Glycine cleavage system P protein

Overview
NameGlycine cleavage system P protein
Smed IDSMED30006517
Length (bp)3489
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine cleavage system P protein (SMED30006517) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine cleavage system P protein (SMED30006517) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine cleavage system P protein (SMED30006517) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine cleavage system P protein (SMED30006517) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006517

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30006517SMESG000022206.1 dd_Smed_v4_1833_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30006517SMESG000013161.1 Contig1396GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006517SMESG000022206.1 Contig1396GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycine cleavage system P protein vs. Ensembl Human
Match: GLDC (glycine decarboxylase [Source:HGNC Symbol;Acc:HGNC:4313])

HSP 1 Score: 1115.52 bits (2884), Expect = 0.000e+0
Identity = 558/974 (57.29%), Postives = 727/974 (74.64%), Query Frame = 3
Query:  261 KRFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +R   +  +F +RHIGP + D++ ML+ LG+ +I E+IE T+P +I+ ++ +K+ DP+ E E++  L  I+ +N++WRSYIGMGY +C +P  I RN+ EN GWIT YTPYQPE+SQGRLESLLN+QTM+CD+TG+++ANASLLDEGTAAAEAL +  R N+R+KF +D RCH QTI VV+TRA   G+          DFS K+ +GVL QYPDT G +  +  ++VE A QS ++   A DLL+  IL+PPGE+ +DI +GSSQRFG+PLGYGGPHAAFFA ++  +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AM+A+YHG  GL+ IA R+H  TLIL+EG    GH++ +D L FDTL I  G   ++        +  RA   +IN +   D ++ +SLDETV   DL+DLL IF    S   +  ++ ++   +      +   RTS +LTH VFNS+HSET +VRYMKKLENKD+SLVHSMIPLGSCTMKLNS+ EL   +W EF+ IHPFVP++Q QGY +LF++LE+DLCE+TGY++   QPNSGAQGEYAGL  I +Y     + +R +CLIP SAHGTNPASA MAGM ++PV+V+K G +D   L+  + K+++NLAAIM+TYPSTNGVF+++I  +CD++H++GGQVYLDGANMNAQVG+CRPGD+GSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAP+LP H ++                G V++AP+GS+SILPISWAYIK+MG +GLKQA+E AILNANYM KRL+ +Y+  F    G+  HEFI+D + F K+  IE +D++KRL DYGFH+PTMSWPV   LM+EPTESEDKAE DR CDA+I IR+EI  IEEG++D   NPLKM+PHS   V S +WDR Y+R +AA+P  + +    +KFWP+++RIDD YGDQ+L+C+CP +E
Sbjct:   54 ERLLPRHDDFARRHIGPGDKDQREMLQTLGLASIDELIEKTVPANIRLKRPLKMEDPVCENEILATLHAISSKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWITQYTPYQPEVSQGRLESLLNYQTMVCDITGLDMANASLLDEGTAAAEALQLCYRHNKRRKFLVDPRCHPQTIAVVQTRAKYTGVLTELKLPCEMDFSGKDVSGVLFQYPDTEGKV-EDFTELVERAHQSGSLACCATDLLALCILRPPGEFGVDIALGSSQRFGVPLGYGGPHAAFFAVRESLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLEHIARRVHNATLILSEGLKRAGHQLQHD-LFFDTLKIQCGCSVKE--------VLGRAAQRQINFRLFEDGTLGISLDETVNEKDLDDLLWIFGCESSAELVAESMGEECRGI----PGSVFKRTSPFLTHQVFNSYHSETNIVRYMKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVISLKRNEDAC-----PVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPE--NKFWPTIARIDDIYGDQHLVCTCPPME 1006          
BLAST of Glycine cleavage system P protein vs. Ensembl Human
Match: GLDC (glycine decarboxylase [Source:HGNC Symbol;Acc:HGNC:4313])

HSP 1 Score: 454.907 bits (1169), Expect = 5.792e-149
Identity = 243/405 (60.00%), Postives = 312/405 (77.04%), Query Frame = 3
Query: 1968 EKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            + F L   SGAQGEYAGL  I +Y     + +R +CLIP SAHGTNPASA MAGM ++PV+V+K G +D   L+  + K+++NLAAIM+TYPSTNGVF+++I  +CD++H++GGQVYLDGANMNAQVG+CRPGD+GSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAP+LP H ++                G V++AP+GS+SILPISWAYIK+MG +GLKQA+E AILNANYM KRL+ +Y+  F    G+  HEFI+D + F K+  IE +D++KRL DYGFH+PTMSWPV   LM+EPTESEDKAE DR CDA+I IR+EI  IEEG++D   NPLKM+PHS   V S +WDR Y+R +AA+P  + +    +KFWP+++RIDD YGDQ+L+C+CP +E
Sbjct:    9 DPFLLVFASGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVISLKRNEDAC-----PVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPE--NKFWPTIARIDDIYGDQHLVCTCPPME 406          
BLAST of Glycine cleavage system P protein vs. Ensembl Human
Match: GLDC (glycine decarboxylase [Source:HGNC Symbol;Acc:HGNC:4313])

HSP 1 Score: 403.675 bits (1036), Expect = 6.288e-130
Identity = 227/404 (56.19%), Postives = 289/404 (71.53%), Query Frame = 3
Query: 1968 EKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            + F L   SGAQGEYAGL  I +Y     + +R +CLIP SAHGTNPASA MAGM ++PV+V+K G +D   L+  + K+++NLAAIM+TYPSTNGVF+++I  +CD++H++GGQVYLDGANMNAQVG+CRPGD+GSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAP+LP H ++                G V++AP+GS+SILPISWAYIK+MG +GLKQA+E AILNANYM KRL+ +Y+  F                                   GFH+PTMSWPV   LM+EPTESEDKAE DR CDA+I IR+EI  IEEG++D   NPLKM+PHS   V S +WDR Y+R +AA+P  + +    +KFWP+++RIDD YGDQ+L+C+CP +E
Sbjct:    9 DPFLLVFASGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVISLKRNEDAC-----PVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYMAKRLETHYRILFRGAR-------------------------------GFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPE--NKFWPTIARIDDIYGDQHLVCTCPPME 374          
BLAST of Glycine cleavage system P protein vs. Ensembl Human
Match: GLDC (glycine decarboxylase [Source:HGNC Symbol;Acc:HGNC:4313])

HSP 1 Score: 258.07 bits (658), Expect = 9.170e-78
Identity = 126/211 (59.72%), Postives = 164/211 (77.73%), Query Frame = 3
Query: 2550 GPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFK-NCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            G V++AP+GS+SILPISWAYIK+MG +GLKQA+E AILNANYM KRL+ +Y+  F    G+  HEFI+D + FK +  IE +D++KRL DYGFH+PTMSWPV   LM+EPTESEDKAE DR CDA+I IR+EI  IEEG++D   NPLKM+PHS   V S +WDR Y+R +AA+P  + +    +KFWP+++RIDD YGDQ+L+C+CP +E
Sbjct:   32 GTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPE--NKFWPTIARIDDIYGDQHLVCTCPPME 240          
BLAST of Glycine cleavage system P protein vs. Ensembl Human
Match: GLDC (glycine decarboxylase [Source:HGNC Symbol;Acc:HGNC:4313])

HSP 1 Score: 235.343 bits (599), Expect = 5.214e-71
Identity = 105/161 (65.22%), Postives = 129/161 (80.12%), Query Frame = 3
Query:  858 DFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIH 1340
            DFS K+ +GVL QYPDT G +  +  ++VE A QS ++   A DLL+  IL+PPGE+ +DI +GSSQRFG+PLGYGGPHAAFFA ++  +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AM+A+YHG  GL+ IA R+H
Sbjct:    2 DFSGKDVSGVLFQYPDTEGKV-EDFTELVERAHQSGSLACCATDLLALCILRPPGEFGVDIALGSSQRFGVPLGYGGPHAAFFAVRESLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLEHIARRVH 161          
BLAST of Glycine cleavage system P protein vs. Ensembl Celegans
Match: gldc-1 (Glycine cleavage system P protein [Source:UniProtKB/TrEMBL;Acc:Q21962])

HSP 1 Score: 1033.86 bits (2672), Expect = 0.000e+0
Identity = 553/980 (56.43%), Postives = 688/980 (70.20%), Query Frame = 3
Query:  288 FIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYI-----RMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHA-FTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINR--------SNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDS--FGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            F+ RHIGP   +++ ML+ +G K + ++    +P  IK +K ++L  PL E +++  L  IA +NK++RSYIGMGY   I+PA I+RNI +N GWI+ YTPYQ EISQGRLESLLNFQTMI ++TG+   NASLLDE TA+AEA+ +  R  +R K  +DS CH Q +DV++TR+   GI+I   ++        + A V++QYP+T G I     +++E+A ++ ++ I+  DLLS TIL+ PG+   DI +GS+QRFG+PLGYGGPHA F A  K        R +PGR++GV+KD NGN A RLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGP+ L EIA  +H  T  LA      GH+I++    FDTL I       +L++ A     +KRAE +K+N +Y  D  + VSLDETV   DL D++   +              DVTKLR  R         N+  SR+S +L HPVFN+H SE  LVRYMK+LENKD+SLVHSMIPLGSCTMKLN++ EL   +WP  S IHPF P+ Q +GY+ +F  LE+ LCEITGY+ FSLQPNSGA GEYAGL  I +Y     +  R ICLIPTSAHGTNPASAQMA M V  V  +  G ++ KDL  +  KY + LAAIMVTYPST+GVF+  IR +CD VHE+GGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGVGPIGVK+HLA             L G +V  +D    G V SAP+GSASIL I+WAYI++MG  GL++AS+VAILNANYM KRL+  Y+  + +E G  AHEFI+DC+ FK  GIEV+DI+KRLMDYGFHSPTMSWPV   LMIEPTESEDKAE DRL +AL+ IREEIR +E G LD H NPLKMAPH+ E V SDNW+  Y+R +AA+P  W       K WP+V R+DD+YGD+NL+C+CP +E
Sbjct:   30 FVDRHIGPRRLEQQQMLDFIGYKDLDDLTGTNVPNMIKAEKALELPAPLDEYKMLKELEAIAAQNKIYRSYIGMGYYDTIVPAVISRNILQNIGWISQYTPYQAEISQGRLESLLNFQTMIAEMTGLPTTNASLLDEATASAEAVALAARTTKRNKIVVDSFCHPQNLDVIRTRSGPLGIDIEVSDSIEGYAFDDKVAAVVVQYPNTEGRIH-QFDELIESAHKNKSLVIMVCDLLSLTILRSPGDLGADIAVGSAQRFGVPLGYGGPHAGFMAVAKHDAKNALGRNIPGRIIGVTKDANGNRALRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPQRLTEIARGVHKSTAYLAYHLRNAGHEIVHKDY-FDTLKI-------RLKDKAALEETKKRAEEMKMNFRYYEDGDIGVSLDETVKSEDLMDIIYTLNGATE---------KDVTKLREERWEVACPLIGNSPHSRSSLFLQHPVFNTHQSEQQLVRYMKRLENKDVSLVHSMIPLGSCTMKLNASAELIPITWPTLSSIHPFAPVEQAKGYSRIFGDLEKWLCEITGYDNFSLQPNSGANGEYAGLLAIRNYLIHKGEEQRNICLIPTSAHGTNPASAQMANMKVVVVDSDHHGNINYKDLAAKAEKYSNQLAAIMVTYPSTHGVFESSIRDVCDKVHEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGVGPIGVKKHLA-----------PFLPGHSVVPVDGRKVGSVASAPYGSASILAITWAYIRMMGPVGLREASQVAILNANYMAKRLENDYRIVYKDEQGLVAHEFIMDCKPFKKHGIEVVDIAKRLMDYGFHSPTMSWPVHDCLMIEPTESEDKAEMDRLVEALLSIREEIRQVENGSLDKHLNPLKMAPHTLEKVTSDNWNMPYSRELAAFPKPW----CTHKAWPTVGRVDDQYGDRNLVCTCPPIE 976          
BLAST of Glycine cleavage system P protein vs. Ensembl Celegans
Match: gldc-1 (Glycine cleavage system P protein [Source:UniProtKB/TrEMBL;Acc:Q21962])

HSP 1 Score: 1033.86 bits (2672), Expect = 0.000e+0
Identity = 553/980 (56.43%), Postives = 688/980 (70.20%), Query Frame = 3
Query:  288 FIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYI-----RMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHA-FTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINR--------SNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDS--FGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            F+ RHIGP   +++ ML+ +G K + ++    +P  IK +K ++L  PL E +++  L  IA +NK++RSYIGMGY   I+PA I+RNI +N GWI+ YTPYQ EISQGRLESLLNFQTMI ++TG+   NASLLDE TA+AEA+ +  R  +R K  +DS CH Q +DV++TR+   GI+I   ++        + A V++QYP+T G I     +++E+A ++ ++ I+  DLLS TIL+ PG+   DI +GS+QRFG+PLGYGGPHA F A  K        R +PGR++GV+KD NGN A RLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGP+ L EIA  +H  T  LA      GH+I++    FDTL I       +L++ A     +KRAE +K+N +Y  D  + VSLDETV   DL D++   +              DVTKLR  R         N+  SR+S +L HPVFN+H SE  LVRYMK+LENKD+SLVHSMIPLGSCTMKLN++ EL   +WP  S IHPF P+ Q +GY+ +F  LE+ LCEITGY+ FSLQPNSGA GEYAGL  I +Y     +  R ICLIPTSAHGTNPASAQMA M V  V  +  G ++ KDL  +  KY + LAAIMVTYPST+GVF+  IR +CD VHE+GGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGVGPIGVK+HLA             L G +V  +D    G V SAP+GSASIL I+WAYI++MG  GL++AS+VAILNANYM KRL+  Y+  + +E G  AHEFI+DC+ FK  GIEV+DI+KRLMDYGFHSPTMSWPV   LMIEPTESEDKAE DRL +AL+ IREEIR +E G LD H NPLKMAPH+ E V SDNW+  Y+R +AA+P  W       K WP+V R+DD+YGD+NL+C+CP +E
Sbjct:   30 FVDRHIGPRRLEQQQMLDFIGYKDLDDLTGTNVPNMIKAEKALELPAPLDEYKMLKELEAIAAQNKIYRSYIGMGYYDTIVPAVISRNILQNIGWISQYTPYQAEISQGRLESLLNFQTMIAEMTGLPTTNASLLDEATASAEAVALAARTTKRNKIVVDSFCHPQNLDVIRTRSGPLGIDIEVSDSIEGYAFDDKVAAVVVQYPNTEGRIH-QFDELIESAHKNKSLVIMVCDLLSLTILRSPGDLGADIAVGSAQRFGVPLGYGGPHAGFMAVAKHDAKNALGRNIPGRIIGVTKDANGNRALRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPQRLTEIARGVHKSTAYLAYHLRNAGHEIVHKDY-FDTLKI-------RLKDKAALEETKKRAEEMKMNFRYYEDGDIGVSLDETVKSEDLMDIIYTLNGATE---------KDVTKLREERWEVACPLIGNSPHSRSSLFLQHPVFNTHQSEQQLVRYMKRLENKDVSLVHSMIPLGSCTMKLNASAELIPITWPTLSSIHPFAPVEQAKGYSRIFGDLEKWLCEITGYDNFSLQPNSGANGEYAGLLAIRNYLIHKGEEQRNICLIPTSAHGTNPASAQMANMKVVVVDSDHHGNINYKDLAAKAEKYSNQLAAIMVTYPSTHGVFESSIRDVCDKVHEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGVGPIGVKKHLA-----------PFLPGHSVVPVDGRKVGSVASAPYGSASILAITWAYIRMMGPVGLREASQVAILNANYMAKRLENDYRIVYKDEQGLVAHEFIMDCKPFKKHGIEVVDIAKRLMDYGFHSPTMSWPVHDCLMIEPTESEDKAEMDRLVEALLSIREEIRQVENGSLDKHLNPLKMAPHTLEKVTSDNWNMPYSRELAAFPKPW----CTHKAWPTVGRVDDQYGDRNLVCTCPPIE 976          
BLAST of Glycine cleavage system P protein vs. Ensembl Celegans
Match: gldc-1 (Glycine cleavage system P protein [Source:UniProtKB/TrEMBL;Acc:Q21962])

