F-box domain-containing protein

Overview
NameF-box domain-containing protein
Smed IDSMED30006519
Length (bp)720
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of F-box domain-containing protein (SMED30006519) t-SNE clustered cells

Violin plots show distribution of expression levels for F-box domain-containing protein (SMED30006519) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of F-box domain-containing protein (SMED30006519) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for F-box domain-containing protein (SMED30006519) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006519

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006519SMESG000018134.1 SmedASXL_008916SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30006519SMESG000018134.1 dd_Smed_v6_11888_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of F-box domain-containing protein vs. Ensembl Human
Match: FBXO25 (F-box protein 25 [Source:HGNC Symbol;Acc:HGNC:13596])

HSP 1 Score: 65.4698 bits (158), Expect = 7.143e-12
Identity = 38/103 (36.89%), Postives = 58/103 (56.31%), Query Frame = 1
Query:  241 TSSGFYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            T S + +  I +   STKE     TLGE    LDF  AI+D RR  Y+ ++LQ++ K   +SLSG  Q    ++L +I+Q+V+   +   +I+ LL +L  TL
Sbjct:   78 TQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTL 180          
BLAST of F-box domain-containing protein vs. Ensembl Human
Match: FBXO25 (F-box protein 25 [Source:HGNC Symbol;Acc:HGNC:13596])

HSP 1 Score: 65.4698 bits (158), Expect = 7.499e-12
Identity = 38/103 (36.89%), Postives = 58/103 (56.31%), Query Frame = 1
Query:  241 TSSGFYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            T S + +  I +   STKE     TLGE    LDF  AI+D RR  Y+ ++LQ++ K   +SLSG  Q    ++L +I+Q+V+   +   +I+ LL +L  TL
Sbjct:   78 TQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTL 180          
BLAST of F-box domain-containing protein vs. Ensembl Human
Match: FBXO32 (F-box protein 32 [Source:HGNC Symbol;Acc:HGNC:16731])

HSP 1 Score: 61.2326 bits (147), Expect = 2.066e-10
Identity = 34/94 (36.17%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            I +   STKE     TLGE    LDF  AI D+RR  Y+ R+L+++ K   +SLSG  Q   +++L++++ +V++ +  + +IR LL  L  +L
Sbjct:   84 IYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSL 177          
BLAST of F-box domain-containing protein vs. Ensembl Human
Match: FBXO25 (F-box protein 25 [Source:HGNC Symbol;Acc:HGNC:13596])

HSP 1 Score: 57.7658 bits (138), Expect = 2.485e-9
Identity = 31/80 (38.75%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  310 TTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
             TLGE    LDF  AI+D RR  Y+ ++LQ++ K   +SLSG  Q    ++L +I+Q+V+   +   +I+ LL +L  TL
Sbjct:   34 CTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTL 113          
BLAST of F-box domain-containing protein vs. Ensembl Human
Match: FBXO25 (F-box protein 25 [Source:HGNC Symbol;Acc:HGNC:13596])

HSP 1 Score: 57.7658 bits (138), Expect = 2.485e-9
Identity = 31/80 (38.75%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  310 TTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
             TLGE    LDF  AI+D RR  Y+ ++LQ++ K   +SLSG  Q    ++L +I+Q+V+   +   +I+ LL +L  TL
Sbjct:   34 CTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTL 113          
BLAST of F-box domain-containing protein vs. Ensembl Celegans
Match: mfb-1 (MAFBx (F-box) protein homolog [Source:UniProtKB/TrEMBL;Acc:O45323])

HSP 1 Score: 50.8322 bits (120), Expect = 2.578e-7
Identity = 36/127 (28.35%), Postives = 62/127 (48.82%), Query Frame = 1
Query:  262 PHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVE-MKLLLEN 639
            PH  +K+ S KE +  T++ E    LD   A+ D RR  +IC+V+QIL ++   +LS   +  +L +L  I          ++  + L+    + L+N   +  GS QL   H ++    + L+ EN
Sbjct:  113 PHCFVKSTS-KEFIGCTSMSEAFHRLDLARAVNDVRRFNFICKVVQILVEEKLPNLSATARKSLLGILSAICFRSSNEDVNVSTAKDLVKQFGNGLDN--VNVCGSPQLVSRHHQTASSLLDLISEN 236          
BLAST of F-box domain-containing protein vs. Ensembl Fly
Match: CG11658 (gene:FBgn0036196 transcript:FBtr0076127)

HSP 1 Score: 68.1662 bits (165), Expect = 4.293e-13
Identity = 39/135 (28.89%), Postives = 70/135 (51.85%), Query Frame = 1
Query:  262 PHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLED--TLENKKF--DHVGSDQLWKSHSKSLVEMKLLLENISFKQ 654
            PH  +    T+E      L E +  LDF+ ++RD +R  YIC  L +++    +SL G  Q  +L +++E+   V  S+ + N++R L + LE   + EN+K     +GS  LWK H  ++  ++ +   I  ++
Sbjct:   59 PHYHITIRCTREIAGFNGLSEAVKRLDFRRSVRDRKRFHYICAFLLLVSNKGIASLPGSAQRQLLQMVEEVASHVNDSQQHPNVLRGLALKLEHIVSQENQKCWGKPLGSTYLWKEHMATIKRIQRVASQIEIRE 193          
BLAST of F-box domain-containing protein vs. Ensembl Fly
Match: CG11658 (gene:FBgn0036196 transcript:FBtr0076125)

HSP 1 Score: 68.1662 bits (165), Expect = 4.293e-13
Identity = 39/135 (28.89%), Postives = 70/135 (51.85%), Query Frame = 1
Query:  262 PHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLED--TLENKKF--DHVGSDQLWKSHSKSLVEMKLLLENISFKQ 654
            PH  +    T+E      L E +  LDF+ ++RD +R  YIC  L +++    +SL G  Q  +L +++E+   V  S+ + N++R L + LE   + EN+K     +GS  LWK H  ++  ++ +   I  ++
Sbjct:   59 PHYHITIRCTREIAGFNGLSEAVKRLDFRRSVRDRKRFHYICAFLLLVSNKGIASLPGSAQRQLLQMVEEVASHVNDSQQHPNVLRGLALKLEHIVSQENQKCWGKPLGSTYLWKEHMATIKRIQRVASQIEIRE 193          
BLAST of F-box domain-containing protein vs. Ensembl Fly
Match: CG11658 (gene:FBgn0036196 transcript:FBtr0076128)

