXXXXXXXXXXXXDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDXXXXXXXXLDSANNLTDDEFDGF 1574
            MAT +L    EKLP +K N E +KD+NLPTLEDIRDQIKLIEKSV+TKE HYMTRVVRSIFRIRKKLNC VF RL+NGYYPNTCSQKTYF EYLPEAMDTDLTLLPFSPRSKQ QSLLPEVEMFLHLLLLIFLVDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLR CTLRKDCHGQAAIINLLLRNYLTYNLYDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDRREREQQELDSANNLTDDEFDGF
Sbjct:    1 MATDILVPVNEKLPSIKINAEHIKDINLPTLEDIRDQIKLIEKSVVTKECHYMTRVVRSIFRIRKKLNCDVFRRLINGYYPNTCSQKTYFIEYLPEAMDTDLTLLPFSPRSKQYQSLLPEVEMFLHLLLLIFLVDNERKEESVKCSNLLMERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRMCTLRKDCHGQAAIINLLLRNYLTYNLYDQANKLVSKVNYPEEPSNNDLARYLYYLGRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQPDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTYTLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAIKDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVKAMRYPPKYYHKELESAEDRREREQQELDSANNLTDDEFDGF 491          
The following BLAST results are available for this feature:
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PSMD31.448e-16157.23proteasome 26S subunit, non-ATPase 3 [Source:HGNC ... [more]
PSMD32.455e-1954.17proteasome 26S subunit, non-ATPase 3 [Source:HGNC ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpn-34.526e-9739.4926S proteasome non-ATPase regulatory subunit 3 [S... [more]
rpn-34.526e-9739.4926S proteasome non-ATPase regulatory subunit 3 [S... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rpn31.864e-13750.21gene:FBgn0261396 transcript:FBtr0336843[more]
Rpn31.864e-13750.21gene:FBgn0261396 transcript:FBtr0302289[more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
psmd31.351e-15856.05proteasome 26S subunit, non-ATPase 3 [Source:ZFIN;... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSMD31.456e-15656.38proteasome 26S subunit, non-ATPase 3 [Source:NCBI ... [more]
PSMD32.071e-15557.70proteasome 26S subunit, non-ATPase 3 [Source:NCBI ... [more]
PSMD34.515e-15557.51proteasome 26S subunit, non-ATPase 3 [Source:NCBI ... [more]
PSMD33.008e-15457.61proteasome 26S subunit, non-ATPase 3 [Source:NCBI ... [more]
PSMD35.291e-14859.67proteasome 26S subunit, non-ATPase 3 [Source:NCBI ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Psmd31.404e-16057.02proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd36.683e-7460.73proteasome (prosome, macropain) 26S subunit, non-A... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43242|PSMD3_HUMAN6.952e-16157.2326S proteasome non-ATPase regulatory subunit 3 OS=... [more]
sp|Q2KJ46|PSMD3_BOVIN1.171e-16057.4526S proteasome non-ATPase regulatory subunit 3 OS=... [more]
sp|P14685|PSMD3_MOUSE9.820e-16057.0226S proteasome non-ATPase regulatory subunit 3 OS=... [more]
sp|Q9U5Z8|PSMD3_ANOST1.325e-14053.39Probable 26S proteasome non-ATPase regulatory subu... [more]
sp|O61470|PSMD3_ANOGA6.722e-13854.03Probable 26S proteasome non-ATPase regulatory subu... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NLG50.000e+062.4726S proteasome regulatory subunit N3 OS=Paragonimu... [more]
A0A4S2LIY00.000e+065.03PCI domain-containing protein OS=Opisthorchis feli... [more]
A0A075A1S00.000e+065.03PCI domain-containing protein OS=Opisthorchis vive... [more]
A0A4Z2CRH20.000e+064.8326S proteasome non-ATPase regulatory subunit 3 iso... [more]
Q5DF740.000e+064.41SJCHGC06456 protein OS=Schistosoma japonicum OX=61... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
psmd31.041e-16057.97proteasome 26S subunit, non-ATPase 3 [Source:NCBI ... [more]
psmd39.366e-14957.51proteasome 26S subunit, non-ATPase 3 [Source:NCBI ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
psmd38.147e-15155.19proteasome 26S subunit, non-ATPase 3 [Source:ZFIN;... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RPN32.445e-6635.80Essential non-ATPase regulatory subunit of the 26S... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO339691.511e-15356.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
psmd36.235e-15655.39proteasome 26S subunit, non-ATPase 3 [Source:NCBI ... [more]
psmd38.496e-15555.78proteasome 26S subunit, non-ATPase 3 [Source:NCBI ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000066329.10.000e+099.80SMESG000066329.1[more]