HSP 1 Score: 1008.82 bits (2607), Expect = 0.000e+0
Identity = 542/944 (57.42%), Postives = 667/944 (70.66%), Query Frame = 3
Query:  396 IKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYI-----RMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHA-FTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINR--------SNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDS--FGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            IK +K ++L  PL E +++  L  IA +NK++RSYIGMGY   I+PA I+RNI +N GWI+ YTPYQ EISQGRLESLLNFQTMI ++TG+   NASLLDE TA+AEA+ +  R  +R K  +DS CH Q +DV++TR+   GI+I   ++        + A V++QYP+T G I     +++E+A ++ ++ I+  DLLS TIL+ PG+   DI +GS+QRFG+PLGYGGPHA F A  K        R +PGR++GV+KD NGN A RLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGP+ L EIA  +H  T  LA      GH+I++    FDTL I       +L++ A     +KRAE +K+N +Y  D  + VSLDETV   DL D++   +              DVTKLR  R         N+  SR+S +L HPVFN+H SE  LVRYMK+LENKD+SLVHSMIPLGSCTMKLN++ EL   +WP  S IHPF P+ Q +GY+ +F  LE+ LCEITGY+ FSLQPNSGA GEYAGL  I +Y     +  R ICLIPTSAHGTNPASAQMA M V  V  +  G ++ KDL  +  KY + LAAIMVTYPST+GVF+  IR +CD VHE+GGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGVGPIGVK+HLA             L G +V  +D    G V SAP+GSASIL I+WAYI++MG  GL++AS+VAILNANYM KRL+  Y+  + +E G  AHEFI+DC+ FK  GIEV+DI+KRLMDYGFHSPTMSWPV   LMIEPTESEDKAE DRL +AL+ IREEIR +E G LD H NPLKMAPH+ E V SDNW+  Y+R +AA+P  W       K WP+V R+DD+YGD+NL+C+CP +E
Sbjct:    2 IKAEKALELPAPLDEYKMLKELEAIAAQNKIYRSYIGMGYYDTIVPAVISRNILQNIGWISQYTPYQAEISQGRLESLLNFQTMIAEMTGLPTTNASLLDEATASAEAVALAARTTKRNKIVVDSFCHPQNLDVIRTRSGPLGIDIEVSDSIEGYAFDDKVAAVVVQYPNTEGRIH-QFDELIESAHKNKSLVIMVCDLLSLTILRSPGDLGADIAVGSAQRFGVPLGYGGPHAGFMAVAKHDAKNALGRNIPGRIIGVTKDANGNRALRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPQRLTEIARGVHKSTAYLAYHLRNAGHEIVHKDY-FDTLKI-------RLKDKAALEETKKRAEEMKMNFRYYEDGDIGVSLDETVKSEDLMDIIYTLNGATE---------KDVTKLREERWEVACPLIGNSPHSRSSLFLQHPVFNTHQSEQQLVRYMKRLENKDVSLVHSMIPLGSCTMKLNASAELIPITWPTLSSIHPFAPVEQAKGYSRIFGDLEKWLCEITGYDNFSLQPNSGANGEYAGLLAIRNYLIHKGEEQRNICLIPTSAHGTNPASAQMANMKVVVVDSDHHGNINYKDLAAKAEKYSNQLAAIMVTYPSTHGVFESSIRDVCDKVHEHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGVGPIGVKKHLA-----------PFLPGHSVVPVDGRKVGSVASAPYGSASILAITWAYIRMMGPVGLREASQVAILNANYMAKRLENDYRIVYKDEQGLVAHEFIMDCKPFKKHGIEVVDIAKRLMDYGFHSPTMSWPVHDCLMIEPTESEDKAEMDRLVEALLSIREEIRQVENGSLDKHLNPLKMAPHTLEKVTSDNWNMPYSRELAAFPKPW----CTHKAWPTVGRVDDQYGDRNLVCTCPPIE 912          
BLAST of Glycine cleavage system P protein vs. Ensembl Fly
Match: CG3999 (gene:FBgn0037801 transcript:FBtr0337048)

HSP 1 Score: 1139.02 bits (2945), Expect = 0.000e+0
Identity = 574/968 (59.30%), Postives = 732/968 (75.62%), Query Frame = 3
Query:  279 KFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENG-FCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSV 3176
            K +F  RHIGP ++D   ML+ LG K++ E+ E  +P+SI+ ++ + L  PL E EL+  +R I+ +N++WRSYIGMGY++C +P  I RN+FENPGW T YTPYQPEI+QGRLESLLN+QT++ DLTG++VANASLLDEGTAAAEA+ +  R N+RKK ++ +R H QT+ VVKTR +A  +EIV G    AD  S+E AG+LLQYPDT G +  +   I   AK++ T+ +VA DLLS T+L+PP E+  DI +G+SQR G+PLGYGGPHA FFA K+  +R+MPGRM+GV++D++GN AYRLALQTREQHIRRDKATSNICTAQALLANMSAMYA+YHGPEGLK +A+RIH  TL L  G    GH+++N    FDTLHI  GG +      +   +++RAE  +INL+Y  D +V V+LDETV+  D++DLL +F +  S+  IL     DV K  I   N++  RTS YL HP+F S+HSE+ +VRYMKKLENKD+SLVHSMIPLGSCTMKLNST E+  CS+  F+ IHPF P+ Q QG+ ++FK+LE DLCEITGY++ S QPNSGAQGEYAGLR I SY     + +R ICLIP SAHGTNPASAQMAGM V+P+++   G++DM  L  +  ++   L+ +M+TYPST GVF++ +  IC ++H++GGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK HLAPYLP H ++ P        S   SFG V++APFGS++ILPISW+YIKLMG +GLK+A++VAILNANYM KRL+ +YK+ +   N    AHEFI+D ++  K+  IE +D++KRLMDYGFH+PTMSWPV   LMIEPTESEDK E DR CDA+I IREEI  IE G++D   NPLKM+PH+Q  V SD WDR YTR  AA+PAI+ +    +K WP+V RIDD YGD++L+C+CP +
Sbjct:   34 KSDFPSRHIGPRKTDVVAMLDTLGFKSLAELTEKAVPQSIQLKRELDLDKPLNEHELIRRIRDISLKNQLWRSYIGMGYHNCHVPHTIIRNMFENPGWTTQYTPYQPEIAQGRLESLLNYQTLVTDLTGLDVANASLLDEGTAAAEAMCLATRHNKRKKLYLSNRVHPQTLSVVKTRTEALELEIVVGPIEQADLPSRELAGILLQYPDTYGDVK-DFEDIAALAKKNGTLVVVATDLLSLTLLRPPAEFGADIAVGTSQRLGVPLGYGGPHAGFFACKQSLVRLMPGRMIGVTRDMDGNDAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAIYHGPEGLKAMANRIHHFTLTLQTGVLGAGHEVINKNF-FDTLHIRLGGGQ------SLEDLKERAEHKRINLRYLEDDTVGVALDETVSVADVDDLLWVFKAEASVEHILAR--KDVLKNSIE--NSKFLRTSPYLQHPIFQSYHSESRMVRYMKKLENKDISLVHSMIPLGSCTMKLNSTTEMMPCSFRHFTDIHPFAPVEQAQGFHQMFKELEHDLCEITGYDRISFQPNSGAQGEYAGLRAIRSYHEHRNEGHRNICLIPISAHGTNPASAQMAGMKVEPIRILSNGSIDMAHLRAKAEEHAHELSCLMITYPSTMGVFEETVADICTLIHKHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPYLPGHPVVSPLS------SEEHSFGVVSAAPFGSSAILPISWSYIKLMGSRGLKRATQVAILNANYMSKRLEQHYKTLYKAPNSQLVAHEFILDIRDLKKSANIEAVDVAKRLMDYGFHAPTMSWPVAGTLMIEPTESEDKEELDRFCDAMISIREEIAEIEAGRMDKAVNPLKMSPHTQAQVISDKWDRPYTREQAAFPAIFVKPD--AKIWPTVGRIDDAYGDKHLVCTCPPI 981          
BLAST of Glycine cleavage system P protein vs. Ensembl Fly
Match: CG3999 (gene:FBgn0037801 transcript:FBtr0082225)

HSP 1 Score: 1139.02 bits (2945), Expect = 0.000e+0
Identity = 574/968 (59.30%), Postives = 732/968 (75.62%), Query Frame = 3
Query:  279 KFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENG-FCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSV 3176
            K +F  RHIGP ++D   ML+ LG K++ E+ E  +P+SI+ ++ + L  PL E EL+  +R I+ +N++WRSYIGMGY++C +P  I RN+FENPGW T YTPYQPEI+QGRLESLLN+QT++ DLTG++VANASLLDEGTAAAEA+ +  R N+RKK ++ +R H QT+ VVKTR +A  +EIV G    AD  S+E AG+LLQYPDT G +  +   I   AK++ T+ +VA DLLS T+L+PP E+  DI +G+SQR G+PLGYGGPHA FFA K+  +R+MPGRM+GV++D++GN AYRLALQTREQHIRRDKATSNICTAQALLANMSAMYA+YHGPEGLK +A+RIH  TL L  G    GH+++N    FDTLHI  GG +      +   +++RAE  +INL+Y  D +V V+LDETV+  D++DLL +F +  S+  IL     DV K  I   N++  RTS YL HP+F S+HSE+ +VRYMKKLENKD+SLVHSMIPLGSCTMKLNST E+  CS+  F+ IHPF P+ Q QG+ ++FK+LE DLCEITGY++ S QPNSGAQGEYAGLR I SY     + +R ICLIP SAHGTNPASAQMAGM V+P+++   G++DM  L  +  ++   L+ +M+TYPST GVF++ +  IC ++H++GGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK HLAPYLP H ++ P        S   SFG V++APFGS++ILPISW+YIKLMG +GLK+A++VAILNANYM KRL+ +YK+ +   N    AHEFI+D ++  K+  IE +D++KRLMDYGFH+PTMSWPV   LMIEPTESEDK E DR CDA+I IREEI  IE G++D   NPLKM+PH+Q  V SD WDR YTR  AA+PAI+ +    +K WP+V RIDD YGD++L+C+CP +
Sbjct:   34 KSDFPSRHIGPRKTDVVAMLDTLGFKSLAELTEKAVPQSIQLKRELDLDKPLNEHELIRRIRDISLKNQLWRSYIGMGYHNCHVPHTIIRNMFENPGWTTQYTPYQPEIAQGRLESLLNYQTLVTDLTGLDVANASLLDEGTAAAEAMCLATRHNKRKKLYLSNRVHPQTLSVVKTRTEALELEIVVGPIEQADLPSRELAGILLQYPDTYGDVK-DFEDIAALAKKNGTLVVVATDLLSLTLLRPPAEFGADIAVGTSQRLGVPLGYGGPHAGFFACKQSLVRLMPGRMIGVTRDMDGNDAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAIYHGPEGLKAMANRIHHFTLTLQTGVLGAGHEVINKNF-FDTLHIRLGGGQ------SLEDLKERAEHKRINLRYLEDDTVGVALDETVSVADVDDLLWVFKAEASVEHILAR--KDVLKNSIE--NSKFLRTSPYLQHPIFQSYHSESRMVRYMKKLENKDISLVHSMIPLGSCTMKLNSTTEMMPCSFRHFTDIHPFAPVEQAQGFHQMFKELEHDLCEITGYDRISFQPNSGAQGEYAGLRAIRSYHEHRNEGHRNICLIPISAHGTNPASAQMAGMKVEPIRILSNGSIDMAHLRAKAEEHAHELSCLMITYPSTMGVFEETVADICTLIHKHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPYLPGHPVVSPLS------SEEHSFGVVSAAPFGSSAILPISWSYIKLMGSRGLKRATQVAILNANYMSKRLEQHYKTLYKAPNSQLVAHEFILDIRDLKKSANIEAVDVAKRLMDYGFHAPTMSWPVAGTLMIEPTESEDKEELDRFCDAMISIREEIAEIEAGRMDKAVNPLKMSPHTQAQVISDKWDRPYTREQAAFPAIFVKPD--AKIWPTVGRIDDAYGDKHLVCTCPPI 981          
BLAST of Glycine cleavage system P protein vs. Ensembl Zebrafish
Match: gldc (glycine dehydrogenase (decarboxylating) [Source:ZFIN;Acc:ZDB-GENE-030131-340])

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 474/976 (48.57%), Postives = 625/976 (64.04%), Query Frame = 3
Query:  285 EFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEI---VTGNASTADFSSKEYAGVLLQ---YPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHI---LPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLS-LVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCG-IEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            EF +RHIGP + +K+ ML  LGV+++ ++IE TIP SI+  + +K+ DP+ E E++ +L+KIA +NK+WRSYIGMGY +C +P  I RN+ EN GW+T YTPYQPE+SQGRLESLLN+QTM+CD+TGM VANASLLDEGTAAAEA+ +  R+N+R+ F+ID RCH QTI VV+TRA+   I +   ++   S + FS   +         +     ++CL++           ++++     LS     P   + I + I  SQ   L L        F   K   + ++ G+M  V +D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AMYA+YHG +GL+ IA+R H  TLILAEG    GHK+ ++   FDTL I   + G D  +        ++  ++ L  NL Y P    + +    +    L   LSIF   K I     NL   +   R             ++++ +FN +      +     +  K+ S   H  + LGSCTMKLNS+ EL   +W EF+ IHPFVP++Q +GY  LF+QLE+DLCEITGY+K S QPNSGAQGEYAGL  I +Y  +  +S+R +                                           K++ NLAAIM+TYPSTNGVF++++  +C+++HENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAP+LP+H ++       ++ +   S G +++AP+GS++ILPISWAYIK+MG +GL  A+EVAILNANYM KRL+  YK  F    GF AHEFI+D + FK    IE +D++KRL DYGFH+PTMSWPV   LMIEPTESEDKAE DR CD+L+ IR+EI  IEEG++D   NPLKMAPHS   + S  WDR Y R  AA+P  + R    +KFWP++SRIDD YGDQ+L+C+CP ++
Sbjct:   69 EFSERHIGPGDKEKREMLNTLGVESVSQLIENTIPPSIRLGRSLKMDDPVCENEILDSLQKIASKNKMWRSYIGMGYYNCSVPPVIQRNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVCDITGMAVANASLLDEGTAAAEAMQLCNRQNKRRMFYIDPRCHPQTIAVVQTRANYLSIYLSIYLSIYLSISVFSVCFFLSFCFFLSVHLSVCFSVCLSLFV---------SISLCFSVCLSLLFFLPVLSFSICLSIFVSQSLSLSLSLTAKFIYFIILKTNLV-VLNGQMCPV-RDAAGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMYALYHGSQGLRHIAERTHNATLILAEGLKRAGHKLQHENF-FDTLKINCGVAGKDILEKATQREINLRVYSDGLVRNLLYEPYNVKMFTFSVWIFVCSLFIFLSIFQ--KLIKTTSENLLICLKHFR------------KFISYLLFNIYIYIYIYIYMYIYIYIKNNSTFYHFNLLLGSCTMKLNSSSELMPITWREFANIHPFVPLDQAEGYQLLFRQLEKDLCEITGYDKISFQPNSGAQGEYAGLAAIKAYLNSRGESHRTV------------------------------------------DKHKANLAAIMITYPSTNGVFEENVSEVCELIHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVVNM-----QSNNAGSSLGTISAAPWGSSAILPISWAYIKMMGSKGLAHATEVAILNANYMAKRLENQYKILFRGTKGFVAHEFILDVRPFKKTANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDSLLAIRQEIADIEEGRMDSRVNPLKMAPHSLACITSSTWDRPYPREFAAFPMPFVRPE--TKFWPTISRIDDIYGDQHLVCTCPPMD 969          
BLAST of Glycine cleavage system P protein vs. Ensembl Xenopus
Match: GLDC (glycine decarboxylase [Source:NCBI gene;Acc:100497481])