HSP 1 Score: 68.1662 bits (165), Expect = 4.293e-13
Identity = 39/135 (28.89%), Postives = 70/135 (51.85%), Query Frame = 1
Query:  262 PHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLED--TLENKKF--DHVGSDQLWKSHSKSLVEMKLLLENISFKQ 654
            PH  +    T+E      L E +  LDF+ ++RD +R  YIC  L +++    +SL G  Q  +L +++E+   V  S+ + N++R L + LE   + EN+K     +GS  LWK H  ++  ++ +   I  ++
Sbjct:   59 PHYHITIRCTREIAGFNGLSEAVKRLDFRRSVRDRKRFHYICAFLLLVSNKGIASLPGSAQRQLLQMVEEVASHVNDSQQHPNVLRGLALKLEHIVSQENQKCWGKPLGSTYLWKEHMATIKRIQRVASQIEIRE 193          
BLAST of F-box domain-containing protein vs. Ensembl Fly
Match: CG11658 (gene:FBgn0036196 transcript:FBtr0076124)

HSP 1 Score: 68.1662 bits (165), Expect = 4.293e-13
Identity = 39/135 (28.89%), Postives = 70/135 (51.85%), Query Frame = 1
Query:  262 PHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLED--TLENKKF--DHVGSDQLWKSHSKSLVEMKLLLENISFKQ 654
            PH  +    T+E      L E +  LDF+ ++RD +R  YIC  L +++    +SL G  Q  +L +++E+   V  S+ + N++R L + LE   + EN+K     +GS  LWK H  ++  ++ +   I  ++
Sbjct:   59 PHYHITIRCTREIAGFNGLSEAVKRLDFRRSVRDRKRFHYICAFLLLVSNKGIASLPGSAQRQLLQMVEEVASHVNDSQQHPNVLRGLALKLEHIVSQENQKCWGKPLGSTYLWKEHMATIKRIQRVASQIEIRE 193          
BLAST of F-box domain-containing protein vs. Ensembl Fly
Match: CG11658 (gene:FBgn0036196 transcript:FBtr0076126)

HSP 1 Score: 68.1662 bits (165), Expect = 4.293e-13
Identity = 39/135 (28.89%), Postives = 70/135 (51.85%), Query Frame = 1
Query:  262 PHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLED--TLENKKF--DHVGSDQLWKSHSKSLVEMKLLLENISFKQ 654
            PH  +    T+E      L E +  LDF+ ++RD +R  YIC  L +++    +SL G  Q  +L +++E+   V  S+ + N++R L + LE   + EN+K     +GS  LWK H  ++  ++ +   I  ++
Sbjct:   59 PHYHITIRCTREIAGFNGLSEAVKRLDFRRSVRDRKRFHYICAFLLLVSNKGIASLPGSAQRQLLQMVEEVASHVNDSQQHPNVLRGLALKLEHIVSQENQKCWGKPLGSTYLWKEHMATIKRIQRVASQIEIRE 193          
BLAST of F-box domain-containing protein vs. Ensembl Zebrafish
Match: fbxo25 (F-box protein 25 [Source:ZFIN;Acc:ZDB-GENE-040801-19])

HSP 1 Score: 65.0846 bits (157), Expect = 2.870e-13
Identity = 35/99 (35.35%), Postives = 58/99 (58.59%), Query Frame = 1
Query:  253 FYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            F +  I ++  ST+E     TLGE    LDF  AI+D RR  Y+ ++LQ++ K   +SLSG  Q    ++L++I+++V++      +I+ LL +L  TL
Sbjct:   80 FQERWIYVQKESTRERHGYCTLGEAFNRLDFSSAIQDVRRFNYVVKLLQLIAKSQLTSLSGAAQKNYFNVLEKIVRKVLEDHQNPRLIKALLHDLSSTL 178          

HSP 2 Score: 28.4906 bits (62), Expect = 2.870e-13
Identity = 15/45 (33.33%), Postives = 26/45 (57.78%), Query Frame = 2
Query:    8 MAFVSKDWRDPGGIYIKSNIGHWESKKVYRLRIFEMLNENYLKRL 142
            M F+ +DWR PG  +IK+  G W+    +  ++ + +NE  L+ L
Sbjct:    1 MPFLGQDWRSPGWSWIKTEDG-WKRFDYFSHKLGDNINELGLEEL 44          
BLAST of F-box domain-containing protein vs. Ensembl Zebrafish
Match: fbxo25 (F-box protein 25 [Source:ZFIN;Acc:ZDB-GENE-040801-19])

HSP 1 Score: 65.0846 bits (157), Expect = 2.991e-13
Identity = 35/99 (35.35%), Postives = 58/99 (58.59%), Query Frame = 1
Query:  253 FYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            F +  I ++  ST+E     TLGE    LDF  AI+D RR  Y+ ++LQ++ K   +SLSG  Q    ++L++I+++V++      +I+ LL +L  TL
Sbjct:   80 FQERWIYVQKESTRERHGYCTLGEAFNRLDFSSAIQDVRRFNYVVKLLQLIAKSQLTSLSGAAQKNYFNVLEKIVRKVLEDHQNPRLIKALLHDLSSTL 178          

HSP 2 Score: 28.4906 bits (62), Expect = 2.991e-13
Identity = 15/45 (33.33%), Postives = 26/45 (57.78%), Query Frame = 2
Query:    8 MAFVSKDWRDPGGIYIKSNIGHWESKKVYRLRIFEMLNENYLKRL 142
            M F+ +DWR PG  +IK+  G W+    +  ++ + +NE  L+ L
Sbjct:    1 MPFLGQDWRSPGWSWIKTEDG-WKRFDYFSHKLGDNINELGLEEL 44          
BLAST of F-box domain-containing protein vs. Ensembl Zebrafish
Match: fbxo32 (F-box protein 32 [Source:ZFIN;Acc:ZDB-GENE-040426-1040])