SMESG000066317.10.000e+095.72SMESG000066317.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006521 ID=SMED30006521|Name=26S proteasome non-ATPase regulatory subunit 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1682bp
CGAAAATTAATCGCCTTTTTTAAAATTATTATAACTTATATTATAATTCA
AATTTTCATTATTAAGCTAACATTTATTAGAGTTGATTTTCAGCAGCAAT
AATGGCAACTGCTGTTCTTACTTCCCAAGTTGAAAAATTACCAATAGTTA
AAAATAATGTTGAACTTGTTAAAGATGTTAATCTACCAACTCTGGAAGAT
ATTCGAGATCAGATCAAGCTTATCGAAAAATCTGTTTTGACTAAAGAGTC
TCATTATATGACGAGAGTTGTTAGAAGTATTTTTAGAATAAGGAAGAAGT
TAAATTGTATTGTTTTTCTACGATTAGTTAATGGTTATTATCCTAATACG
TGTTCACAAAAAACATATTTTACTGAATATTTACCAGAAGCTATGGATAC
TGATTTAACACTATTACCATTTTCTCCACGATCAAAGCAATCTCAATCCT
TATTGCCGGAAGTGGAGATGTTTCTACATTTGCTTTTACTGATATTTTTA
GTAGATAATGAAAGGAAAGAAGAATCTGTTAAATGTTCAAATTTATTAAT
GGAAAGACTATCAGATTATAATCGTAGATCAATGGATATGGTGGCTGCCA
AATGTTATTTTTATCATAGTGTAGCATACGAAAAATCTGGCAAACTCGAT
GCTATCCGGCCATTTTTGTATGCCAGGTTGAGAACGTGTACTTTAAGAAA
AGATTGTCATGGCCAGGCCGCAATTATAAATCTTTTGCTGAGAAATTATT
TGACATATAACCTATACGATCAAGCTAACAAATTAGTAAGTAAAGTAAAT
TACCCAGAAGAACCTTCGAATAACGATCTTGCAAGATATTTATATTACCT
TGGAAGAATTAAAGCCATCCAACTTGATTATTCGGCAGCTCACCAGCATT
TAACATCTGCTTTAAGGAAAGCTCCTCAAAATAGTGCAGTTGGATTCAAA
CAAGCTGTTCATAAATTAAACACTGTGGTGGAGTTATTACTTGGTGAGCA
ACCTGACCGAGCCAATTTCCGAAATCCAGCTCTCAAATCGTGTCTTTTAC
CATATTTCCAGTTAACACAAACTGTCCGAGTTGGTGATCTTGGACAGTTT
AATAAAGTATTAGAAAATTTCGGAAATAAGTTTCTCGCTGATAAAACTTA
CACTCTTATTGTAAGGATGCGACATAATGTCATTAAAACCGGAGTCAGAT
TAATGGCATTGAGTTATTCGTGCATATCGTTAGAAAGTATTGCTAATAAA
TTACAATTGGGAAGTCCGGAAGATGCGGAATTTATAGTGGCTAAGGCAAT
CAAAGATGAGGTAATAAATGCAAGAATCTTTCACGACAAAGGTATCGTCT
CAACAAAAGAATCGCAAGACGTTTATTCAACTGGCGAGCCACTGACACAG
TTTCATCAACGCATTCGGTTCTGCCTTGATATCCATAATCAATCCGTCAA
GGCAATGCGATACCCTCCAAAGTACTATCATAAGGAGCTGGAAAGCGCTG
AGGATCGCAGGGAAAGGGAACAGCAAGAATTGGATAGTGCAAATAATCTG
ACTGATGATGAGTTCGATGGATTTTGATTTAATAAATCGGATATTTTTGT
GTTGAATTAGCGAATAATTTGTAATATTATGAATATAATTTGAAAATAAC
ATTGGAATATGGTTTTAGTAATATATGTTTCG
back to top

protein sequence of SMED30006521-orf-1

>SMED30006521-orf-1 ID=SMED30006521-orf-1|Name=SMED30006521-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=492bp
MATAVLTSQVEKLPIVKNNVELVKDVNLPTLEDIRDQIKLIEKSVLTKES
HYMTRVVRSIFRIRKKLNCIVFLRLVNGYYPNTCSQKTYFTEYLPEAMDT
DLTLLPFSPRSKQSQSLLPEVEMFLHLLLLIFLVDNERKEESVKCSNLLM
ERLSDYNRRSMDMVAAKCYFYHSVAYEKSGKLDAIRPFLYARLRTCTLRK
DCHGQAAIINLLLRNYLTYNLYDQANKLVSKVNYPEEPSNNDLARYLYYL
GRIKAIQLDYSAAHQHLTSALRKAPQNSAVGFKQAVHKLNTVVELLLGEQ
PDRANFRNPALKSCLLPYFQLTQTVRVGDLGQFNKVLENFGNKFLADKTY
TLIVRMRHNVIKTGVRLMALSYSCISLESIANKLQLGSPEDAEFIVAKAI
KDEVINARIFHDKGIVSTKESQDVYSTGEPLTQFHQRIRFCLDIHNQSVK
AMRYPPKYYHKELESAEDRREREQQELDSANNLTDDEFDGF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR035267PSMD3
IPR036390WH_DNA-bd_sf
IPR000717PCI_dom
IPR011991WHTH_DNA-bd_dom
IPR01358626S_Psome_reg_C
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0030234enzyme regulator activity
Vocabulary: biological process
TermDefinition
GO:0042176regulation of protein catabolic process
GO:0050790regulation of catalytic activity
Vocabulary: cellular component
TermDefinition
GO:0000502proteasome complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 463..483
NoneNo IPR availableSMARTSM00753PINTcoord: 351..441
e-value: 5.4E-20
score: 82.4
NoneNo IPR availableGENE3DG3DSA:1.25.40.570coord: 232..366
e-value: 2.7E-36
score: 126.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 462..491
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 462..479
NoneNo IPR availablePANTHERPTHR1075826S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 3/COP9 SIGNALOSOME COMPLEX SUBUNIT 3coord: 17..487
IPR000717Proteasome component (PCI) domainSMARTSM00088PINT_4coord: 351..441
e-value: 5.4E-20
score: 82.4
IPR000717Proteasome component (PCI) domainPFAMPF01399PCIcoord: 317..419
e-value: 9.6E-20
score: 71.1
IPR000717Proteasome component (PCI) domainPROSITEPS50250PCIcoord: 244..423
score: 29.605
IPR01358626S proteasome regulatory subunit, C-terminalPFAMPF08375Rpn3_Ccoord: 423..489
e-value: 2.2E-25
score: 88.9
IPR03526726S proteasome non-ATPase regulatory subunit 3PANTHERPTHR10758:SF226S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 3coord: 17..487
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 356..425