HSP 1 Score: 1140.18 bits (2948), Expect = 0.000e+0
Identity = 572/966 (59.21%), Postives = 733/966 (75.88%), Query Frame = 3
Query:  285 EFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +F +RHIGP + +K+ ML+ LG++ I+E+I+ T+P SI+  + +K+ D + E E++ +L+ IA +NK+WRSYIGMGY +C +P  I RN+ EN GW+T YTPYQPE+SQGRLESLLN+QTM+CD+TGM+VANASLLDEGTAAAEA+ +  R N+R+KF++DSRCH QTI VV+TRA+  G+          DFS K+ +GVL QYPDTNG +  +   +V+ A Q+ T+   A DLL+  I++PPGE+ +DI +GSSQRFG+PL YGGPHAAFFA K+  +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AM+ VYHGP GLK IA R+H   +ILAEG +  GH + N+ + FDTL I  G   +++ +        RA   +INL+   D S+ VSLDETV   DL+DLL +F    S   +  ++ ++   +          RTS +LTH VFNS+HSET +VRYMK+LENKD+SLVHSMIPLGSCTMKLNS+ EL   +W  F+ IHPFVP++Q QGY +LF++LE+DLCEITGY+  S QPNSGAQGEYAGL  I +Y  A  + +R +CLIP SAHGTNPASAQMAGM ++PV+V+K G++D+  L+  + K+RD+LAAIM+TYPSTNGVF++DI  +CD++H+NGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAPYLP+H ++              S G +++AP+GS++ILPISWAYIK+MG +GLK A+EVAILNANYM KRL+ +YK  F    GF AHEFI+D + F K+  IE +D++KRL DYGFH+PTMSWPV   LMIEPTESEDKAE DR CDA+I IR+EI  IEEG++D   NPLKMAPH+   + S NWDR Y+R +AA+P  + R    SKFWP+++RIDD YGDQ+L+C+CP ++
Sbjct:   67 DFSERHIGPGDKEKREMLDTLGLQGIEELIDKTVPASIRLARPLKMDDQVCENEILESLQSIASKNKIWRSYIGMGYYNCSVPQAILRNLLENAGWVTQYTPYQPEVSQGRLESLLNYQTMVCDVTGMDVANASLLDEGTAAAEAMQLCHRHNKRRKFYVDSRCHPQTIAVVQTRANYIGVVTELLLPHEMDFSGKDVSGVLFQYPDTNGNV-EDFTHLVDRAHQNGTLACCATDLLALCIMRPPGEFGVDIALGSSQRFGVPLCYGGPHAAFFAVKENLVRMMPGRMVGVTRDAAGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFCVYHGPNGLKHIARRVHNAAIILAEGLTRAGHHLQNE-MFFDTLKIHCGCPTKEVLD--------RAAQRQINLRVYSDGSLGVSLDETVKEKDLDDLLWVFGCESSAELVAESMGEETKGIL----GTAFKRTSKFLTHTVFNSYHSETNIVRYMKRLENKDISLVHSMIPLGSCTMKLNSSSELTPITWSAFANIHPFVPLDQAQGYQQLFQELEKDLCEITGYDNISFQPNSGAQGEYAGLAAIKAYLNAKGEHHRTVCLIPKSAHGTNPASAQMAGMKIQPVEVDKNGSIDLVHLKAMVDKHRDHLAAIMITYPSTNGVFEEDISDVCDLIHKNGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVIALPN------DNTASLGTISAAPWGSSAILPISWAYIKMMGAKGLKHATEVAILNANYMSKRLEKHYKILFKGARGFVAHEFILDIRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMIGIRQEIADIEEGRMDSRINPLKMAPHTLTCIASSNWDRPYSREVAAFPLPFVRPE--SKFWPTIARIDDIYGDQHLVCTCPPMD 1010          
BLAST of Glycine cleavage system P protein vs. Ensembl Xenopus
Match: GLDC (glycine decarboxylase [Source:NCBI gene;Acc:100497481])

HSP 1 Score: 1097.42 bits (2837), Expect = 0.000e+0
Identity = 553/918 (60.24%), Postives = 698/918 (76.03%), Query Frame = 3
Query:  429 PLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            P+ E E++ +L+ IA +NK+WRSYIGMGY +C +P  I RN+ EN GW+T YTPYQPE+SQGRLESLLN+QTM+CD+TGM+VANASLLDEGTAAAEA+ +  R N+R+KF++DSRCH QTI VV+TRA+  G+          DFS K+ +GVL QYPDTNG +  +   +V+ A Q+ T+   A DLL+  I++PPGE+ +DI +GSSQRFG+PL YGGPHAAFFA K+  +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AM+ VYHGP GLK IA R+H   +ILAEG +  GH + N+ + FDTL I  G   +++ +        RA   +INL+   D S+ VSLDETV   DL+DLL +F    S   +  ++ ++   +          RTS +LTH VFNS+HSET +VRYMK+LENKD+SLVHSMIPLGSCTMKLNS+ EL   +W  F+ IHPFVP++Q QGY +LF++LE+DLCEITGY+  S QPNSGAQGEYAGL  I +Y  A  + +R +CLIP SAHGTNPASAQMAGM ++PV+V+K G++D+  L+  + K+RD+LAAIM+TYPSTNGVF++DI  +CD++H+NGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAPYLP+H ++              S G +++AP+GS++ILPISWAYIK+MG +GLK A+EVAILNANYM KRL+ +YK  F    GF AHEFI+D + F K+  IE +D++KRL DYGFH+PTMSWPV   LMIEPTESEDKAE DR CDA+I IR+EI  IEEG++D   NPLKMAPH+   + S NWDR Y+R +AA+P  + R    SKFWP+++RIDD YGDQ+L+C+CP ++
Sbjct:    4 PICENEILESLQSIASKNKIWRSYIGMGYYNCSVPQAILRNLLENAGWVTQYTPYQPEVSQGRLESLLNYQTMVCDVTGMDVANASLLDEGTAAAEAMQLCHRHNKRRKFYVDSRCHPQTIAVVQTRANYIGVVTELLLPHEMDFSGKDVSGVLFQYPDTNGNV-EDFTHLVDRAHQNGTLACCATDLLALCIMRPPGEFGVDIALGSSQRFGVPLCYGGPHAAFFAVKENLVRMMPGRMVGVTRDAAGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFCVYHGPNGLKHIARRVHNAAIILAEGLTRAGHHLQNE-MFFDTLKIHCGCPTKEVLD--------RAAQRQINLRVYSDGSLGVSLDETVKEKDLDDLLWVFGCESSAELVAESMGEETKGIL----GTAFKRTSKFLTHTVFNSYHSETNIVRYMKRLENKDISLVHSMIPLGSCTMKLNSSSELTPITWSAFANIHPFVPLDQAQGYQQLFQELEKDLCEITGYDNISFQPNSGAQGEYAGLAAIKAYLNAKGEHHRTVCLIPKSAHGTNPASAQMAGMKIQPVEVDKNGSIDLVHLKAMVDKHRDHLAAIMITYPSTNGVFEEDISDVCDLIHKNGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVIALPN------DNTASLGTISAAPWGSSAILPISWAYIKMMGAKGLKHATEVAILNANYMSKRLEKHYKILFKGARGFVAHEFILDIRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMIGIRQEIADIEEGRMDSRINPLKMAPHTLTCIASSNWDRPYSREVAAFPLPFVRPE--SKFWPTIARIDDIYGDQHLVCTCPPMD 899          
BLAST of Glycine cleavage system P protein vs. Ensembl Xenopus
Match: GLDC (glycine decarboxylase [Source:NCBI gene;Acc:100497481])

HSP 1 Score: 1092.41 bits (2824), Expect = 0.000e+0
Identity = 552/915 (60.33%), Postives = 696/915 (76.07%), Query Frame = 3
Query:  438 EGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            E E++ +L+ IA +NK+WRSYIGMGY +C +P  I RN+ EN GW+T YTPYQPE+SQGRLESLLN+QTM+CD+TGM+VANASLLDEGTAAAEA+ +  R N+R+KF++DSRCH QTI VV+TRA+  G+          DFS K+ +GVL QYPDTNG +  +   +V+ A Q+ T+   A DLL+  I++PPGE+ +DI +GSSQRFG+PL YGGPHAAFFA K+  +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AM+ VYHGP GLK IA R+H   +ILAEG +  GH + N+ + FDTL I  G   +++ +        RA   +INL+   D S+ VSLDETV   DL+DLL +F    S   +  ++ ++   +          RTS +LTH VFNS+HSET +VRYMK+LENKD+SLVHSMIPLGSCTMKLNS+ EL   +W  F+ IHPFVP++Q QGY +LF++LE+DLCEITGY+  S QPNSGAQGEYAGL  I +Y  A  + +R +CLIP SAHGTNPASAQMAGM ++PV+V+K G++D+  L+  + K+RD+LAAIM+TYPSTNGVF++DI  +CD++H+NGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAPYLP+H ++              S G +++AP+GS++ILPISWAYIK+MG +GLK A+EVAILNANYM KRL+ +YK  F    GF AHEFI+D + F K+  IE +D++KRL DYGFH+PTMSWPV   LMIEPTESEDKAE DR CDA+I IR+EI  IEEG++D   NPLKMAPH+   + S NWDR Y+R +AA+P  + R    SKFWP+++RIDD YGDQ+L+C+CP ++
Sbjct:   48 ENEILESLQSIASKNKIWRSYIGMGYYNCSVPQAILRNLLENAGWVTQYTPYQPEVSQGRLESLLNYQTMVCDVTGMDVANASLLDEGTAAAEAMQLCHRHNKRRKFYVDSRCHPQTIAVVQTRANYIGVVTELLLPHEMDFSGKDVSGVLFQYPDTNGNV-EDFTHLVDRAHQNGTLACCATDLLALCIMRPPGEFGVDIALGSSQRFGVPLCYGGPHAAFFAVKENLVRMMPGRMVGVTRDAAGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFCVYHGPNGLKHIARRVHNAAIILAEGLTRAGHHLQNE-MFFDTLKIHCGCPTKEVLD--------RAAQRQINLRVYSDGSLGVSLDETVKEKDLDDLLWVFGCESSAELVAESMGEETKGIL----GTAFKRTSKFLTHTVFNSYHSETNIVRYMKRLENKDISLVHSMIPLGSCTMKLNSSSELTPITWSAFANIHPFVPLDQAQGYQQLFQELEKDLCEITGYDNISFQPNSGAQGEYAGLAAIKAYLNAKGEHHRTVCLIPKSAHGTNPASAQMAGMKIQPVEVDKNGSIDLVHLKAMVDKHRDHLAAIMITYPSTNGVFEEDISDVCDLIHKNGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVIALPN------DNTASLGTISAAPWGSSAILPISWAYIKMMGAKGLKHATEVAILNANYMSKRLEKHYKILFKGARGFVAHEFILDIRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMIGIRQEIADIEEGRMDSRINPLKMAPHTLTCIASSNWDRPYSREVAAFPLPFVRPE--SKFWPTIARIDDIYGDQHLVCTCPPMD 940          
BLAST of Glycine cleavage system P protein vs. Ensembl Xenopus
Match: GLDC (glycine decarboxylase [Source:NCBI gene;Acc:100497481])

HSP 1 Score: 1059.28 bits (2738), Expect = 0.000e+0
Identity = 539/966 (55.80%), Postives = 708/966 (73.29%), Query Frame = 3
Query:  285 EFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +F +RHIGP + +K+ ML+ LG++ I+E+I+ T+P SI+  + +K+ D + E E++ +L+ IA +NK+WRSYIGMGY +C +P  I RN+ EN GW+T YTPYQPE+SQGRLESLLN+QTM+CD+TGM+VANASLLDEGTAAAEA+ +  R N+R+KF++DSRCH QTI VV+TRA+  G+          DFS K+ +GVL QYPDTNG +  +   +V+ A Q+ T+   A DLL+  I++PPGE+ +DI +GSSQRFG+PL YGGPHAAFFA K+  +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AM+ VYHGP GLK IA R+H   +ILAEG +  GH + N+ + FDTL I  G   +++ +        RA   +INL+   D S+ VSLDETV   DL+DLL +F    S   +  ++ ++   +          RTS +LTH VFN         ++ +     +++++H ++        L + + +   +W  F+ IHPFVP++Q QGY +LF++LE+DLCEITGY+  S QPNSGAQGEYAGL  I +Y  A  + +R +CLIP SAHGTNPASAQMAGM ++PV+V+K G++D+  L+  + K+RD+LAAIM+TYPSTNGVF++DI  +CD++H+NGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAPYLP+H ++              S G +++AP+GS++ILPISWAYIK+MG +GLK A+EVAILNANYM KRL+ +YK  F    GF AHEFI+D + F K+  IE +D++KRL DYGFH+PTMSWPV   LMIEPTESEDKAE DR CDA+I IR+EI  IEEG++D   NPLKMAPH+   + S NWDR Y+R +AA+P  + R    SKFWP+++RIDD YGDQ+L+C+CP ++
Sbjct:   67 DFSERHIGPGDKEKREMLDTLGLQGIEELIDKTVPASIRLARPLKMDDQVCENEILESLQSIASKNKIWRSYIGMGYYNCSVPQAILRNLLENAGWVTQYTPYQPEVSQGRLESLLNYQTMVCDVTGMDVANASLLDEGTAAAEAMQLCHRHNKRRKFYVDSRCHPQTIAVVQTRANYIGVVTELLLPHEMDFSGKDVSGVLFQYPDTNGNV-EDFTHLVDRAHQNGTLACCATDLLALCIMRPPGEFGVDIALGSSQRFGVPLCYGGPHAAFFAVKENLVRMMPGRMVGVTRDAAGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFCVYHGPNGLKHIARRVHNAAIILAEGLTRAGHHLQNE-MFFDTLKIHCGCPTKEVLD--------RAAQRQINLRVYSDGSLGVSLDETVKEKDLDDLLWVFGCESSAELVAESMGEETKGIL----GTAFKRTSKFLTHTVFNRESHLVNDFKHEQICTFLEVNVIHGLV-----VYALETVMPI---TWSAFANIHPFVPLDQAQGYQQLFQELEKDLCEITGYDNISFQPNSGAQGEYAGLAAIKAYLNAKGEHHRTVCLIPKSAHGTNPASAQMAGMKIQPVEVDKNGSIDLVHLKAMVDKHRDHLAAIMITYPSTNGVFEEDISDVCDLIHKNGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVIALPN------DNTASLGTISAAPWGSSAILPISWAYIKMMGAKGLKHATEVAILNANYMSKRLEKHYKILFKGARGFVAHEFILDIRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMIGIRQEIADIEEGRMDSRINPLKMAPHTLTCIASSNWDRPYSREVAAFPLPFVRPE--SKFWPTIARIDDIYGDQHLVCTCPPMD 1002          
BLAST of Glycine cleavage system P protein vs. Ensembl Xenopus
Match: GLDC (glycine decarboxylase [Source:NCBI gene;Acc:100497481])

HSP 1 Score: 1053.12 bits (2722), Expect = 0.000e+0
Identity = 544/966 (56.31%), Postives = 695/966 (71.95%), Query Frame = 3
Query:  285 EFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +F +RHIGP + +K+ ML+ LG+    ++I+ T+P SI+  + +K+ D + E E++ +L+ IA +NK+WRSYIGMGY +C +P  I RN+ EN GW+T YTPYQPE+SQGRLESLLN+QTM+CD+TGM+VANASLLDEGTAAAEA+ +  R N+R+KF++DSRCH QTI VV+TRA+  G+          DFS K+ +GVL QYPDTNG +  +   +V+ A Q+ T+   A DLL+  I++PPGE+ +DI +GSSQRFG+PL YGGPHAAFFA K+  +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AM+ VYHGP GLK IA R+H   +ILAEG +  GH + N+ + FDTL I  G   +++ +        RA   +INL+   D S+ VSLDETV   DL+DLL +F    S   +  ++ ++   +          RTS +LTH VFNS+HSET +VRYMK+LENKD+SLVHSMIPLGSCTMKLNS+ EL   +W  F+ IHPFVP++Q QGY +LF++LE+DLCEITGY+  S QPNSGAQGEYAGL  I +Y  A  + +R                                           + K+RD+LAAIM+TYPSTNGVF++DI  +CD++H+NGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAPYLP+H ++              S G +++AP+GS++ILPISWAYIK+MG +GLK A+EVAILNANYM KRL+ +YK  F    GF AHEFI+D + F K+  IE +D++KRL DYGFH+PTMSWPV   LMIEPTESEDKAE DR CDA+I IR+EI  IEEG++D   NPLKMAPH+   + S NWDR Y+R +AA+P  + R    SKFWP+++RIDD YGDQ+L+C+CP ++
Sbjct:   67 DFSERHIGPGDKEKREMLDTLGL----QLIDKTVPASIRLARPLKMDDQVCENEILESLQSIASKNKIWRSYIGMGYYNCSVPQAILRNLLENAGWVTQYTPYQPEVSQGRLESLLNYQTMVCDVTGMDVANASLLDEGTAAAEAMQLCHRHNKRRKFYVDSRCHPQTIAVVQTRANYIGVVTELLLPHEMDFSGKDVSGVLFQYPDTNGNV-EDFTHLVDRAHQNGTLACCATDLLALCIMRPPGEFGVDIALGSSQRFGVPLCYGGPHAAFFAVKENLVRMMPGRMVGVTRDAAGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFCVYHGPNGLKHIARRVHNAAIILAEGLTRAGHHLQNE-MFFDTLKIHCGCPTKEVLD--------RAAQRQINLRVYSDGSLGVSLDETVKEKDLDDLLWVFGCESSAELVAESMGEETKGIL----GTAFKRTSKFLTHTVFNSYHSETNIVRYMKRLENKDISLVHSMIPLGSCTMKLNSSSELTPITWSAFANIHPFVPLDQAQGYQQLFQELEKDLCEITGYDNISFQPNSGAQGEYAGLAAIKAYLNAKGEHHRT------------------------------------------VDKHRDHLAAIMITYPSTNGVFEEDISDVCDLIHKNGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVIALPN------DNTASLGTISAAPWGSSAILPISWAYIKMMGAKGLKHATEVAILNANYMSKRLEKHYKILFKGARGFVAHEFILDIRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMIGIRQEIADIEEGRMDSRINPLKMAPHTLTCIASSNWDRPYSREVAAFPLPFVRPE--SKFWPTIARIDDIYGDQHLVCTCPPMD 964          
BLAST of Glycine cleavage system P protein vs. Ensembl Mouse
Match: Gldc (glycine decarboxylase [Source:MGI Symbol;Acc:MGI:1341155])