HSP 1 Score: 63.5438 bits (153), Expect = 2.324e-11
Identity = 41/124 (33.06%), Postives = 69/124 (55.65%), Query Frame = 1
Query:  286 STKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL-----ENKKFDHVGSDQLWKSHSKSLVEMKLLLENI 642
            STKE     TLGE    LDF  AI+DTRR  Y+ R+L+++ K    SLSG  Q   +++L+ ++Q+V+  +  +  I+ LL  L  +L     +  K   VG+  +W    +++++ +  L+NI
Sbjct:   91 STKERHGYCTLGEAFNRLDFCSAIKDTRRFNYVVRLLELIAKSQLPSLSGVAQKNYMNILERVVQKVLDDQQNVRPIKELLQTLYASLCSLVQDMGKSVLVGNINIWVHRMENILQWQQQLDNI 214          
BLAST of F-box domain-containing protein vs. Ensembl Zebrafish
Match: fbxo25 (F-box protein 25 [Source:ZFIN;Acc:ZDB-GENE-040801-19])

HSP 1 Score: 54.299 bits (129), Expect = 4.462e-10
Identity = 27/71 (38.03%), Postives = 40/71 (56.34%), Query Frame = 1
Query:  253 FYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLL 465
            F +  I ++  ST+E     TLGE    LDF  AI+D RR  Y+ ++LQ++ K   +SLSG  Q    ++L
Sbjct:   80 FQERWIYVQKESTRERHGYCTLGEAFNRLDFSSAIQDVRRFNYVVKLLQLIAKSQLTSLSGAAQKNYFNVL 150          

HSP 2 Score: 28.4906 bits (62), Expect = 4.462e-10
Identity = 15/45 (33.33%), Postives = 26/45 (57.78%), Query Frame = 2
Query:    8 MAFVSKDWRDPGGIYIKSNIGHWESKKVYRLRIFEMLNENYLKRL 142
            M F+ +DWR PG  +IK+  G W+    +  ++ + +NE  L+ L
Sbjct:    1 MPFLGQDWRSPGWSWIKTEDG-WKRFDYFSHKLGDNINELGLEEL 44          
BLAST of F-box domain-containing protein vs. Ensembl Xenopus
Match: fbxo25 (F-box protein 25 [Source:NCBI gene;Acc:595094])

HSP 1 Score: 63.1586 bits (152), Expect = 4.144e-11
Identity = 42/139 (30.22%), Postives = 73/139 (52.52%), Query Frame = 1
Query:  253 FYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL-----ENKKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQ 654
            +++  I ++  ST+E     TLGE    LDF  AI D RR  Y+ ++LQ++ K   +SLSG  Q    ++L++I+Q+  + +    +IR LL +L  +L     E  +   VG+  +W S  +++   +  L N+   Q
Sbjct:   77 YHEKWIYIQKESTRERHGYCTLGEAFNRLDFSSAIWDIRRFNYVVKLLQLIAKSQLTSLSGAAQKNYFNILEKIVQKATEDQYNPRLIRELLQDLSSSLCILIQEVGRCVLVGNINIWISRLETIYSWQQQLMNLQITQ 215          
BLAST of F-box domain-containing protein vs. Ensembl Xenopus
Match: sdhaf2 (succinate dehydrogenase complex assembly factor 2 [Source:Xenbase;Acc:XB-GENE-990420])

HSP 1 Score: 62.003 bits (149), Expect = 1.207e-10
Identity = 41/130 (31.54%), Postives = 72/130 (55.38%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLEN-----KKFDHVGSDQLWKSHSKSLVEMKLLLENI 642
            I +   STKE     TLGE    LDF  AI D+R+  Y+ R+L+++ K   +SLSG  Q   +++L++++Q+V++ +  + +I+ LL  L  +L        K   VG+  +W    +++V+ +  L NI
Sbjct:   82 IYVHKGSTKERHGYCTLGEAFNRLDFSSAIHDSRKFNYVVRLLELIAKSQLTSLSGIAQKNYMNILEKVVQKVLEDQQNIRLIKELLHTLYTSLCTLVQRVGKSVLVGNINVWFYRMETIVDWQHQLNNI 211          
BLAST of F-box domain-containing protein vs. Ensembl Mouse
Match: Fbxo25 (F-box protein 25 [Source:MGI Symbol;Acc:MGI:1914072])

HSP 1 Score: 63.1586 bits (152), Expect = 3.535e-11
Identity = 38/104 (36.54%), Postives = 57/104 (54.81%), Query Frame = 1
Query:  241 TSSGFY-QPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
             +  FY +  I +   STKE     TLGE    LDF  AI+D RR  Y+ ++LQ++ K   +SLSG  Q    ++L +I+Q+V+       +I+ LL +L  TL
Sbjct:   76 AAHSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFTYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHQNPRLIKGLLQDLSSTL 179          
BLAST of F-box domain-containing protein vs. Ensembl Mouse
Match: Fbxo25 (F-box protein 25 [Source:MGI Symbol;Acc:MGI:1914072])

HSP 1 Score: 63.1586 bits (152), Expect = 3.689e-11
Identity = 38/104 (36.54%), Postives = 57/104 (54.81%), Query Frame = 1
Query:  241 TSSGFY-QPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
             +  FY +  I +   STKE     TLGE    LDF  AI+D RR  Y+ ++LQ++ K   +SLSG  Q    ++L +I+Q+V+       +I+ LL +L  TL
Sbjct:   76 AAHSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFTYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHQNPRLIKGLLQDLSSTL 179          
BLAST of F-box domain-containing protein vs. Ensembl Mouse
Match: Fbxo32 (F-box protein 32 [Source:MGI Symbol;Acc:MGI:1914981])

HSP 1 Score: 61.2326 bits (147), Expect = 1.379e-10
Identity = 34/94 (36.17%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            I +   STKE     TLGE    LDF  AI D+RR  Y+ R+L+++ K   +SLSG  Q   +++L++++ +V++ +  + +IR LL  L  +L
Sbjct:   84 IYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSL 177          
BLAST of F-box domain-containing protein vs. Ensembl Mouse
Match: Fbxo32 (F-box protein 32 [Source:MGI Symbol;Acc:MGI:1914981])