HSP 1 Score: 1115.91 bits (2885), Expect = 0.000e+0
Identity = 559/974 (57.39%), Postives = 732/974 (75.15%), Query Frame = 3
Query:  261 KRFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +R   +  +F +RHIGP + D++ ML+ LG+ +I E+IE T+P SI+ ++ +K+ DP+ E E++  L  IA +N++WRSYIGMGY +C +P  I RN+ EN GW+T YTPYQPE+SQGRLESLLN+QTM+ D+TG+++ANASLLDE TAAAEA+ +  R N+RKKFF+D RCH QTI VV+TRA   G+ +        DFS K+  GVL QYPDT G +  +  ++V+ A Q+ ++T  A DLL+  IL+PPGE+ +DI +G+SQRFG+PLGYGGPHAAFFA K+  +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AM+A+YHG +GLK IA R+H  TLIL+EG    GH++ +D L FDTL +  G   ++        +  RA   +IN +   D ++ +SLDETVT  DL+DLL IF    S   +   + ++    R     +   RTS +LTH VFNS+HSET LVRYMKKLENKD+SLVHSMIPLGSCTMKLNS+ EL   +W EF+ IHPFVP++Q QGY +LF+ LE+DLCEITGY++ S QPNSGAQGEYAGL  I +Y     + +R +CLIP SAHGTNPASA MAGM ++PV+V++ G +D+  L+  + ++++NLAAIM+TYPSTNGVF+++I  +C ++H++GGQVYLDGANMNAQVG+CRPGD+GSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HL+P+LP+H ++       +   G    G V++AP+GS+SILPISWAYIK+MG +GLK+A+E+AILNANYM KRL+ +Y+  F    G+ AHEFI+D + F K+  +E +D++KRL DYGFH+PTMSWPV   LMIEPTESEDKAE DR CDA+I IR+EI  IEEG++D   NPLKM+PHS   V S  WDR Y+R +AA+P  + +    +KFWP+++RIDD YGDQ+L+C+CP +E
Sbjct:   59 ERLLPRHDDFSRRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKMEDPICENEILETLHAIASKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRHNKRKKFFVDPRCHPQTIAVVQTRAKYRGVLVELKLPHEMDFSGKDVCGVLFQYPDTEGKV-EDFTELVDRAHQTGSLTCCATDLLALCILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSQGLKHIAKRVHNATLILSEGLKRAGHQLQHD-LFFDTLKVQCGCSVKE--------VLGRAAQRQINFRLFDDGTLGISLDETVTEKDLDDLLWIFGCESSAELVAEGMGEE----RRGLLGSSFKRTSPFLTHQVFNSYHSETNLVRYMKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWREFANIHPFVPLDQAQGYQQLFQGLEKDLCEITGYDRVSFQPNSGAQGEYAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDRYGNIDVAHLKAMVDQHKENLAAIMITYPSTNGVFEENIGDVCALIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLSPFLPSHPVISI-----KPTEGTWPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKEATEIAILNANYMAKRLEKHYRVLFRGARGYVAHEFILDTRPFKKSANVEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSCWDRPYSREVAAFPLPFVKPE--NKFWPTIARIDDIYGDQHLVCTCPPME 1011          
BLAST of Glycine cleavage system P protein vs. UniProt/SwissProt
Match: sp|P15505|GCSP_CHICK (Glycine dehydrogenase (decarboxylating), mitochondrial OS=Gallus gallus OX=9031 GN=GLDC PE=1 SV=2)

HSP 1 Score: 1124.77 bits (2908), Expect = 0.000e+0
Identity = 570/966 (59.01%), Postives = 728/966 (75.36%), Query Frame = 3
Query:  285 EFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCG-IEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +F +RHIGP E +K+ ML  +GV++++E+++ TIP SI+ ++ +++ D + E E++  L  IA +NK+WRSYIGMGY +C +P PIARN+ EN GW+T YTPYQPE+SQGRLESLLN+QTM+CD+TGM+VANASLLDEGTAAAEA+ +  R+N+R+KF+ID+RCH QTI      A+  G+          DFS K+ +GVL QYPDT G +  +  +++E A Q+ T+   A DLL+  ILKPPGE+ +D+V+GSSQRFG+PL YGGPHAAFFA K+  +RMMPGRMVGV++D NG   YRLALQTREQHIRRDKATSNICTAQALLANM+AMY VYHG +GLK+IA R+H  TLILAEG    GHK+ +D L FDTL +  G   +++ +        RA   KIN++   D  + VSLDETV   DL+D+L IF    S   +   + ++   +     +    RTS +LTH VFNS+HSET +VRYMK+LENKD+SLVHSMIPLGSCTMKLNS+ EL   SW EF+ IHPFVP++Q QGY +LFK LE+DLCEITGY+K S QPNSGAQGEYAGL  I +Y  A  + +R +CLIP SAHGTNPASAQMAGM ++P++V+K G++D+  L+  + K+++NLAAIM+TYPSTNGVF+++I  +CD++H++GGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAPYLPTH ++                G V++AP+GS++ILPISW YIK MG +GLK ASE+AILNANYM KRL+ +YK  F    G+ AHEFI+D + FK    IE +D++KRL DYGFH+PTMSWPV   LMIEPTESEDK E DR CDA+I IR+EI  IEEG++D   NPLKM+PH+   V S  WDR Y+R +AA+P  + +    SKFWP+++RIDD YGDQ+L+C+CP +E
Sbjct:   52 DFCRRHIGPREREKREMLSAVGVQSVEELMDKTIPASIRLRRPLRMDDHVVENEILETLYNIASKNKIWRSYIGMGYYNCSVPQPIARNLLENAGWVTQYTPYQPEVSQGRLESLLNYQTMVCDITGMDVANASLLDEGTAAAEAMQLCHRQNKRRKFYIDARCHPQTI------ANYTGVITELKLPHEMDFSGKDVSGVLFQYPDTEGKV-EDFSELIERAHQNGTLACCATDLLALCILKPPGEFGVDVVLGSSQRFGVPLCYGGPHAAFFAVKENLVRMMPGRMVGVTRDANGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMYGVYHGSDGLKDIARRVHNATLILAEGLRRAGHKLHHD-LFFDTLTVTCGCSVKEVLD--------RAALRKINVRIYSDGRLGVSLDETVNEKDLDDILWIFGCESSAELVAEGMGEETKGIL----STPFKRTSKFLTHQVFNSYHSETNIVRYMKRLENKDISLVHSMIPLGSCTMKLNSSAELAPISWKEFANIHPFVPLDQAQGYQQLFKDLEKDLCEITGYDKISFQPNSGAQGEYAGLAAIKAYLNAKGERHRSVCLIPRSAHGTNPASAQMAGMKIQPIEVDKNGSIDISHLKAMVDKHKENLAAIMITYPSTNGVFEEEIGDVCDLIHKHGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPTHPVIKIQTDKDAC-----PLGTVSAAPWGSSAILPISWVYIKTMGAKGLKHASEIAILNANYMAKRLEKHYKILFRGVRGYVAHEFILDTRPFKKTANIEAVDLAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKGELDRFCDAMISIRQEIADIEEGRMDPQVNPLKMSPHTLNCVTSSKWDRPYSREVAAFPLPFVKPE--SKFWPTIARIDDIYGDQHLVCTCPPME 990          
BLAST of Glycine cleavage system P protein vs. UniProt/SwissProt
Match: sp|Q91W43|GCSP_MOUSE (Glycine dehydrogenase (decarboxylating), mitochondrial OS=Mus musculus OX=10090 GN=Gldc PE=1 SV=1)

HSP 1 Score: 1115.91 bits (2885), Expect = 0.000e+0
Identity = 559/974 (57.39%), Postives = 732/974 (75.15%), Query Frame = 3
Query:  261 KRFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +R   +  +F +RHIGP + D++ ML+ LG+ +I E+IE T+P SI+ ++ +K+ DP+ E E++  L  IA +N++WRSYIGMGY +C +P  I RN+ EN GW+T YTPYQPE+SQGRLESLLN+QTM+ D+TG+++ANASLLDE TAAAEA+ +  R N+RKKFF+D RCH QTI VV+TRA   G+ +        DFS K+  GVL QYPDT G +  +  ++V+ A Q+ ++T  A DLL+  IL+PPGE+ +DI +G+SQRFG+PLGYGGPHAAFFA K+  +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AM+A+YHG +GLK IA R+H  TLIL+EG    GH++ +D L FDTL +  G   ++        +  RA   +IN +   D ++ +SLDETVT  DL+DLL IF    S   +   + ++    R     +   RTS +LTH VFNS+HSET LVRYMKKLENKD+SLVHSMIPLGSCTMKLNS+ EL   +W EF+ IHPFVP++Q QGY +LF+ LE+DLCEITGY++ S QPNSGAQGEYAGL  I +Y     + +R +CLIP SAHGTNPASA MAGM ++PV+V++ G +D+  L+  + ++++NLAAIM+TYPSTNGVF+++I  +C ++H++GGQVYLDGANMNAQVG+CRPGD+GSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HL+P+LP+H ++       +   G    G V++AP+GS+SILPISWAYIK+MG +GLK+A+E+AILNANYM KRL+ +Y+  F    G+ AHEFI+D + F K+  +E +D++KRL DYGFH+PTMSWPV   LMIEPTESEDKAE DR CDA+I IR+EI  IEEG++D   NPLKM+PHS   V S  WDR Y+R +AA+P  + +    +KFWP+++RIDD YGDQ+L+C+CP +E
Sbjct:   59 ERLLPRHDDFSRRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKMEDPICENEILETLHAIASKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRHNKRKKFFVDPRCHPQTIAVVQTRAKYRGVLVELKLPHEMDFSGKDVCGVLFQYPDTEGKV-EDFTELVDRAHQTGSLTCCATDLLALCILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSQGLKHIAKRVHNATLILSEGLKRAGHQLQHD-LFFDTLKVQCGCSVKE--------VLGRAAQRQINFRLFDDGTLGISLDETVTEKDLDDLLWIFGCESSAELVAEGMGEE----RRGLLGSSFKRTSPFLTHQVFNSYHSETNLVRYMKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWREFANIHPFVPLDQAQGYQQLFQGLEKDLCEITGYDRVSFQPNSGAQGEYAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDRYGNIDVAHLKAMVDQHKENLAAIMITYPSTNGVFEENIGDVCALIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLSPFLPSHPVISI-----KPTEGTWPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKEATEIAILNANYMAKRLEKHYRVLFRGARGYVAHEFILDTRPFKKSANVEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSCWDRPYSREVAAFPLPFVKPE--NKFWPTIARIDDIYGDQHLVCTCPPME 1011          
BLAST of Glycine cleavage system P protein vs. UniProt/SwissProt
Match: sp|P23378|GCSP_HUMAN (Glycine dehydrogenase (decarboxylating), mitochondrial OS=Homo sapiens OX=9606 GN=GLDC PE=1 SV=2)

HSP 1 Score: 1115.52 bits (2884), Expect = 0.000e+0
Identity = 558/974 (57.29%), Postives = 727/974 (74.64%), Query Frame = 3
Query:  261 KRFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +R   +  +F +RHIGP + D++ ML+ LG+ +I E+IE T+P +I+ ++ +K+ DP+ E E++  L  I+ +N++WRSYIGMGY +C +P  I RN+ EN GWIT YTPYQPE+SQGRLESLLN+QTM+CD+TG+++ANASLLDEGTAAAEAL +  R N+R+KF +D RCH QTI VV+TRA   G+          DFS K+ +GVL QYPDT G +  +  ++VE A QS ++   A DLL+  IL+PPGE+ +DI +GSSQRFG+PLGYGGPHAAFFA ++  +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AM+A+YHG  GL+ IA R+H  TLIL+EG    GH++ +D L FDTL I  G   ++        +  RA   +IN +   D ++ +SLDETV   DL+DLL IF    S   +  ++ ++   +      +   RTS +LTH VFNS+HSET +VRYMKKLENKD+SLVHSMIPLGSCTMKLNS+ EL   +W EF+ IHPFVP++Q QGY +LF++LE+DLCE+TGY++   QPNSGAQGEYAGL  I +Y     + +R +CLIP SAHGTNPASA MAGM ++PV+V+K G +D   L+  + K+++NLAAIM+TYPSTNGVF+++I  +CD++H++GGQVYLDGANMNAQVG+CRPGD+GSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAP+LP H ++                G V++AP+GS+SILPISWAYIK+MG +GLKQA+E AILNANYM KRL+ +Y+  F    G+  HEFI+D + F K+  IE +D++KRL DYGFH+PTMSWPV   LM+EPTESEDKAE DR CDA+I IR+EI  IEEG++D   NPLKM+PHS   V S +WDR Y+R +AA+P  + +    +KFWP+++RIDD YGDQ+L+C+CP +E
Sbjct:   54 ERLLPRHDDFARRHIGPGDKDQREMLQTLGLASIDELIEKTVPANIRLKRPLKMEDPVCENEILATLHAISSKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWITQYTPYQPEVSQGRLESLLNYQTMVCDITGLDMANASLLDEGTAAAEALQLCYRHNKRRKFLVDPRCHPQTIAVVQTRAKYTGVLTELKLPCEMDFSGKDVSGVLFQYPDTEGKV-EDFTELVERAHQSGSLACCATDLLALCILRPPGEFGVDIALGSSQRFGVPLGYGGPHAAFFAVRESLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLEHIARRVHNATLILSEGLKRAGHQLQHD-LFFDTLKIQCGCSVKE--------VLGRAAQRQINFRLFEDGTLGISLDETVNEKDLDDLLWIFGCESSAELVAESMGEECRGI----PGSVFKRTSPFLTHQVFNSYHSETNIVRYMKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVISLKRNEDAC-----PVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPE--NKFWPTIARIDDIYGDQHLVCTCPPME 1006          
BLAST of Glycine cleavage system P protein vs. UniProt/SwissProt
Match: sp|B2J427|GCSP_NOSP7 (Glycine dehydrogenase (decarboxylating) OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) OX=63737 GN=gcvP PE=3 SV=1)

HSP 1 Score: 1016.14 bits (2626), Expect = 0.000e+0
Identity = 531/979 (54.24%), Postives = 694/979 (70.89%), Query Frame = 3
Query:  255 DEKRFTNQKFE----FIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVT--IRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINR-SNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSC 3167
            +E++  NQK +    F  RHIGP+  D + ML+ LG  ++  +I+ T+P++I+ ++ +KL +  +E   + +L+KIA +N+V+RSYIGMGY   I P  I RNI ENPGW T+YTPYQPEI+QGRLE+LLNFQT+I DLTG+E+ANASLLDE TAAAEA+ ++  + +N+   +F+   CH QTIDV++TRA   GI I+ G+  T DF    + G +LQYP ++GTI  + R  +E A     +  VA D LS T+L PPGE+  DI +GS+QRFG+PLG+GGPHAA+FATK+EY R++PGR+VGVSKD  G PA RLALQTREQHIRR+KATSNICTAQ LLA M++MYAVYHGP+GLK+IA+ IH LTL+LA G    G+KI ++   FDTL +       +L   +  +I +  ++  INL+   D +V +S+DET T +DL +L  IF++  S+      + D +   R +   N+  +RTS+YLTHPVFN +HSET L+RY+ KLE+KDLSL  SMIPLGSCTMKLN+T E+   +W EF +IHPF P +Q QGY  LF+QLE  L EITG+   SLQPN+G+QGEYAGL VI  Y     +++R +CLIPTSAHGTNPASA M GM V  V  + +G +D+ DL+ +  K+   LAA+MVTYPST+GVF++ I+ IC +VH +GGQVY+DGANMNAQVG+CRPGD G+DV HLNLHKTFCIPHGGGGPG+GPIGV  HL P+LP H ++     T  +       G V +AP+GSASIL ISW YI +MG  GL QA++VAILNANY+ K+L+ YY   +  +NG  AHE I+D +   K+  IE+ D++KRLMDYGFH+PT+SWPV   +M+EPTESE K E DR CDALI IR+EI  IE GK+D   N LK APH+ E + +  W   Y+R  AAYPA W R     KFWP+V RID  +GD+N +CSC
Sbjct:   11 NEQQVLNQKSQKLSSFAPRHIGPNSDDIQQMLKVLGFPSLDALIDKTVPQTIRLKQPLKLPEAESEYAALASLKKIAAKNQVFRSYIGMGYYDTITPLVIGRNILENPGWYTAYTPYQPEIAQGRLEALLNFQTLIIDLTGLEIANASLLDEATAAAEAMSLSYGVSKNQANAYFVSHDCHPQTIDVLQTRAKPLGINIIVGDHQTFDFDRAIF-GAVLQYPASDGTI-YDYRAFIEKAHAKGALVTVAADPLSLTLLTPPGEFGADIAVGSTQRFGIPLGFGGPHAAYFATKEEYKRLVPGRIVGVSKDAQGKPALRLALQTREQHIRREKATSNICTAQVLLAVMASMYAVYHGPDGLKQIAENIHQLTLMLAAGLKHLGYKISSEHF-FDTLRV-------ELGTRSLEVILEACQARNINLRIFDDTAVGISVDETTTADDLIELFEIFAAPDSLLFGFKEIGDLIAARRKSSLQNSTFARTSNYLTHPVFNRYHSETELLRYLHKLESKDLSLTTSMIPLGSCTMKLNATAEMIPVTWEEFGKIHPFAPASQTQGYQILFQQLEAWLAEITGFAGISLQPNAGSQGEYAGLLVIRQYHENRGEAHRNVCLIPTSAHGTNPASAVMCGMKVVAVACDSQGNIDVDDLKAKAEKHSHELAALMVTYPSTHGVFEEPIQEICAVVHSHGGQVYMDGANMNAQVGICRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHPVVTINDSTQHS-----HIGAVAAAPWGSASILVISWMYIAMMGADGLTQATKVAILNANYIAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAAIEIDDVAKRLMDYGFHAPTVSWPVGGTIMVEPTESESKQELDRFCDALIAIRQEIAEIEVGKVDAQDNVLKNAPHTAESLITGEWQHPYSREQAAYPAPWTRE---YKFWPAVGRIDAAFGDRNFVCSC 971          
BLAST of Glycine cleavage system P protein vs. UniProt/SwissProt
Match: sp|Q3M9G1|GCSP_TRIV2 (Glycine dehydrogenase (decarboxylating) OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=gcvP PE=3 SV=1)

HSP 1 Score: 1006.51 bits (2601), Expect = 0.000e+0
Identity = 532/971 (54.79%), Postives = 675/971 (69.52%), Query Frame = 3
Query:  288 FIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVT--IRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGM----DSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            FI+RHIGPS +D + ML+ LG  ++ ++IE T+P +I+  K ++L    TE   +  L++IA +N+V+RSYIGMGY   I P  I RNI ENPGW T+YTPYQPEI+QGRLE+LLNFQTMI DLTG+E+ANASLLDE TAAAEA+ ++  + +N+   +F+   CH QTIDV++TRA   GIEI+ G+  T DF  K   G +LQYP ++GTI  + R  +E A     +  VA D LS T+L PPGE+  DI +GS+QRFG+PLG+GGPHAA+FATK+EY R +PGR+VGVSKDVNG  A RLALQTREQHIRR+KATSNICTAQ LLA M++MYAVYHGPEGLK+IA+ IH LT+ LAEG    G+KI ++   FDTL +       +L  +    I    ++  INL+   + +V +SLDET T  DL DL  IF+   ++           T   +  S N   R+SSYLTHPVFN +HSET L+RY+ +LE KDLSL  SMIPLGSCTMKLN+T E+   +W EF +IHPF P+ Q +GY  LF+QLE  L EITG+   +LQPN+G+QGEY GL VI  Y  +  +++R +CLIPTSAHGTNPASA M GM V  V  +  G +D+ DL+ +  K+   LAA+MVTYPST+GVF+  I+ IC ++H +GGQVY+DGANMNAQVG+CRPGD G+DV HLNLHKTFCIPHGGGGPG+GPIGV  HL              L G  V G      + G V +AP+GSASIL ISW YI +MG  GL QA++VAILNANY+ KRL+ YY   +  +NG  AHE I+D +   K+  IE+ DI+KRL+DYGFH+PT+SWPV   +M+EPTESE +AE DR CDALI IR+EI  IE GK+D H+N LK APH+ E +    W   Y+R  AAYP  W R     KFWPSV RID  +GD+N +CSC  +E
Sbjct:   34 FIQRHIGPSSADIQHMLDVLGFSSLDDLIEKTVPSTIRLHKKLQLPTAQTEYAALAKLKQIASKNQVFRSYIGMGYYDTITPPVIGRNILENPGWYTAYTPYQPEIAQGRLEALLNFQTMIIDLTGLEIANASLLDEATAAAEAMSMSYGVSKNKANAYFVSHDCHPQTIDVLQTRAKPLGIEIIIGDHQTFDFQ-KPIFGAVLQYPASDGTI-YDYRAFIETAHAQGALVTVAADPLSLTLLTPPGEFGADIAVGSTQRFGIPLGFGGPHAAYFATKEEYKRQVPGRIVGVSKDVNGKTALRLALQTREQHIRREKATSNICTAQVLLAVMASMYAVYHGPEGLKQIAENIHQLTVTLAEGLKRLGYKISSEHF-FDTLRV-------ELGTNNLETILAGCQARNINLRIFDETAVGISLDETTTPEDLIDLWQIFAGEDNL---------PFTPEELISSLNLPLRSSSYLTHPVFNRYHSETELLRYLHRLETKDLSLTTSMIPLGSCTMKLNATSEMIPVTWEEFGRIHPFAPLTQTRGYQILFQQLEAWLAEITGFAGVALQPNAGSQGEYTGLLVIRQYHESRGETHRNVCLIPTSAHGTNPASAVMCGMKVVAVACDAGGNIDIDDLKAKAEKHSHELAALMVTYPSTHGVFEAGIQEICAVIHSHGGQVYMDGANMNAQVGICRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLV-----------RFLPGHPVLGSGKNPQNIGAVAAAPWGSASILVISWMYIAMMGADGLTQATKVAILNANYIAKRLETYYPVLYKGQNGLVAHECILDLRALKKSANIEIDDIAKRLIDYGFHAPTVSWPVTGTIMVEPTESESQAELDRFCDALIAIRQEIAAIEAGKMDTHNNLLKNAPHTIESLIVGEWLHPYSREQAAYPVSWTRE---YKFWPSVGRIDAAFGDRNFVCSCLPME 971          
BLAST of Glycine cleavage system P protein vs. TrEMBL
Match: A0A1S3IXV5 (Glycine cleavage system P protein OS=Lingula unguis OX=7574 GN=LOC106168499 PE=3 SV=1)

HSP 1 Score: 1202.58 bits (3110), Expect = 0.000e+0
Identity = 616/1009 (61.05%), Postives = 765/1009 (75.82%), Query Frame = 3
Query:  192 SMEILNFKWNTYLTISR------REFCDEK-----RFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEF-KNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVEE 3182
            S   LN K+++ +++ R       +   EK      F ++  +F +RHIGPSE++KK ML+ +GVK IKE+I   +P++I+  + + L +P  E E++ +L+ IA  NK+WRSYIGMGY  C +P  I RNIFENPGW+T YTPYQ EI+QGRLESLLN+QTMICD+TG++VANASLLDE TAAAEA+G+  R N+R+KF++D RCH QTI VV TRA   GIE++   A   DFS ++  GVL QYPDTNG+I  ++   V +A+ + T+ + A DLL+ TIL+PPGE+++DI +G+SQRFG+PLGYGGPHA FFA KK+YIRM+PGRM+GV+KD +G  AYRL LQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGP GLK I  R+H   LIL EG  + GH  +N+ + +DTL I+P    ++L N    IIQ RA+  KINL+Y PD  + VSLDETV   DLNDLL +F S +   +I   L  D  +   +  N    RTS YLT  VFN  HSET +VRYMK LENKD+SLVHSMIPLGSCTMKLNST E+  CSW EF+ IHPF P+ Q  GY +LF++LE+DLCEITGY++ S QPNSGAQGEYAGLR I++Y  +  QS+R +CLIP SAHGTNPASAQMAGM +KP+K +K G +DM  L+  + K++DNLA +M+TYPST GVF++ IR IC ++H+NGGQ+YLDGANMNAQVGLCRPGDYG+DVSHLNLHKTFCIPHGGGGPG+GPIGVK HLAP+LPTH I+PP   TG      +SFG ++ AP+GS++ILPISWAYIK+MG +GL+ A+E+AILNANYM  RL GYYK+ + N  G+CAHEFI+DC+EF K  G+EV+DI+KRLMDYGFH+PTMSWPV   LM+EPTESE K E DR CDALI I+ EI  IE+GKLD   NPLKMAPHS +VV S NWDR Y+R MAAYPA +      +K WP+VSRIDDKYGDQNL C+C  +EE
Sbjct:    9 SSRTLNLKYDSLISLCRPISSQLNQLSVEKTRCYGNFYSRHDDFTERHIGPSETEKKDMLQFIGVKDIKELINKAVPENIRLGRELDLEEPKGEHEVLDHLKGIAKNNKLWRSYIGMGYYGCDVPPTIMRNIFENPGWVTQYTPYQAEIAQGRLESLLNYQTMICDMTGLDVANASLLDEATAAAEAMGLCYRYNQRQKFYVDERCHPQTIAVVTTRASVLGIEVICCPADEMDFSKQDIGGVLFQYPDTNGSI-EDLSAFVADAQANGTLVVCATDLLALTILRPPGEFEVDITVGTSQRFGVPLGYGGPHAGFFAVKKKYIRMVPGRMIGVTKDASGKEAYRLVLQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPHGLKHIGTRVHHAALILNEGVESAGHSQVNN-VFYDTLKIMPA--DQELNN----IIQ-RAQEKKINLRYFPDDHIGVSLDETVEIEDLNDLLWVFGSQEKAEDIAVALERDCPR---SLFNTPFKRTSKYLTENVFNRFHSETQIVRYMKILENKDVSLVHSMIPLGSCTMKLNSTTEMIPCSWSEFAHIHPFAPVEQALGYLQLFEELEKDLCEITGYDRISFQPNSGAQGEYAGLRAIMAYLKSKGQSHRTVCLIPASAHGTNPASAQMAGMEIKPIKADKYGEIDMVHLKTMVEKHKDNLACMMITYPSTFGVFEERIRDICSLIHDNGGQIYLDGANMNAQVGLCRPGDYGADVSHLNLHKTFCIPHGGGGPGMGPIGVKRHLAPHLPTHPIIPPYGTTGPEA---ESFGVISGAPYGSSAILPISWAYIKMMGAEGLRHATEIAILNANYMSYRLKGYYKTLYSNFAGYCAHEFIVDCREFKKTAGVEVVDIAKRLMDYGFHAPTMSWPVPGTLMVEPTESESKEELDRFCDALISIKHEIDDIEQGKLDPKINPLKMAPHSADVVLSSNWDRPYSREMAAYPASF--VCPDTKIWPTVSRIDDKYGDQNLFCTCLPMEE 1000          
BLAST of Glycine cleavage system P protein vs. TrEMBL
Match: A0A210QF92 (Glycine cleavage system P protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08182 PE=3 SV=1)

HSP 1 Score: 1158.28 bits (2995), Expect = 0.000e+0
Identity = 592/966 (61.28%), Postives = 733/966 (75.88%), Query Frame = 3
Query:  285 EFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDD-VTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCG-IEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSV 3176
            +F +RHIGP  ++K+ ML+ L +K + ++I+  +P +I   + ++L   L E EL+  L  IA +N VWRSYIG+GY +   P  I RN+FENPGW T YTPYQ E++QGRLE LLN+QTM+CD+T + VANASLLDE TAAAEA+G+  R N+R+KF+ID +CH QTI VV+TRA A GIE+   + S  D S+++  GVL+QYPDT+G++  +  ++V  A  + T+ + A DLL+ TIL+PPGE+ +DI +GSSQR G+P+GYGGPHA FF+T+  ++R+MPGRM+GV++D  GN AYRLALQTREQHIRRDKATSNICTAQALLANMSAMYA+YHGP+GLK I  R+H  TLILAEG    GH +  + + FDTL  +P   + +        I  RA   +INL+Y  D  V VSLDETV  +DL DLL I     S   +   L  +  T +R    N+   RTS++L HPVFN + SET +VRYMK LENKDLSLVHSMIPLGSCTMKLNST E+  CSW EF+ IHPFVP+ Q +GY E+F +LERDLCEITGY+K S QPNSGAQGEYAGLR I++Y  A  Q+ R +CLIP SAHGTNPASAQMAGM ++P+ V+K GAV+M+ L     K++D LA +MVTYPSTNGVFDKDIR ICDM+H  GGQVYLDGANMNAQVG+CRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAPYLPTH ++PP   TG       SFG V++APFGS++ILPISWAYIK+MG +GL+ ASE+A+LNANYM  RL+GYYK+ + NENG  AHEFI+DC+EFK    IEV+D++KRL DYGFHSPT SWPV+  LMIEPTESEDK E DR CDALI IR+EI+MIEEGK+D  +NPLK APHSQ VV +  WD  YTR +AA+P  + R    SKFWP+VSRIDD +GDQNL+C+CP +
Sbjct:  113 DFSERHIGPGNAEKRAMLDFLKLKDVDDLIDQAVPSNILLDRPLQLDPQLGELELIERLYHIAGKNDVWRSYIGIGYYNTYTPHTILRNMFENPGWTTQYTPYQAELAQGRLECLLNYQTMVCDMTRLPVANASLLDEATAAAEAMGLCYRHNKRRKFYIDRKCHPQTIGVVETRASALGIEVKRVDWSEMDLSNRDVCGVLIQYPDTDGSV-FDHTELVVKAHANGTLVVCATDLLALTILRPPGEFGVDIAVGSSQRMGIPMGYGGPHAGFFSTRNRFMRLMPGRMIGVTRDAKGNDAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAIYHGPDGLKHIGKRVHNATLILAEGIKKAGHNLRTE-MCFDTLRFMPKNGQAE--------ILHRASVKEINLRYYGDGHVGVSLDETVERSDLKDLLEIIGCRDSAESLAEELGPEPSTSIR----NSPYRRTSTFLQHPVFNRYQSETNIVRYMKYLENKDLSLVHSMIPLGSCTMKLNSTTEMMPCSWNEFANIHPFVPLPQTEGYREMFMELERDLCEITGYDKISFQPNSGAQGEYAGLRAIMAYLQANGQAQRTVCLIPVSAHGTNPASAQMAGMKIQPINVDKNGAVNMEHLSAMTEKHKDTLACLMVTYPSTNGVFDKDIREICDMIHHYGGQVYLDGANMNAQVGICRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPTHPVIPPYGTTGPEAK---SFGVVSAAPFGSSAILPISWAYIKMMGAKGLRHASEIAVLNANYMSARLEGYYKTLYKNENGLVAHEFILDCREFKKTANIEVMDVAKRLQDYGFHSPTTSWPVVGTLMIEPTESEDKEELDRFCDALIAIRKEIQMIEEGKIDSRNNPLKNAPHSQAVVMATQWDFPYTREVAAFPLPYVRPE--SKFWPTVSRIDDIFGDQNLVCTCPPM 1059          
BLAST of Glycine cleavage system P protein vs. TrEMBL
Match: A0A2C9JQZ7 (Glycine cleavage system P protein OS=Biomphalaria glabrata OX=6526 GN=106064339 PE=3 SV=1)