HSP 1 Score: 61.2326 bits (147), Expect = 1.379e-10
Identity = 34/94 (36.17%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            I +   STKE     TLGE    LDF  AI D+RR  Y+ R+L+++ K   +SLSG  Q   +++L++++ +V++ +  + +IR LL  L  +L
Sbjct:   84 IYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSL 177          
BLAST of F-box domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4R372|FBX25_MACFA (F-box only protein 25 OS=Macaca fascicularis OX=9541 GN=FBXO25 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 3.334e-11
Identity = 38/103 (36.89%), Postives = 58/103 (56.31%), Query Frame = 1
Query:  241 TSSGFYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            T S + +  I +   STKE     TLGE    LDF  AI+D RR  Y+ ++LQ++ K   +SLSG  Q    ++L +I+Q+V+   +   +I+ LL +L  TL
Sbjct:   78 TQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTL 180          
BLAST of F-box domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8TCJ0|FBX25_HUMAN (F-box only protein 25 OS=Homo sapiens OX=9606 GN=FBXO25 PE=1 SV=3)

HSP 1 Score: 65.4698 bits (158), Expect = 3.601e-11
Identity = 38/103 (36.89%), Postives = 58/103 (56.31%), Query Frame = 1
Query:  241 TSSGFYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            T S + +  I +   STKE     TLGE    LDF  AI+D RR  Y+ ++LQ++ K   +SLSG  Q    ++L +I+Q+V+   +   +I+ LL +L  TL
Sbjct:   78 TQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTL 180          
BLAST of F-box domain-containing protein vs. UniProt/SwissProt
Match: sp|Q1RMS8|FBX25_BOVIN (F-box only protein 25 OS=Bos taurus OX=9913 GN=FBXO25 PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 9.338e-11
Identity = 38/100 (38.00%), Postives = 57/100 (57.00%), Query Frame = 1
Query:  253 FYQPH-IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            FY+ + I +   ST+E     TLGE    LDF  AI+D RR  Y+ R+LQ++ K   +SLSG  Q    ++L +I+Q+V+       +I+ LL +L  TL
Sbjct:   81 FYRENWIYVHKESTRERHGYCTLGEAFNRLDFSSAIQDIRRFNYVVRLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLGDHQNPRLIKDLLQDLSSTL 180          
BLAST of F-box domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9D2Y6|FBX25_MOUSE (F-box only protein 25 OS=Mus musculus OX=10090 GN=Fbxo25 PE=1 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.473e-10
Identity = 38/104 (36.54%), Postives = 57/104 (54.81%), Query Frame = 1
Query:  241 TSSGFY-QPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
             +  FY +  I +   STKE     TLGE    LDF  AI+D RR  Y+ ++LQ++ K   +SLSG  Q    ++L +I+Q+V+       +I+ LL +L  TL
Sbjct:   76 AAHSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFTYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHQNPRLIKGLLQDLSSTL 179          
BLAST of F-box domain-containing protein vs. UniProt/SwissProt
Match: sp|Q641X7|FBX25_RAT (F-box only protein 25 OS=Rattus norvegicus OX=10116 GN=Fbxo25 PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 2.987e-10
Identity = 38/104 (36.54%), Postives = 57/104 (54.81%), Query Frame = 1
Query:  241 TSSGFY-QPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
             +  FY +  I +   STKE     TLGE    LDF  AI+D RR  Y+ ++LQ++ K   +SLSG  Q    ++L +I+Q+V+       +I+ LL +L  TL
Sbjct:   76 AAHSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFTYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHQNPRLIKDLLQDLSSTL 179          
BLAST of F-box domain-containing protein vs. TrEMBL
Match: G7YNF9 (F-box protein 25/32 OS=Clonorchis sinensis OX=79923 GN=CLF_103411 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.999e-31
Identity = 55/135 (40.74%), Postives = 89/135 (65.93%), Query Frame = 1
Query:  256 YQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQVI 660
            YQPH+ ++  + ++ V  TT+ E L+ LD K AIRD RR  Y+C+++QIL KD F  L+G++Q+++++LL+ IL +V  S N   ++R LL +L D LE  K+DH+GS  LW +H K++ EM   L+    ++ +
Sbjct:   72 YQPHVHLRAGTVRDVVTTTTISEALIGLDLKAAIRDVRRFNYVCKIIQILLKDHFHRLTGRLQLFLIELLRAILSQVQASCNQTAMLRQLLSDLLDNLERNKYDHIGSAMLWDNHRKAVGEMNAELDGFDIEKCL 206          

HSP 2 Score: 49.2914 bits (116), Expect = 1.999e-31
Identity = 30/82 (36.59%), Postives = 46/82 (56.10%), Query Frame = 2
Query:    8 MAFVSKDWRDPGGIYIKSN-IGH-WESKKVYRLRIFEMLNENYLKRLFIIYLVNYKFL*CKEHFPNLFLVIVSSMRYLNKLL 247
            M F+S DWR PG  +++S+  G  WE+ K+YRLR+FE +NE  ++R+            C++   +L      SM Y+N LL
Sbjct:    1 MPFLSPDWRYPGDRWLRSSECGSLWENAKIYRLRMFERMNETVVRRV------------CRQ---SLIEDTDQSMNYVNDLL 67          
BLAST of F-box domain-containing protein vs. TrEMBL
Match: A0A183R5X5 (F-box domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 8.446e-31
Identity = 56/146 (38.36%), Postives = 94/146 (64.38%), Query Frame = 1
Query:  253 FYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEMKLLLENISF-KQVIYYLLSSNYK 687
            FYQP+I ++  +T+E    TT+ E LL LD K A+RD RR  YIC+++++L  + F  L+G++Q+++++LLKE+L++V  S N     R LL  L + LE  ++DH+GS  LW++H K+L EM + ++     K++  +    +YK
Sbjct:   70 FYQPYIHLQAGTTREIATTTTISEALLKLDTKAALRDIRRFDYICKIIELLISEHFHRLAGRLQLFLIELLKEVLKQVQASCNQTERFRKLLDALRENLEKNEYDHIGSALLWQNHKKALDEMYIRIDEFDIEKKIQSFTTCPHYK 215          

HSP 2 Score: 56.9954 bits (136), Expect = 8.446e-31
Identity = 26/47 (55.32%), Postives = 35/47 (74.47%), Query Frame = 2
Query:    8 MAFVSKDWRDPGGIYIKSNIG--HWESKKVYRLRIFEMLNENYLKRL 142
            M F+S DWR PGG ++K+N     WE+ K+YRLR+FE +NEN +KRL
Sbjct:    1 MPFLSPDWRCPGGQWLKTNESGSMWENAKIYRLRMFETINENVVKRL 47          
BLAST of F-box domain-containing protein vs. TrEMBL
Match: G4VGQ1 (F-box domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_132210 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 9.325e-31
Identity = 56/146 (38.36%), Postives = 94/146 (64.38%), Query Frame = 1
Query:  253 FYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEMKLLLENISF-KQVIYYLLSSNYK 687
            FYQP+I ++  +T+E    TT+ E LL LD K A+RD RR  YIC+++++L  + F  L+G++Q+++++LLKE+L++V  S N     R LL  L + LE  ++DH+GS  LW++H K+L EM + ++     K++  +    +YK
Sbjct:   70 FYQPYIHLQAGTTREIATTTTISEALLKLDTKAALRDIRRFDYICKIIELLISEHFHRLAGRLQLFLIELLKEVLKQVQASCNQTERFRKLLDALRENLEKNEYDHIGSALLWQNHKKALDEMYIRIDEFDIEKKIQSFTTCPHYK 215          

HSP 2 Score: 56.9954 bits (136), Expect = 9.325e-31
Identity = 26/47 (55.32%), Postives = 35/47 (74.47%), Query Frame = 2
Query:    8 MAFVSKDWRDPGGIYIKSNIG--HWESKKVYRLRIFEMLNENYLKRL 142
            M F+S DWR PGG ++K+N     WE+ K+YRLR+FE +NEN +KRL
Sbjct:    1 MPFLSPDWRCPGGQWLKTNESGSMWENAKIYRLRMFETINENVVKRL 47          
BLAST of F-box domain-containing protein vs. TrEMBL
Match: A0A4Z2DL44 (F-box only protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_011321 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.944e-30
Identity = 50/123 (40.65%), Postives = 81/123 (65.85%), Query Frame = 1
Query:  253 FYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEM 621
            FYQP+I ++  +T+E    TT+ E L+ LD K A+RD RR  YIC+++++L  + F  L+G++Q+++++LL+E L++V  S N     R LL  L++ L   + DH+GS  LW+ H K+L EM
Sbjct:   70 FYQPYIHLQAGATREIATTTTISEALIKLDTKSALRDIRRFDYICKIVELLISEHFHRLTGRLQLFLIELLREALKQVQASCNQTERFRKLLDALKENLAKNEHDHIGSALLWQGHRKALDEM 192          

HSP 2 Score: 53.9138 bits (128), Expect = 1.944e-30
Identity = 25/47 (53.19%), Postives = 34/47 (72.34%), Query Frame = 2
Query:    8 MAFVSKDWRDPGGIYIKSNIG--HWESKKVYRLRIFEMLNENYLKRL 142
            M F+S DWR PG  ++KS+     WE+ K+YRLR+FE +NEN +KRL
Sbjct:    1 MPFLSPDWRCPGDQWLKSSESGSMWENAKIYRLRMFETMNENVVKRL 47          
BLAST of F-box domain-containing protein vs. TrEMBL
Match: U6IZ45 (F-box only protein 32 OS=Echinococcus granulosus OX=6210 GN=EGR_02623 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 3.086e-30
Identity = 56/135 (41.48%), Postives = 87/135 (64.44%), Query Frame = 1
Query:  256 YQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQVI 660
            +QPHI +   ST+E   V+T+ + LL LD K AIRD RR  Y+C++++ L  D   +++G+ Q+YI++LLK I+ +V+ S N   + R LL  L   LE  ++DH+GS QLW +H +SL +MK  L++   KQ +
Sbjct:   72 FQPHIRINLYSTREIATVSTITDALLKLDMKSAIRDVRRFNYVCKLVRRLLADRLHTMTGRSQLYIIELLKVIMHQVLGSCNQTLVFRQLLDTLRTNLERHEYDHIGSSQLWANHWESLTKMKATLDDFDIKQTL 206          

HSP 2 Score: 42.3578 bits (98), Expect = 3.086e-30
Identity = 25/73 (34.25%), Postives = 40/73 (54.79%), Query Frame = 2
Query:    8 MAFVSKDWRDPGGIYIKS--NIGHWESKKVYRLRIFEMLNENYLKRLFIIYLVNYKFL*CKEHFPNLFLVIVS 220
            M F+S DWR PG  +IKS  +   WE+ K +R ++F  +N+  LKR++   L + +     E F ++   IV 
Sbjct:    1 MPFLSPDWRCPGDKWIKSSEDGNTWENAKDWREKVFANMNDAALKRIYRQSLTDDRL--STEDFESMLANIVC 71          
BLAST of F-box domain-containing protein vs. Ensembl Cavefish
Match: fbxo32 (F-box protein 32 [Source:NCBI gene;Acc:103026917])

HSP 1 Score: 63.1586 bits (152), Expect = 2.394e-11
Identity = 42/130 (32.31%), Postives = 72/130 (55.38%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL-----ENKKFDHVGSDQLWKSHSKSLVEMKLLLENI 642
            I +   STKE     TLGE    LDF  AI+DTRR  Y+ R+L+++ K    SLSG  Q   +++L+ ++Q+V++ +  +  I+ LL  L  +L     +  K   VG+  +W    +++++ +  L+NI
Sbjct:   84 IYVHKGSTKERHGYCTLGEAFNRLDFCSAIKDTRRFNYVVRLLELIAKSQLPSLSGVAQKNYMNILERVVQKVLEDQQNVRPIKELLQTLYVSLCSLVQDMGKSVLVGNINIWVHRMENILQWQQQLDNI 213          
BLAST of F-box domain-containing protein vs. Ensembl Cavefish
Match: fbxo25 (F-box protein 25 [Source:NCBI gene;Acc:107197413])

HSP 1 Score: 60.077 bits (144), Expect = 3.011e-10
Identity = 32/94 (34.04%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            I ++  ST+E     TLGE    LDF  AI+D RR  Y+ ++L ++ K   +SLSG  Q    ++L++I+++V+       +I+ LL +L   L
Sbjct:   85 IYVQKESTRERHGYCTLGEAFNRLDFSSAIQDVRRFNYVVKLLHLIAKSQLTSLSGAAQKNYFNVLEKIVRKVLDDHQNPRLIKALLEDLSSVL 178          
BLAST of F-box domain-containing protein vs. Ensembl Cavefish
Match: fbxo25 (F-box protein 25 [Source:NCBI gene;Acc:107197413])