HSP 1 Score: 1155.2 bits (2987), Expect = 0.000e+0
Identity = 579/973 (59.51%), Postives = 728/973 (74.82%), Query Frame = 3
Query:  285 EFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCG-IEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVEEIVQSSE 3200
            +F +RHIGP+ S+ K MLE +GVK ++E+    +PK I   + + L +PL E EL+  L+++A +N+VWRSYIG GYN    P  I RNIFENPGW T YTPYQ E++QGRLESLLN+QTM+ DL  + V+NASLLDEGTAAAEA+ +  R N+RKKFF+DS+CH QTI VVKTRAD  GI++V GN    D S+K++ G L+QYPDT GT+  +   +V+ A ++ T+ + A DLL+ T++KPPG+ D DI IG++QRFG+P+GYGGPHA FFA K++++RM+PGR+VG+++D  G  A RLALQTREQHIRRDKATSNICTAQALLANMSAM+A++HGP+GL   A ++H   L+LAEG    GH  L   + FDT+   P              I+++AE  KINL+Y  D  V VSLDETV+  D+ DLL I   + S N+I   L +       +      +RTS YLTHPVFNS+HSET +VRYMK LEN+DLSL HSMIPLGSCTMKLNST E+  CSWPEF+ +HPFVP  Q +GY ++  +LE+DLCEITGY++ S QPNSGAQGEYAGLR I+SY  ++ Q  RK+CLIP SAHGTNPASAQMAGM ++P+ V++ GAVD+K ++    KY++ LA  M+TYPST+GVFDKD+R ICD+VH  GGQVYLDGANMNAQVG+CRPGDYGSDVSHLNLHKTFCIPHGGGGPG GPIGVK+HLAP+LP+H +LP      + +    SFG V+S P+GS+SILPISW+YIK+MG +GL++AS+VAILNANYM KRL G+YK+ F NE GFCAHEFIIDC+EFK    ++  DI+KRL DYGFH+PT+SWPV   LMIEPTESEDK E D  CDALI IR+EI  IE G+ +   NPLK APHSQ  V    W+R Y+  +A +PAI+ + G  +K WP+VSRIDD YGDQNLIC+CP+V +   S E
Sbjct:   73 DFSRRHIGPNSSEIKTMLEVVGVKNLEELTTNAVPKDILLNRDLALDEPLGEFELLERLKELASQNEVWRSYIGQGYNGTNTPTSILRNIFENPGWTTQYTPYQAELAQGRLESLLNYQTMVTDLMALPVSNASLLDEGTAAAEAMALCQRHNKRKKFFVDSKCHIQTISVVKTRADPLGIDVVEGNWQDLDLSNKDFCGALVQYPDTEGTVS-DFSSLVQQAHKNGTLMVAATDLLAVTLMKPPGDMDFDIAIGTNQRFGIPMGYGGPHAGFFACKEKFMRMLPGRVVGITRDAAGRRALRLALQTREQHIRRDKATSNICTAQALLANMSAMFAIFHGPKGLHHFAQKVHHGALLLAEGVKKSGH-TLTSTVFFDTVKFQP--------KDGIADIKRKAEEKKINLRYYTDGEVSVSLDETVSQKDIADLLDIVGCSLSANDIAKELGERPLN---SLERGSFARTSPYLTHPVFNSYHSETRIVRYMKNLENRDLSLAHSMIPLGSCTMKLNSTTEMIPCSWPEFAGLHPFVPKEQAKGYHQMLNELEKDLCEITGYDRISFQPNSGAQGEYAGLRTIMSYLDSLGQQQRKVCLIPVSAHGTNPASAQMAGMKIQPINVDRNGAVDIKHMKENAEKYKEELACCMITYPSTHGVFDKDVREICDIVHHFGGQVYLDGANMNAQVGICRPGDYGSDVSHLNLHKTFCIPHGGGGPGAGPIGVKKHLAPFLPSHPVLPL-----DGIDPKTSFGSVSSGPYGSSSILPISWSYIKMMGAKGLRKASQVAILNANYMSKRLAGHYKTLFTNEKGFCAHEFIIDCREFKKVANVDATDIAKRLQDYGFHAPTLSWPVSGTLMIEPTESEDKMELDNFCDALIMIRKEIHAIEVGQWNRECNPLKKAPHSQADVLLGKWERPYSPELAVFPAIFVQPG--TKVWPTVSRIDDIYGDQNLICTCPAVTDYASSDE 1025          
BLAST of Glycine cleavage system P protein vs. TrEMBL
Match: A0A3P8QIA0 (Glycine cleavage system P protein OS=Astatotilapia calliptera OX=8154 PE=3 SV=1)

HSP 1 Score: 1154.81 bits (2986), Expect = 0.000e+0
Identity = 585/1008 (58.04%), Postives = 754/1008 (74.80%), Query Frame = 3
Query:  159 RLRLPVRKCCYSMEILNFKWNTYLTISRREFCDEKRFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCG-IEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +L+  +R  C S+        T  T+S R+    +R   +  +F +RHIGP E +K+ ML+ LG++++ ++IE T+P SI+ Q+ +K+ DP+ E E++ +L+KIA +NKVWRSYIGMGY +C +P PI RN+ EN GW+T YTPYQPE++QGRLESLLN+QTMICD+TGM VANASLLDEGTAAAEA+ +  R+N+R+ F++D RCH QTI VV+TRA+  G++ V       DFS ++ +GVL QYPDT+G +  +   +V+ A +   +   A DLL+  +L+PPGE+ +DI +GSSQRFG+PL YGGPHAAFFA ++  +RMMPGRMVGV+KD  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AMYA+YHGP+GLK IA R H   LILAEG    GH++ ++ + FDTL I          + A   I +RAE  KINL+   D  + VSLDETVT  DL+DLL +F    S   I   + + V  +      +   RTS YLTH VFNS+HSET +VRYMK+LENKDLSLVHSMIPLGSCTMKLNS+ EL   +W EF+ IHPFVP++Q +GY +LF+QLE+DLCE+TGY+K S QPNSGAQGEYAGL  I +Y  +  +S+R +CLIP SAHGTNPASAQMAGM V+ V+V+K+G +D+  L+  + K++ NLAA+M+TYPST GVF++ +  +CD++H+NGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK HLAP+LP+H ++       ++V+   S G +++AP+GS++ILPISWAYIK+MG +GL+ A+EVAILNANYM KRL+G+YK  +    GF AHEFI+D + FK    IE +D++KRL DYGFH+PTMSWPV   LMIEPTESEDKAE DR CDAL+ IR+EI  IEEG++D   NPLKMAPHS   + + +WDR Y+R  AA+P  + +    +KFWPS+SRIDD YGDQNL+C+CP +E
Sbjct:   34 KLQCKIRNSCASLTTSARALRTSATVSSRQI---ERILPRHDDFAERHIGPGEKEKRDMLDVLGLESVDQLIENTVPSSIRLQRSLKMDDPVCENEVLESLQKIASKNKVWRSYIGMGYYNCSVPPPIQRNLLENAGWVTQYTPYQPEVAQGRLESLLNYQTMICDITGMPVANASLLDEGTAAAEAMQLCHRQNKRRTFYVDPRCHPQTIAVVQTRANYIGVKTVLKLPHEMDFSGQDVSGVLFQYPDTDGRV-EDFTALVDQAHKGGALACCATDLLALCVLRPPGEFGVDIALGSSQRFGVPLCYGGPHAAFFAVRENLVRMMPGRMVGVTKDAAGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMYALYHGPQGLKHIAKRTHGAALILAEGLKRAGHRLQSE-MFFDTLKISC--------SVAAKDILERAEQRKINLRVYADGVLGVSLDETVTERDLDDLLWVFGCESSAELIAEKMGERVKGIM----GSPFKRTSKYLTHQVFNSYHSETNIVRYMKRLENKDLSLVHSMIPLGSCTMKLNSSSELMPITWREFANIHPFVPLDQAEGYQKLFRQLEKDLCEVTGYDKISFQPNSGAQGEYAGLAAIKAYLNSKGESSRSVCLIPKSAHGTNPASAQMAGMKVQVVEVDKDGNIDLSHLKALVDKHKANLAAMMITYPSTFGVFEEHVGDVCDLIHKNGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFLPSHPVVSM-----QSVNISSSLGTISAAPWGSSAILPISWAYIKMMGSRGLRHATEVAILNANYMAKRLEGHYKILYRGRKGFVAHEFILDVRPFKKTANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAEMDRFCDALLAIRQEIAEIEEGRMDSRINPLKMAPHSLACISTSSWDRPYSRECAAFPLPFIKPE--TKFWPSISRIDDIYGDQNLMCTCPPME 1017          
BLAST of Glycine cleavage system P protein vs. TrEMBL
Match: A0A3P9C6F4 (Glycine cleavage system P protein OS=Maylandia zebra OX=106582 PE=3 SV=1)

HSP 1 Score: 1154.81 bits (2986), Expect = 0.000e+0
Identity = 585/1008 (58.04%), Postives = 754/1008 (74.80%), Query Frame = 3
Query:  159 RLRLPVRKCCYSMEILNFKWNTYLTISRREFCDEKRFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCG-IEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +L+  +R  C S+        T  T+S R+    +R   +  +F +RHIGP E +K+ ML+ LG++++ ++IE T+P SI+ Q+ +K+ DP+ E E++ +L+KIA +NKVWRSYIGMGY +C +P PI RN+ EN GW+T YTPYQPE++QGRLESLLN+QTMICD+TGM VANASLLDEGTAAAEA+ +  R+N+R+ F++D RCH QTI VV+TRA+  G++ V       DFS ++ +GVL QYPDT+G +  +   +V+ A +   +   A DLL+  +L+PPGE+ +DI +GSSQRFG+PL YGGPHAAFFA ++  +RMMPGRMVGV+KD  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AMYA+YHGP+GLK IA R H   LILAEG    GH++ ++ + FDTL I          + A   I +RAE  KINL+   D  + VSLDETVT  DL+DLL +F    S   I   + + V  +      +   RTS YLTH VFNS+HSET +VRYMK+LENKDLSLVHSMIPLGSCTMKLNS+ EL   +W EF+ IHPFVP++Q +GY +LF+QLE+DLCE+TGY+K S QPNSGAQGEYAGL  I +Y  +  +S+R +CLIP SAHGTNPASAQMAGM V+ V+V+K+G +D+  L+  + K++ NLAA+M+TYPST GVF++ +  +CD++H+NGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK HLAP+LP+H ++       ++V+   S G +++AP+GS++ILPISWAYIK+MG +GL+ A+EVAILNANYM KRL+G+YK  +    GF AHEFI+D + FK    IE +D++KRL DYGFH+PTMSWPV   LMIEPTESEDKAE DR CDAL+ IR+EI  IEEG++D   NPLKMAPHS   + + +WDR Y+R  AA+P  + +    +KFWPS+SRIDD YGDQNL+C+CP +E
Sbjct:   34 KLQCKIRNSCASLTTSARALRTSATVSSRQI---ERILPRHDDFAERHIGPGEKEKRDMLDVLGLESVDQLIENTVPSSIRLQRSLKMDDPVCENEVLESLQKIASKNKVWRSYIGMGYYNCSVPPPIQRNLLENAGWVTQYTPYQPEVAQGRLESLLNYQTMICDITGMPVANASLLDEGTAAAEAMQLCHRQNKRRTFYVDPRCHPQTIAVVQTRANYIGVKTVLKLPHEMDFSGQDVSGVLFQYPDTDGRV-EDFTALVDQAHKGGALACCATDLLALCVLRPPGEFGVDIALGSSQRFGVPLCYGGPHAAFFAVRENLVRMMPGRMVGVTKDAAGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMYALYHGPQGLKHIAKRTHGAALILAEGLKRAGHRLQSE-MFFDTLKISC--------SVAAKDILERAEQRKINLRVYADGVLGVSLDETVTERDLDDLLWVFGCESSAELIAEKMGERVKGIM----GSPFKRTSKYLTHQVFNSYHSETNIVRYMKRLENKDLSLVHSMIPLGSCTMKLNSSSELMPITWREFANIHPFVPLDQAEGYQKLFRQLEKDLCEVTGYDKISFQPNSGAQGEYAGLAAIKAYLNSKGESSRSVCLIPKSAHGTNPASAQMAGMKVQVVEVDKDGNIDLSHLKALVDKHKANLAAMMITYPSTFGVFEEHVGDVCDLIHKNGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFLPSHPVVSM-----QSVNISSSLGTISAAPWGSSAILPISWAYIKMMGSRGLRHATEVAILNANYMAKRLEGHYKILYRGRKGFVAHEFILDVRPFKKTANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAEMDRFCDALLAIRQEIAEIEEGRMDSRINPLKMAPHSLACISTSSWDRPYSRECAAFPLPFIKPE--TKFWPSISRIDDIYGDQNLMCTCPPME 1017          
BLAST of Glycine cleavage system P protein vs. Ensembl Cavefish
Match: gldc (glycine decarboxylase [Source:NCBI gene;Acc:103032063])

HSP 1 Score: 1144.8 bits (2960), Expect = 0.000e+0
Identity = 572/974 (58.73%), Postives = 736/974 (75.56%), Query Frame = 3
Query:  261 KRFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCG-IEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +R   +  +F +RHIGP + +K+ ML  LG+++I EMIE TIP SI+ Q+ +K+ DP+ E E++  L+KIA +NK+WRSYIGMGY +C +P  I RN+ EN GW+T YTPYQPE++QGRLESLLN+QTM+CD+TGM VANASLLDEGTAAAEA+ +  R+N+R+ F+ID RCH QTI VV+TRA+  G++ V       DFS K+ +GVL QYPDT G +  +   +V+ A +   +   A DLL+  +L+PPGE+ +DI +GSSQRFG+PL YGGPHAAFF+ K+  +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AMY +YHGP+GL+ IA+R H  TLILAEG    GHK+ ++   FDTL I  G   +         I ++A   +INL+   +  + VSLDE VT  DL+DLL +F    S   I   +S+    L  +       RTS +LTHPVFNS+HSET +VRYMK+LENKD+SLVHSMIPLGSCTMKLNS+ EL   +W EF+ IHPFVP++Q +GY +LF+QLERDLCE+TGY+K S QPNSGAQGEYAGL  I +Y  +  +++R +CLIP SAHGTNPASAQMAGM V+ V+V+K+G +D+  L+  + K+++NLAAIM+TYPSTNGVF++++  +C+++H+NGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAP+LP+H ++       ++ + + S G +++AP+GS++ILPISWAYIK+MG +GL+ A+EVAILNANYM KRL+ +YK  F    GF AHEFI+D + FK    IE +DI+KRL DYGFH+PTMSWPV   LMIEPTESEDK E DR CDAL+ IR+E+  IEEG++D   NPLKMAPHS   + S  WDR Y+R  AA+P  + R    +KFWP++SRIDD YGDQ+L+C+CP +E
Sbjct:   60 ERILPRHDDFAERHIGPGDKEKREMLNTLGLESISEMIENTIPSSIRLQRSLKMDDPVCENEILETLQKIASKNKIWRSYIGMGYYNCSVPPVIQRNLLENSGWVTQYTPYQPEVAQGRLESLLNYQTMVCDITGMAVANASLLDEGTAAAEAMQLCHRQNKRRTFYIDPRCHPQTIAVVQTRANYIGVKTVLKLPHEMDFSGKDVSGVLFQYPDTEGRV-EDFSALVDRAHKGGALACCATDLLALCVLRPPGEFGVDIALGSSQRFGVPLCYGGPHAAFFSVKENLVRMMPGRMVGVTRDAAGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMYGLYHGPQGLRHIAERTHNATLILAEGLIRAGHKLQHETF-FDTLKIHCGVASKD--------ILEKAVQREINLRVYSEGVLGVSLDENVTERDLDDLLWVFGCESSAELIAEKMSERTKGLLAS----PFKRTSKFLTHPVFNSYHSETNIVRYMKRLENKDISLVHSMIPLGSCTMKLNSSSELMPITWQEFANIHPFVPLDQAEGYQQLFRQLERDLCEVTGYDKISFQPNSGAQGEYAGLAAIKAYLNSKGEAHRTVCLIPKSAHGTNPASAQMAGMKVQVVEVDKDGNIDVAHLKAMVDKHKENLAAIMITYPSTNGVFEENVSEVCELIHQNGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVVNM-----QSSNTVSSLGTISAAPWGSSAILPISWAYIKMMGSKGLRHATEVAILNANYMAKRLENHYKILFKGSKGFVAHEFILDVRPFKKTANIEAVDIAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKGELDRFCDALVAIRQEVADIEEGRMDSRVNPLKMAPHSLACIASSTWDRPYSREYAAFPMPFVRPE--TKFWPTISRIDDIYGDQHLVCTCPPME 1012          
BLAST of Glycine cleavage system P protein vs. Ensembl Cavefish
Match: gldc (glycine decarboxylase [Source:NCBI gene;Acc:103032063])