HSP 1 Score: 59.6918 bits (143), Expect = 3.515e-10
Identity = 32/94 (34.04%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            I ++  ST+E     TLGE    LDF  AI+D RR  Y+ ++L ++ K   +SLSG  Q    ++L++I+++V+       +I+ LL +L   L
Sbjct:   85 IYVQKESTRERHGYCTLGEAFNRLDFSSAIQDVRRFNYVVKLLHLIAKSQLTSLSGAAQKNYFNVLEKIVRKVLDDHQNPRLIKALLEDLSSVL 178          
BLAST of F-box domain-containing protein vs. Ensembl Cavefish
Match: fbxo25 (F-box protein 25 [Source:NCBI gene;Acc:107197413])

HSP 1 Score: 60.077 bits (144), Expect = 3.529e-10
Identity = 32/94 (34.04%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            I ++  ST+E     TLGE    LDF  AI+D RR  Y+ ++L ++ K   +SLSG  Q    ++L++I+++V+       +I+ LL +L   L
Sbjct:   85 IYVQKESTRERHGYCTLGEAFNRLDFSSAIQDVRRFNYVVKLLHLIAKSQLTSLSGAAQKNYFNVLEKIVRKVLDDHQNPRLIKALLEDLSSVL 178          
BLAST of F-box domain-containing protein vs. Ensembl Cavefish
Match: fbxo25 (F-box protein 25 [Source:NCBI gene;Acc:107197413])

HSP 1 Score: 60.077 bits (144), Expect = 3.573e-10
Identity = 32/94 (34.04%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            I ++  ST+E     TLGE    LDF  AI+D RR  Y+ ++L ++ K   +SLSG  Q    ++L++I+++V+       +I+ LL +L   L
Sbjct:   85 IYVQKESTRERHGYCTLGEAFNRLDFSSAIQDVRRFNYVVKLLHLIAKSQLTSLSGAAQKNYFNVLEKIVRKVLDDHQNPRLIKALLEDLSSVL 178          
BLAST of F-box domain-containing protein vs. Ensembl Sea Lamprey
Match: fbxo25 (F-box protein 25 [Source:ZFIN;Acc:ZDB-GENE-040801-19])

HSP 1 Score: 65.0846 bits (157), Expect = 1.193e-12
Identity = 35/94 (37.23%), Postives = 54/94 (57.45%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTL 549
            I +   STKE     TLGE    LDF  AI D RR  Y+ R+LQ++ +   +SLSG  Q    ++L++I+ +V+K +  + +I+ LL  L  +L
Sbjct:   86 IYVHKGSTKERHGYCTLGEAFNRLDFSAAIHDRRRFTYVVRLLQLIAQSQLTSLSGAAQKNYFNILEKIVNKVLKDQENIRLIKELLQGLHTSL 179          
BLAST of F-box domain-containing protein vs. Ensembl Medaka
Match: fbxo25 (F-box protein 25 [Source:NCBI gene;Acc:101158321])

HSP 1 Score: 64.6994 bits (156), Expect = 7.835e-12
Identity = 41/141 (29.08%), Postives = 76/141 (53.90%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLEN-----KKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQVIYYLLS 675
            I ++  STKE     TLGE L  LDF  AI+D RR  Y+ ++ Q++ +    SLSG  Q    ++L++I+++V++      +++ LL +L  TL +      +   VG+  +W    +++V+ +  L ++   + IY  +S
Sbjct:   83 IYVQKGSTKERHGYCTLGEALNRLDFSSAIQDVRRFNYVAKLFQLIARSQLPSLSGAAQKNYFNILEKIVRKVLEDHYNPRLVKELLQDLNSTLHSLTLHVGRCVLVGNVNIWLCRLETIVKWQQELNDLEIPKQIYSGMS 223          
BLAST of F-box domain-containing protein vs. Ensembl Medaka
Match: fbxo25 (F-box protein 25 [Source:NCBI gene;Acc:101158321])

HSP 1 Score: 64.3142 bits (155), Expect = 9.978e-12
Identity = 41/141 (29.08%), Postives = 76/141 (53.90%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLEN-----KKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQVIYYLLS 675
            I ++  STKE     TLGE L  LDF  AI+D RR  Y+ ++ Q++ +    SLSG  Q    ++L++I+++V++      +++ LL +L  TL +      +   VG+  +W    +++V+ +  L ++   + IY  +S
Sbjct:   69 IYVQKGSTKERHGYCTLGEALNRLDFSSAIQDVRRFNYVAKLFQLIARSQLPSLSGAAQKNYFNILEKIVRKVLEDHYNPRLVKELLQDLNSTLHSLTLHVGRCVLVGNVNIWLCRLETIVKWQQELNDLEIPKQIYSGMS 209          
BLAST of F-box domain-containing protein vs. Ensembl Medaka
Match: fbxo25 (F-box protein 25 [Source:NCBI gene;Acc:101158321])

HSP 1 Score: 64.3142 bits (155), Expect = 9.998e-12
Identity = 41/141 (29.08%), Postives = 76/141 (53.90%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLEN-----KKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQVIYYLLS 675
            I ++  STKE     TLGE L  LDF  AI+D RR  Y+ ++ Q++ +    SLSG  Q    ++L++I+++V++      +++ LL +L  TL +      +   VG+  +W    +++V+ +  L ++   + IY  +S
Sbjct:   85 IYVQKGSTKERHGYCTLGEALNRLDFSSAIQDVRRFNYVAKLFQLIARSQLPSLSGAAQKNYFNILEKIVRKVLEDHYNPRLVKELLQDLNSTLHSLTLHVGRCVLVGNVNIWLCRLETIVKWQQELNDLEIPKQIYSGMS 225          
BLAST of F-box domain-containing protein vs. Ensembl Medaka
Match: fbxo25 (F-box protein 25 [Source:NCBI gene;Acc:101158321])

HSP 1 Score: 64.3142 bits (155), Expect = 1.048e-11
Identity = 41/141 (29.08%), Postives = 76/141 (53.90%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLEN-----KKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQVIYYLLS 675
            I ++  STKE     TLGE L  LDF  AI+D RR  Y+ ++ Q++ +    SLSG  Q    ++L++I+++V++      +++ LL +L  TL +      +   VG+  +W    +++V+ +  L ++   + IY  +S
Sbjct:   85 IYVQKGSTKERHGYCTLGEALNRLDFSSAIQDVRRFNYVAKLFQLIARSQLPSLSGAAQKNYFNILEKIVRKVLEDHYNPRLVKELLQDLNSTLHSLTLHVGRCVLVGNVNIWLCRLETIVKWQQELNDLEIPKQIYSGMS 225          
BLAST of F-box domain-containing protein vs. Ensembl Medaka
Match: fbxo25 (F-box protein 25 [Source:NCBI gene;Acc:101158321])

HSP 1 Score: 64.3142 bits (155), Expect = 1.048e-11
Identity = 41/141 (29.08%), Postives = 76/141 (53.90%), Query Frame = 1
Query:  268 IVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLEN-----KKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQVIYYLLS 675
            I ++  STKE     TLGE L  LDF  AI+D RR  Y+ ++ Q++ +    SLSG  Q    ++L++I+++V++      +++ LL +L  TL +      +   VG+  +W    +++V+ +  L ++   + IY  +S
Sbjct:   85 IYVQKGSTKERHGYCTLGEALNRLDFSSAIQDVRRFNYVAKLFQLIARSQLPSLSGAAQKNYFNILEKIVRKVLEDHYNPRLVKELLQDLNSTLHSLTLHVGRCVLVGNVNIWLCRLETIVKWQQELNDLEIPKQIYSGMS 225          
BLAST of F-box domain-containing protein vs. Planmine SMEST
Match: SMESG000018134.1 (SMESG000018134.1)

HSP 1 Score: 288.886 bits (738), Expect = 8.027e-99
Identity = 160/169 (94.67%), Postives = 163/169 (96.45%), Query Frame = 1
Query:  151 IFSKL*ISVM*RAFXXXXXXXXXXXXVFKQTSSGFYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQV 657
            IF  L  + + RAFSESISGN+IINEVFKQTSSGFYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQV
Sbjct:   33 IFEMLNENYLKRAFSESISGNNIINEVFKQTSSGFYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQV 201          

HSP 2 Score: 99.3673 bits (246), Expect = 5.080e-25
Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = 2
Query:    8 MAFVSKDWRDPGGIYIKSNIGHWESKKVYRLRIFEMLNENYLKRLF 145
            MAFVSKDWRDPGGIYIKSNIGHWESKKVYRLRIFEMLNENYLKR F
Sbjct:    1 MAFVSKDWRDPGGIYIKSNIGHWESKKVYRLRIFEMLNENYLKRAF 46          
BLAST of F-box domain-containing protein vs. Planmine SMEST
Match: SMESG000018134.1 (SMESG000018134.1)

HSP 1 Score: 288.5 bits (737), Expect = 6.368e-98
Identity = 157/158 (99.37%), Postives = 158/158 (100.00%), Query Frame = 1
Query:  184 RAFXXXXXXXXXXXXVFKQTSSGFYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQV 657
            RAFSESISGN+IINEVFKQTSSGFYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQV
Sbjct:    9 RAFSESISGNNIINEVFKQTSSGFYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQV 166          
BLAST of F-box domain-containing protein vs. Planmine SMEST
Match: SMESG000018134.1 (SMESG000018134.1)

HSP 1 Score: 288.886 bits (738), Expect = 1.450e-97
Identity = 160/169 (94.67%), Postives = 163/169 (96.45%), Query Frame = 1
Query:  151 IFSKL*ISVM*RAFXXXXXXXXXXXXVFKQTSSGFYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQV 657
            IF  L  + + RAFSESISGN+IINEVFKQTSSGFYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQV
Sbjct:   33 IFEMLNENYLKRAFSESISGNNIINEVFKQTSSGFYQPHIVMKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFSSLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHVGSDQLWKSHSKSLVEMKLLLENISFKQV 201          