HSP 1 Score: 1071.61 bits (2770), Expect = 0.000e+0
Identity = 546/974 (56.06%), Postives = 702/974 (72.07%), Query Frame = 3
Query:  261 KRFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCG-IEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +R   +  +F +RHIGP + +K+ ML  LG+++I EMIE TIP SI+ Q+ +K+ DP+ E E++  L+KIA +NK+WRSYIGMGY +C +P  I RN+ EN GW+T YTPYQPE++QGRLESLLN+QTM+CD+TGM VANASLLDEGTAAAEA+ +  R+N+R+ F+ID RCH QTI VV+TRA+  G++ V       DFS K+ +GVL QYPDT G +  +   +V+ A +   +   A DLL+  +L+PPGE+ +DI +GSSQRFG+PL YGGPHAAFF+ K+  +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AMY +YHGP+GL+ IA+R H  TLILAEG    GHK+ ++   FDTL I  G   +         I ++A   +INL+   +  + VSLDE VT  DL+DLL +F    S   I   +S+    L      +   RTS +LTHPVFNS+HSET +VRYMK+LENKD+SLVHSMIPLGSCTMKLNS+ EL   +W EF+ IHPFVP++Q +GY +LF+QLERDLCE+TGY+K S QPNSGAQGEYAGL  I +Y  +  +++R                                           + K+++NLAAIM+TYPSTNGVF++++  +C+++H+NGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK+HLAP+LP+H ++       ++ + + S G +++AP+GS++ILPISWAYIK+MG +GL+ A+EVAILNANYM KRL+ +YK  F    GF AHEFI+D + FK    IE +DI+KRL DYGFH+PTMSWPV   LMIEPTESEDK E DR CDAL+ IR+E+  IEEG++D   NPLKMAPHS   + S  WDR Y+R  AA+P  + R    +KFWP++SRIDD YGDQ+L+C+CP +E
Sbjct:   60 ERILPRHDDFAERHIGPGDKEKREMLNTLGLESISEMIENTIPSSIRLQRSLKMDDPVCENEILETLQKIASKNKIWRSYIGMGYYNCSVPPVIQRNLLENSGWVTQYTPYQPEVAQGRLESLLNYQTMVCDITGMAVANASLLDEGTAAAEAMQLCHRQNKRRTFYIDPRCHPQTIAVVQTRANYIGVKTVLKLPHEMDFSGKDVSGVLFQYPDTEGRV-EDFSALVDRAHKGGALACCATDLLALCVLRPPGEFGVDIALGSSQRFGVPLCYGGPHAAFFSVKENLVRMMPGRMVGVTRDAAGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMYGLYHGPQGLRHIAERTHNATLILAEGLIRAGHKLQHETF-FDTLKIHCGVASKD--------ILEKAVQREINLRVYSEGVLGVSLDENVTERDLDDLLWVFGCESSAELIAEKMSERTKGLLA----SPFKRTSKFLTHPVFNSYHSETNIVRYMKRLENKDISLVHSMIPLGSCTMKLNSSSELMPITWQEFANIHPFVPLDQAEGYQQLFRQLERDLCEVTGYDKISFQPNSGAQGEYAGLAAIKAYLNSKGEAHRT------------------------------------------VDKHKENLAAIMITYPSTNGVFEENVSEVCELIHQNGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVVNM-----QSSNTVSSLGTISAAPWGSSAILPISWAYIKMMGSKGLRHATEVAILNANYMAKRLENHYKILFKGSKGFVAHEFILDVRPFKKTANIEAVDIAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKGELDRFCDALVAIRQEVADIEEGRMDSRVNPLKMAPHSLACIASSTWDRPYSREYAAFPMPFVRPE--TKFWPTISRIDDIYGDQHLVCTCPPME 970          
BLAST of Glycine cleavage system P protein vs. Ensembl Yeast
Match: GCV2 (P subunit of the mitochondrial glycine decarboxylase complex; glycine decarboxylase is required for the catabolism of glycine to 5,10-methylene-THF; expression is regulated by levels of 5,10-methylene-THF in the cytoplasm [Source:SGD;Acc:S000004801])

HSP 1 Score: 927.932 bits (2397), Expect = 0.000e+0
Identity = 515/993 (51.86%), Postives = 673/993 (67.77%), Query Frame = 3
Query:  288 FIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDP---LTEGELVTNLRKIADRNKV-WRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEA--LGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTAD-----FSSKEYAGVLLQYPDTNGTICL--NMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEG--SSTGGHKILNDGLVFDTLHILPGG--DKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENG---FCAHEFIIDCQEFKNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHS-QEVVCSDNWD-RKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVEEIVQSSE 3200
            F +RH+GPS SD K ML+ +G   +   IE  +P +I  ++ +KL  P     E E++ +L KIA++N    +++IG GY   I+P  I RN+ E+P W TSYTPYQPEISQGRLE+LLNFQT++ DLTG+ VANASLLDEGTAA EA  L   I R ++ K+ ID + H+QT  V+ TRA  F IEI+  + S          + + +G L+QYP T+G+I    +M+++ +      ++  VA DL++ T+LKPP  Y  DIV+GSSQRFG+P+GYGGPHAAFFA   +  R +PGR+VG+SKD  G  A RLALQTREQHI+RDKATSNICTAQALLAN+++ Y VYHGP+GL+ I+ RI  LT ILA    + +  H+++N    FDTL I  G     EQL       + K  +   INL      ++ ++LDET T  D+ +LL +F     I      LS+D +    N    E  RT   L + VF+ HHSET ++RY+ +L+++DLSL +SMIPLGSCTMKLNSTVE+   +WP+FS IHPF P NQVQGY EL   LE+DLC ITG++  SLQPNSGAQGEY GLRVI SY  +  +++R +CLIP SAHGTNPASA MAG+ V PV   ++G++D+ DL+ +  ++   LAA+M+TYPST G+F+  I+   D+VH  GGQVYLDGANMNAQVGL  PGD G+DV HLNLHKTF IPHGGGGP   PI VK HL P+LP H ++      G    G  S   V+SAP+G+A +LPIS+AYIK+MG +GL  +S +A+LN+NYMM RL  +YK  FVNE      CAHEFI+D +E+K  G+E ID++KRL DYGFH+PT+++PV   LMIEPTESE+  E DR CDA+I I+EEI  +  G+       LK APHS ++++ S NWD R YTR  AAYP  + R    +KFWP+V+R+DD YGD NLIC+CPSVEEI   +E
Sbjct:   67 FARRHLGPSPSDVKKMLKTMGYSDLNAFIEELVPPNILKRRPLKLEAPSKGFCEQEMLQHLEKIANKNHYKVKNFIGKGYYGTILPPVIQRNLLESPEWYTSYTPYQPEISQGRLEALLNFQTVVSDLTGLPVANASLLDEGTAAGEAMLLSFNISRKKKLKYVIDKKLHQQTKSVLHTRAKPFNIEIIEVDCSDIKKAVDVLKNPDVSGCLVQYPATDGSILPPDSMKQLSDALHSHKSLLSVASDLMALTLLKPPAHYGADIVLGSSQRFGVPMGYGGPHAAFFAVIDKLNRKIPGRIVGISKDRLGKTALRLALQTREQHIKRDKATSNICTAQALLANVASSYCVYHGPKGLQNISRRIFSLTSILANAIENDSCPHELINKTW-FDTLTIKLGNGISSEQL-------LDKALKEFNINLFAVDTTTISLALDETTTKADVENLLKVFD----IENSSQFLSEDYS----NSFPREFQRTDEILRNEVFHMHHSETAMLRYLHRLQSRDLSLANSMIPLGSCTMKLNSTVEMMPITWPQFSNIHPFQPSNQVQGYKELITSLEKDLCSITGFDGISLQPNSGAQGEYTGLRVIRSYLESKGENHRNVCLIPVSAHGTNPASAAMAGLKVVPVNCLQDGSLDLVDLKNKAEQHSKELAAVMITYPSTYGLFEPGIQHAIDIVHSFGGQVYLDGANMNAQVGLTSPGDLGADVCHLNLHKTFSIPHGGGGPAGAPICVKSHLIPHLPKHDVVDMITGIG----GSKSIDSVSSAPYGNALVLPISYAYIKMMGNEGLPFSSVIAMLNSNYMMTRLKDHYKILFVNEMSTLKHCAHEFIVDLREYKAKGVEAIDVAKRLQDYGFHAPTLAFPVPGTLMIEPTESENLEELDRFCDAMISIKEEINALVAGQPK--GQILKNAPHSLEDLITSSNWDTRGYTREEAAYPLPFLR---YNKFWPTVARLDDTYGDMNLICTCPSVEEIANETE 1034          
BLAST of Glycine cleavage system P protein vs. Ensembl Nematostella
Match: EDO33822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR35])

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 345/566 (60.95%), Postives = 429/566 (75.80%), Query Frame = 3
Query: 1485 RAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVEE 3182
            RA   KINL+   D  V VSLDETV   DL+DLL +F       E+  +L++   K  +N   +   R SS+LTHPVFN+HH+ET +VRYMK LENKD+SLVHSMIPLGSCTMKLNST E+   +WP F+ IHP+ PI Q +GY +L+ + E+D+CEITG++    QPNSGAQGEY GLRVI +Y     Q +RK+CLIP SAHG NPASAQMAG  V+ +KV K G +DM+DL+ Q+ K+ D LA IMVTYPSTNG+F+  IR ICD+VH +GGQVYLDGAN+NAQVGLCRP DYG+DV H NLHKTFCIPHGGGGPG+GPIGVK+HL  YLP+H ++PP        +G   FG ++ AP+GS++ILPISWAYIKLMG +GL++A+EVAILNA YM  RL  YY + FV + G+CAHEFI+D +++K  G+E +DI+KRL DYGFH+PT+SWPV +ALMIEPTESE KAE DRLCDALI IREEIR IE+G  D  +NPLK APH Q VV SD+WD  Y+R +AA+PA W      +KFWP  SR+DDK+GDQ+L+C+CP +E+
Sbjct:    4 RAAERKINLRKYSDDKVGVSLDETVKEQDLDDLLWVFGCDSKAAEVGTHLAEVPYKSLLN---SPFKRLSSFLTHPVFNTHHAETNVVRYMKLLENKDISLVHSMIPLGSCTMKLNSTTEMMPITWPRFADIHPYAPIQQAKGYLQLYDEFEKDVCEITGFDAVCFQPNSGAQGEYTGLRVIKAYLENNGQGHRKVCLIPVSAHGNNPASAQMAGFNVQVIKVGKSGDIDMEDLKKQVEKFSDELACIMVTYPSTNGIFEAGIRDICDIVHYHGGQVYLDGANLNAQVGLCRPADYGADVMHSNLHKTFCIPHGGGGPGMGPIGVKKHLISYLPSHPVVPPQSTIA---AGAKPFGVISGAPYGSSAILPISWAYIKLMGGKGLRKATEVAILNAYYMAARLKDYY-AVFVGD-GYCAHEFILDAKDYKKTGVEAMDIAKRLQDYGFHAPTVSWPVSTALMIEPTESESKAELDRLCDALICIREEIRNIEDGVWDPKNNPLKNAPHPQAVVMSDHWDYPYSREVAAFPAPWLNG--TNKFWPGCSRVDDKHGDQHLVCTCPPLED 559          
BLAST of Glycine cleavage system P protein vs. Ensembl Nematostella
Match: EDO36039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJS0])

HSP 1 Score: 277.715 bits (709), Expect = 2.614e-83
Identity = 135/237 (56.96%), Postives = 168/237 (70.89%), Query Frame = 3
Query: 1485 RAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQ 2195
            RA   KINL+   D  V VSLDETV   DL+DLL +F       E+  +L++   K  +N   +   R SS+LTHPVFN+HH+ET +VRYMK LENKD+SLVHSMIPLGSCTMKLNST E+   +WP F+ IHP+ PI Q +GY +L+ + E+D CEITG++    QPNSGAQGEY GLRVI +Y     Q +RK+CLIP SAHGTNPASAQMAG  V+ +KV K G +DM+DL+ Q
Sbjct:    4 RAAERKINLRKYSDDKVGVSLDETVKEQDLDDLLWVFGCDSKAAEVGTHLAEVPHKSLLN---SPFKRLSSFLTHPVFNTHHAETNVVRYMKLLENKDISLVHSMIPLGSCTMKLNSTTEMMPITWPRFADIHPYAPIQQAKGYLQLYDEFEKDFCEITGFDAVCFQPNSGAQGEYTGLRVIKAYLENNGQGHRKVCLIPVSAHGTNPASAQMAGFNVQVIKVGKSGDIDMEDLKKQ 237          
BLAST of Glycine cleavage system P protein vs. Ensembl Nematostella
Match: EDO44072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWQ5])

HSP 1 Score: 184.111 bits (466), Expect = 9.278e-54
Identity = 84/131 (64.12%), Postives = 107/131 (81.68%), Query Frame = 3
Query: 2532 SGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDAL 2924
            +G   FG ++ AP+GS++ILPISWAYIKLMG +GL++A+EVAILNANYM  RL  YY   FV  +G+CAHEFI+D +++K  G+E +DI+KRL DYGFH+PT+S PV +AL+IEPTESE KAE DRLCDAL
Sbjct:   26 AGAKPFGVISGAPYGSSAILPISWAYIKLMGGKGLRKATEVAILNANYMAARLKDYYAVLFVG-DGYCAHEFILDAKDYKKTGVEAMDIAKRLQDYGFHAPTVSRPVSTALVIEPTESESKAELDRLCDAL 155          
BLAST of Glycine cleavage system P protein vs. Ensembl Medaka
Match: gldc (glycine decarboxylase [Source:NCBI gene;Acc:101160738])

HSP 1 Score: 1136.32 bits (2938), Expect = 0.000e+0
Identity = 574/974 (58.93%), Postives = 734/974 (75.36%), Query Frame = 3
Query:  261 KRFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCG-IEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +R   +  +F +RHIGP E +K+ ML+ LG+++I ++IE T+P SI+ Q+ +K+ DP+ E E++  L+KIA  NKVWRSYIGMGY +C +P P+ RN+ EN GW+T YTPYQPE+SQGRLESLLN+QTMICD+TGM VANASLLDEGTAAAEA+ +  R+N+R+ F+ID RCH QTI VV+TRA+  G++ V       DFS K+ +GVL QYPDT+G +  +   +V+ A +   +   A DLL+  +L+PPGE+ +DI +GSSQRFG+PL YGGPHAAFFA +   +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AMYA+YHGP+GLK IA+R H   LILAEG    GH+ L+  + +DTL I          + A   I +RA   +INL+   +  + VSLDETVT  DL+DLL +F    S   I   + + V  +      +   RTS +LTH VFNS+HSET +VRYMK+LENKD+SLVHSMIPLGSCTMKLNS+ EL   +W EF  IHPFVP++Q +GY +LF+QLE+DLCE+TGY+K S QPNSGAQGEYAGL  I +Y  +  +S+R +CLIP SAHGTNPASAQMAGM V+ V+V+K+G +D+  L+  + K++ +LAA+M+TYPST GVF+++I  +C+++H+NGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK HLAP+LP+H ++       ++V+   S G +++AP+GS++ILPISW YIK+MG +GL  A+EVAILNANYM KRL+G+YK  F    GF AHEFI+D + FK    IE +D++KRL DYGFH+PTMSWPV   LMIEPTESEDKAE DR CDAL+ IR+EI  IEEG++D   NPLKMAPHS   + S NWDR Y+R  AA+P  + R    +KFWP++SRIDD YGDQ+L+C+CP +E
Sbjct:   66 ERILPRHDDFAERHIGPGEREKRDMLDVLGLESIDQLIENTVPASIRLQRSLKMDDPICENEVLEALQKIASENKVWRSYIGMGYYNCSVPPPVQRNLLENAGWVTQYTPYQPEVSQGRLESLLNYQTMICDITGMPVANASLLDEGTAAAEAMQLCHRQNKRRTFYIDPRCHPQTIAVVQTRANYIGVKTVLKLPHEMDFSGKDVSGVLFQYPDTDGRV-EDFTALVDRAHKGGALACCATDLLALCVLRPPGEFGVDIALGSSQRFGVPLCYGGPHAAFFAVRDNLVRMMPGRMVGVTRDAAGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMYALYHGPQGLKHIAERTHNAALILAEGLKRAGHR-LHSEIFYDTLKIHC--------SVAAKDILERATQRQINLRIYQEGVLGVSLDETVTERDLDDLLWVFGCESSAELIAEKMGERVKGIM----GSPFKRTSKFLTHQVFNSYHSETNIVRYMKRLENKDISLVHSMIPLGSCTMKLNSSSELMPITWKEFGNIHPFVPLDQAEGYQKLFRQLEKDLCEVTGYDKISFQPNSGAQGEYAGLAAIKAYLNSKGESSRSVCLIPKSAHGTNPASAQMAGMKVQVVEVDKDGNIDLVHLKALVEKHKASLAAMMITYPSTFGVFEENIGDVCELIHQNGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFLPSHPVVAM-----QSVNSSRSLGTISAAPWGSSAILPISWTYIKMMGSRGLTHATEVAILNANYMAKRLEGHYKVLFRGRKGFVAHEFILDVRPFKKTANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAEMDRFCDALLGIRQEIAEIEEGRMDSRINPLKMAPHSLACISSSNWDRPYSREYAAFPLPFIRPE--TKFWPTISRIDDIYGDQHLVCTCPPME 1018          
BLAST of Glycine cleavage system P protein vs. Ensembl Medaka
Match: gldc (glycine decarboxylase [Source:NCBI gene;Acc:101160738])