HSP 2 Score: 98.5969 bits (244), Expect = 4.156e-24
Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = 2
Query:    8 MAFVSKDWRDPGGIYIKSNIGHWESKKVYRLRIFEMLNENYLKRLF 145
            MAFVSKDWRDPGGIYIKSNIGHWESKKVYRLRIFEMLNENYLKR F
Sbjct:    1 MAFVSKDWRDPGGIYIKSNIGHWESKKVYRLRIFEMLNENYLKRAF 46          
The following BLAST results are available for this feature:
BLAST of F-box domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBXO257.143e-1236.89F-box protein 25 [Source:HGNC Symbol;Acc:HGNC:1359... [more]
FBXO257.499e-1236.89F-box protein 25 [Source:HGNC Symbol;Acc:HGNC:1359... [more]
FBXO322.066e-1036.17F-box protein 32 [Source:HGNC Symbol;Acc:HGNC:1673... [more]
FBXO252.485e-938.75F-box protein 25 [Source:HGNC Symbol;Acc:HGNC:1359... [more]
FBXO252.485e-938.75F-box protein 25 [Source:HGNC Symbol;Acc:HGNC:1359... [more]
back to top
BLAST of F-box domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mfb-12.578e-728.35MAFBx (F-box) protein homolog [Source:UniProtKB/T... [more]
back to top
BLAST of F-box domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG116584.293e-1328.89gene:FBgn0036196 transcript:FBtr0076127[more]
CG116584.293e-1328.89gene:FBgn0036196 transcript:FBtr0076125[more]
CG116584.293e-1328.89gene:FBgn0036196 transcript:FBtr0076128[more]
CG116584.293e-1328.89gene:FBgn0036196 transcript:FBtr0076124[more]
CG116584.293e-1328.89gene:FBgn0036196 transcript:FBtr0076126[more]
back to top
BLAST of F-box domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fbxo252.870e-1335.35F-box protein 25 [Source:ZFIN;Acc:ZDB-GENE-040801-... [more]
fbxo252.991e-1335.35F-box protein 25 [Source:ZFIN;Acc:ZDB-GENE-040801-... [more]
fbxo322.324e-1133.06F-box protein 32 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
fbxo254.462e-1038.03F-box protein 25 [Source:ZFIN;Acc:ZDB-GENE-040801-... [more]
back to top
BLAST of F-box domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fbxo254.144e-1130.22F-box protein 25 [Source:NCBI gene;Acc:595094][more]
sdhaf21.207e-1031.54succinate dehydrogenase complex assembly factor 2 ... [more]
back to top
BLAST of F-box domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Fbxo253.535e-1136.54F-box protein 25 [Source:MGI Symbol;Acc:MGI:191407... [more]
Fbxo253.689e-1136.54F-box protein 25 [Source:MGI Symbol;Acc:MGI:191407... [more]
Fbxo321.379e-1036.17F-box protein 32 [Source:MGI Symbol;Acc:MGI:191498... [more]
Fbxo321.379e-1036.17F-box protein 32 [Source:MGI Symbol;Acc:MGI:191498... [more]
back to top
BLAST of F-box domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4R372|FBX25_MACFA3.334e-1136.89F-box only protein 25 OS=Macaca fascicularis OX=95... [more]
sp|Q8TCJ0|FBX25_HUMAN3.601e-1136.89F-box only protein 25 OS=Homo sapiens OX=9606 GN=F... [more]
sp|Q1RMS8|FBX25_BOVIN9.338e-1138.00F-box only protein 25 OS=Bos taurus OX=9913 GN=FBX... [more]
sp|Q9D2Y6|FBX25_MOUSE2.473e-1036.54F-box only protein 25 OS=Mus musculus OX=10090 GN=... [more]
sp|Q641X7|FBX25_RAT2.987e-1036.54F-box only protein 25 OS=Rattus norvegicus OX=1011... [more]
back to top
BLAST of F-box domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YNF91.999e-3140.74F-box protein 25/32 OS=Clonorchis sinensis OX=7992... [more]
A0A183R5X58.446e-3138.36F-box domain-containing protein OS=Schistosoma rod... [more]
G4VGQ19.325e-3138.36F-box domain-containing protein OS=Schistosoma man... [more]
A0A4Z2DL441.944e-3040.65F-box only protein isoform 1 OS=Schistosoma japoni... [more]
U6IZ453.086e-3041.48F-box only protein 32 OS=Echinococcus granulosus O... [more]
back to top
BLAST of F-box domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo322.394e-1132.31F-box protein 32 [Source:NCBI gene;Acc:103026917][more]
fbxo253.011e-1034.04F-box protein 25 [Source:NCBI gene;Acc:107197413][more]
fbxo253.515e-1034.04F-box protein 25 [Source:NCBI gene;Acc:107197413][more]
fbxo253.529e-1034.04F-box protein 25 [Source:NCBI gene;Acc:107197413][more]
fbxo253.573e-1034.04F-box protein 25 [Source:NCBI gene;Acc:107197413][more]
back to top
BLAST of F-box domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fbxo251.193e-1237.23F-box protein 25 [Source:ZFIN;Acc:ZDB-GENE-040801-... [more]
back to top
BLAST of F-box domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of F-box domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of F-box domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo257.835e-1229.08F-box protein 25 [Source:NCBI gene;Acc:101158321][more]
fbxo259.978e-1229.08F-box protein 25 [Source:NCBI gene;Acc:101158321][more]
fbxo259.998e-1229.08F-box protein 25 [Source:NCBI gene;Acc:101158321][more]
fbxo251.048e-1129.08F-box protein 25 [Source:NCBI gene;Acc:101158321][more]
fbxo251.048e-1129.08F-box protein 25 [Source:NCBI gene;Acc:101158321][more]
back to top
BLAST of F-box domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000018134.18.027e-9994.67SMESG000018134.1[more]
SMESG000018134.16.368e-9899.37SMESG000018134.1[more]
SMESG000018134.11.450e-9794.67SMESG000018134.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006519 ID=SMED30006519|Name=F-box domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=720bp
CAACTTCATGGCTTTTGTAAGCAAAGATTGGAGAGATCCAGGTGGGATTT
ATATTAAATCCAATATCGGTCATTGGGAGTCTAAAAAAGTATATAGATTA
CGAATTTTTGAAATGTTAAACGAAAATTATTTAAAGAGGTTATTTATTAT
ATATTTAGTAAATTATAAATTTCTGTGATGTAAAGAGCATTTTCCGAATC
TATTTCTGGTAATAGTATCATCAATGAGGTATTTAAACAAACTTCTTCTG
GATTTTATCAGCCACATATTGTTATGAAAAATATGTCCACAAAGGAAAGC
GTAATTGTCACAACTCTGGGTGAAACACTGCTGGCTCTGGACTTTAAAGT
CGCAATTAGAGACACCAGGCGAGTGGGATATATTTGTCGAGTTTTACAAA
TATTAACTAAAGATATGTTTTCAAGTTTATCTGGTCAAGTTCAAATATAC
ATTTTGGATTTATTGAAAGAAATTTTGCAAGAAGTCATCAAAAGCAAGAA
CTATCTCAATATCATACGAATGTTGTTAATTAATCTTGAAGATACTTTGG
AAAATAAAAAATTTGATCATGTTGGAAGTGATCAATTATGGAAAAGTCAC
AGTAAATCATTAGTCGAAATGAAATTATTGTTGGAAAATATTTCTTTTAA
GCAGGTAATTTATTATTTATTATCTTCCAATTACAAATGTTCTTTTTACT
ATTTTACAGTGTGAATTTCT
back to top

protein sequence of SMED30006519-orf-1

>SMED30006519-orf-1 ID=SMED30006519-orf-1|Name=SMED30006519-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
MKNMSTKESVIVTTLGETLLALDFKVAIRDTRRVGYICRVLQILTKDMFS
SLSGQVQIYILDLLKEILQEVIKSKNYLNIIRMLLINLEDTLENKKFDHV
GSDQLWKSHSKSLVEMKLLLENISFKQVIYYLLSSNYKCSFYYFTV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005634nucleus
GO:0019005SCF ubiquitin ligase complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR040394FBX25/32
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR040394F-box only protein 25/32PANTHERPTHR13123FAMILY NOT NAMEDcoord: 3..126