HSP 1 Score: 1063.14 bits (2748), Expect = 0.000e+0
Identity = 548/974 (56.26%), Postives = 700/974 (71.87%), Query Frame = 3
Query:  261 KRFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCG-IEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVE 3179
            +R   +  +F +RHIGP E +K+ ML+ LG+++I ++IE T+P SI+ Q+ +K+ DP+ E E++  L+KIA  NKVWRSYIGMGY +C +P P+ RN+ EN GW+T YTPYQPE+SQGRLESLLN+QTMICD+TGM VANASLLDEGTAAAEA+ +  R+N+R+ F+ID RCH QTI VV+TRA+  G++ V       DFS K+ +GVL QYPDT+G +  +   +V+ A +   +   A DLL+  +L+PPGE+ +DI +GSSQRFG+PL YGGPHAAFFA +   +RMMPGRMVGV++D  G   YRLALQTREQHIRRDKATSNICTAQALLANM+AMYA+YHGP+GLK IA+R H   LILAEG    GH+ L+  + +DTL I          + A   I +RA   +INL+   +  + VSLDETVT  DL+DLL +F    S   I   + + V  +      +   RTS +LTH VFNS+HSET +VRYMK+LENKD+SLVHSMIPLGSCTMKLNS+ EL   +W EF  IHPFVP++Q +GY +LF+QLE+DLCE+TGY+K S QPNSGAQGEYAGL  I +Y  +  +S+R +                                           K++ +LAA+M+TYPST GVF+++I  +C+++H+NGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPG+GPIGVK HLAP+LP+H ++       ++V+   S G +++AP+GS++ILPISW YIK+MG +GL  A+EVAILNANYM KRL+G+YK  F    GF AHEFI+D + FK    IE +D++KRL DYGFH+PTMSWPV   LMIEPTESEDKAE DR CDAL+ IR+EI  IEEG++D   NPLKMAPHS   + S NWDR Y+R  AA+P  + R    +KFWP++SRIDD YGDQ+L+C+CP +E
Sbjct:   66 ERILPRHDDFAERHIGPGEREKRDMLDVLGLESIDQLIENTVPASIRLQRSLKMDDPICENEVLEALQKIASENKVWRSYIGMGYYNCSVPPPVQRNLLENAGWVTQYTPYQPEVSQGRLESLLNYQTMICDITGMPVANASLLDEGTAAAEAMQLCHRQNKRRTFYIDPRCHPQTIAVVQTRANYIGVKTVLKLPHEMDFSGKDVSGVLFQYPDTDGRV-EDFTALVDRAHKGGALACCATDLLALCVLRPPGEFGVDIALGSSQRFGVPLCYGGPHAAFFAVRDNLVRMMPGRMVGVTRDAAGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMYALYHGPQGLKHIAERTHNAALILAEGLKRAGHR-LHSEIFYDTLKIHC--------SVAAKDILERATQRQINLRIYQEGVLGVSLDETVTERDLDDLLWVFGCESSAELIAEKMGERVKGIM----GSPFKRTSKFLTHQVFNSYHSETNIVRYMKRLENKDISLVHSMIPLGSCTMKLNSSSELMPITWKEFGNIHPFVPLDQAEGYQKLFRQLEKDLCEVTGYDKISFQPNSGAQGEYAGLAAIKAYLNSKGESSRSV------------------------------------------EKHKASLAAMMITYPSTFGVFEENIGDVCELIHQNGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFLPSHPVVAM-----QSVNSSRSLGTISAAPWGSSAILPISWTYIKMMGSRGLTHATEVAILNANYMAKRLEGHYKVLFRGRKGFVAHEFILDVRPFKKTANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAEMDRFCDALLGIRQEIAEIEEGRMDSRINPLKMAPHSLACISSSNWDRPYSREYAAFPLPFIRPE--TKFWPTISRIDDIYGDQHLVCTCPPME 976          
BLAST of Glycine cleavage system P protein vs. Planmine SMEST
Match: SMESG000022206.1 (SMESG000022206.1)

HSP 1 Score: 2040 bits (5284), Expect = 0.000e+0
Identity = 1022/1024 (99.80%), Postives = 1023/1024 (99.90%), Query Frame = 3
Query:  141 MALFANRLRLPVRKCCYSMEILNFKWNTYLTISRREFCDEKRFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCXXXXXXXXXXXXXXXKEHLAXXXXXXXXXXXXXXXGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALXXXXXXXXXXXXGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVEEIVQSSELLFK 3212
            MALFANRLRLPVRKCCYSMEILNFKWNTYLTISRREFCDEKRFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESL+INLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGVGPIGVKEHLAPYLPTHLILPPTILTGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALIQIREEI MIEEGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVEEIVQSSELLFK
Sbjct:    1 MALFANRLRLPVRKCCYSMEILNFKWNTYLTISRREFCDEKRFTNQKFEFIKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTEGELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTPYQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRRNRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVLLQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDIVIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYRLALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIHLLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRAESLEINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSDDVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLVHSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLERDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTSAHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTYPSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGVGPIGVKEHLAPYLPTHLILPPTILTGEAVSGMDSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRLDGYYKSKFVNENGFCAHEFIIDCQEFKNCGIEVIDISKRLMDYGFHSPTMSWPVISALMIEPTESEDKAECDRLCDALIQIREEISMIEEGKLDLHSNPLKMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKYGDQNLICSCPSVEEIVQSSELLFK 1024          
The following BLAST results are available for this feature:
BLAST of Glycine cleavage system P protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLDC0.000e+057.29glycine decarboxylase [Source:HGNC Symbol;Acc:HGNC... [more]
GLDC5.792e-14960.00glycine decarboxylase [Source:HGNC Symbol;Acc:HGNC... [more]
GLDC6.288e-13056.19glycine decarboxylase [Source:HGNC Symbol;Acc:HGNC... [more]
GLDC9.170e-7859.72glycine decarboxylase [Source:HGNC Symbol;Acc:HGNC... [more]
GLDC5.214e-7165.22glycine decarboxylase [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Glycine cleavage system P protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gldc-10.000e+056.43Glycine cleavage system P protein [Source:UniProt... [more]
gldc-10.000e+056.43Glycine cleavage system P protein [Source:UniProt... [more]
gldc-10.000e+057.42Glycine cleavage system P protein [Source:UniProt... [more]
back to top
BLAST of Glycine cleavage system P protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG39990.000e+059.30gene:FBgn0037801 transcript:FBtr0337048[more]
CG39990.000e+059.30gene:FBgn0037801 transcript:FBtr0082225[more]
back to top
BLAST of Glycine cleavage system P protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gldc0.000e+048.57glycine dehydrogenase (decarboxylating) [Source:ZF... [more]
back to top
BLAST of Glycine cleavage system P protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLDC0.000e+059.21glycine decarboxylase [Source:NCBI gene;Acc:100497... [more]
GLDC0.000e+060.24glycine decarboxylase [Source:NCBI gene;Acc:100497... [more]
GLDC0.000e+060.33glycine decarboxylase [Source:NCBI gene;Acc:100497... [more]
GLDC0.000e+055.80glycine decarboxylase [Source:NCBI gene;Acc:100497... [more]
GLDC0.000e+056.31glycine decarboxylase [Source:NCBI gene;Acc:100497... [more]
back to top
BLAST of Glycine cleavage system P protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Gldc0.000e+057.39glycine decarboxylase [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Glycine cleavage system P protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P15505|GCSP_CHICK0.000e+059.01Glycine dehydrogenase (decarboxylating), mitochond... [more]
sp|Q91W43|GCSP_MOUSE0.000e+057.39Glycine dehydrogenase (decarboxylating), mitochond... [more]
sp|P23378|GCSP_HUMAN0.000e+057.29Glycine dehydrogenase (decarboxylating), mitochond... [more]
sp|B2J427|GCSP_NOSP70.000e+054.24Glycine dehydrogenase (decarboxylating) OS=Nostoc ... [more]
sp|Q3M9G1|GCSP_TRIV20.000e+054.79Glycine dehydrogenase (decarboxylating) OS=Trichor... [more]
back to top
BLAST of Glycine cleavage system P protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IXV50.000e+061.05Glycine cleavage system P protein OS=Lingula ungui... [more]
A0A210QF920.000e+061.28Glycine cleavage system P protein OS=Mizuhopecten ... [more]
A0A2C9JQZ70.000e+059.51Glycine cleavage system P protein OS=Biomphalaria ... [more]
A0A3P8QIA00.000e+058.04Glycine cleavage system P protein OS=Astatotilapia... [more]
A0A3P9C6F40.000e+058.04Glycine cleavage system P protein OS=Maylandia zeb... [more]
back to top
BLAST of Glycine cleavage system P protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gldc0.000e+058.73glycine decarboxylase [Source:NCBI gene;Acc:103032... [more]
gldc0.000e+056.06glycine decarboxylase [Source:NCBI gene;Acc:103032... [more]
back to top
BLAST of Glycine cleavage system P protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine cleavage system P protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GCV20.000e+051.86P subunit of the mitochondrial glycine decarboxyla... [more]
back to top
BLAST of Glycine cleavage system P protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO338220.000e+060.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360392.614e-8356.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440729.278e-5464.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycine cleavage system P protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gldc0.000e+058.93glycine decarboxylase [Source:NCBI gene;Acc:101160... [more]
gldc0.000e+056.26glycine decarboxylase [Source:NCBI gene;Acc:101160... [more]
back to top
BLAST of Glycine cleavage system P protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000022206.10.000e+099.80SMESG000022206.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006517 ID=SMED30006517|Name=Glycine cleavage system P protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3489bp
AGAAAATTGAATTATTGATTTAAAAATGTCTGATTATTTGAGGTAATTTT
TTCATTGGCTGCACACAATCAAAACCATGTGACAATTAAAGAATTGAATT
ATCGAATCAAATCATTTCACATTTTCTTTAGACTCTAACCATGGCTTTGT
TTGCGAATAGATTAAGGTTACCGGTTCGAAAATGTTGCTATTCAATGGAA
ATTTTGAACTTCAAATGGAACACGTATTTGACTATATCTAGAAGAGAATT
TTGCGACGAGAAACGTTTTACAAATCAAAAATTTGAATTTATTAAACGTC
ACATTGGTCCTTCTGAATCTGATAAAAAATTGATGTTGGAAAAACTTGGT
GTTAAAACTATCAAGGAAATGATAGAGTTGACAATTCCAAAATCAATCAA
ATGTCAAAAGTTTATCAAACTCAGTGACCCTTTGACTGAAGGTGAATTAG
TGACAAATCTCAGAAAAATAGCAGATCGTAACAAAGTATGGCGTTCATAC
ATTGGTATGGGATACAATAGTTGCATCATTCCAGCTCCTATAGCCAGGAA
CATATTTGAGAATCCGGGATGGATTACCTCATACACACCATATCAACCAG
AGATTTCTCAGGGTCGTTTAGAAAGCTTATTGAATTTTCAAACAATGATC
TGTGACCTAACAGGAATGGAAGTTGCCAATGCAAGTCTTCTTGATGAAGG
AACAGCGGCTGCTGAAGCTTTGGGTGTAACGATAAGAAGAAATCGTAGAA
AGAAATTTTTTATTGATTCACGATGCCATCGGCAGACAATAGATGTTGTG
AAAACTAGAGCGGATGCTTTTGGAATTGAAATTGTCACTGGAAATGCATC
AACGGCTGACTTTTCTTCAAAAGAATATGCAGGAGTTTTACTGCAATATC
CAGATACAAATGGAACCATTTGCTTGAATATGAGGAAAATAGTGGAAAAT
GCTAAACAATCTGATACTATGACGATTGTAGCTGGTGATCTTTTAAGTTG
GACAATTTTAAAACCGCCGGGTGAGTATGATATTGACATTGTAATTGGTT
CGAGTCAAAGATTCGGTTTACCTCTCGGGTATGGCGGTCCACATGCAGCT
TTCTTTGCGACAAAAAAAGAGTATATTCGAATGATGCCTGGAAGAATGGT
TGGTGTATCAAAGGATGTGAATGGTAACCCAGCATACCGACTTGCCTTAC
AAACGAGAGAACAGCATATCAGAAGAGATAAAGCGACAAGTAATATTTGT
ACTGCTCAAGCACTTTTAGCAAATATGTCTGCAATGTATGCTGTTTATCA
TGGTCCCGAAGGCCTTAAGGAAATCGCAGACAGGATTCATCTTCTAACTT
TAATTTTAGCGGAAGGATCTTCTACTGGAGGTCACAAAATACTTAACGAC
GGATTAGTTTTTGATACTTTGCATATATTGCCTGGAGGTGATAAAGAACA
ATTGAGAAACCATGCATTTACTATAATTCAGAAGAGAGCGGAAAGCTTAA
AAATTAATCTTCAGTATCGTCCAGATTATAGTGTCGTGGTGTCTCTTGAT
GAAACCGTCACGTATAATGATTTAAATGATTTACTTTCGATTTTCAGCAG
TACCAAATCAATAAATGAAATTCTCAATAATCTGAGTGATGATGTGACAA
AATTGCGAATTAATAGATCTAACAATGAATTATCAAGGACTAGCTCATAT
TTAACACATCCAGTATTCAATTCTCATCATTCCGAAACTTGTTTAGTTCG
ATATATGAAGAAGCTGGAAAATAAAGATTTATCTCTGGTACACTCTATGA
TTCCTTTAGGTTCTTGTACAATGAAATTGAATAGCACAGTGGAATTGAAT
GCTTGCTCTTGGCCTGAATTTTCTCAAATTCATCCATTTGTTCCCATTAA
CCAGGTCCAAGGATATGCTGAACTATTTAAACAACTGGAAAGAGATCTTT
GTGAAATAACTGGTTATGAGAAGTTTTCTTTGCAACCTAACAGTGGTGCG
CAAGGAGAATATGCCGGACTTCGTGTTATTTTGTCTTATTTTACGGCAAT
TGAACAATCAAACCGTAAAATATGTCTTATTCCAACATCAGCTCATGGGA
CAAATCCTGCAAGTGCTCAAATGGCAGGGATGATTGTCAAGCCAGTAAAA
GTCAATAAAGAAGGTGCTGTAGATATGAAAGATTTAGAACTTCAAATTTC
TAAATATCGCGACAATTTAGCAGCGATTATGGTTACTTATCCTAGTACAA
ATGGAGTTTTTGATAAGGATATTCGAGTAATATGTGATATGGTTCACGAG
AACGGTGGTCAAGTATATCTAGATGGTGCTAATATGAATGCGCAAGTAGG
ATTATGTAGACCTGGGGATTATGGAAGTGATGTTTCACACCTTAATTTGC
ATAAAACATTTTGCATTCCTCACGGCGGAGGGGGACCAGGTGTGGGACCT
ATTGGTGTTAAAGAACACTTAGCTCCATATCTCCCAACTCATTTAATTTT
ACCACCTACAATTTTGACTGGAGAAGCAGTCTCAGGTATGGATAGTTTTG
GCCCTGTAACATCTGCACCTTTCGGATCTGCATCGATTCTTCCGATTTCT
TGGGCATACATTAAGCTCATGGGTTTTCAAGGTTTGAAGCAGGCATCTGA
AGTAGCTATTCTAAATGCAAATTATATGATGAAAAGATTGGATGGCTACT
ATAAGAGTAAATTTGTTAATGAAAATGGATTTTGCGCTCATGAGTTCATA
ATTGATTGTCAAGAGTTTAAAAATTGTGGAATAGAGGTCATTGACATATC
AAAACGATTAATGGATTATGGTTTTCACAGTCCAACAATGTCTTGGCCTG
TTATATCAGCATTAATGATTGAGCCGACAGAAAGTGAAGATAAGGCAGAA
TGTGATAGATTATGTGATGCTTTAATTCAAATCAGAGAAGAAATCAGGAT
GATTGAAGAAGGAAAATTGGATTTACACAGCAATCCTCTGAAAATGGCTC
CTCATTCTCAAGAAGTAGTATGTTCAGATAATTGGGATAGAAAGTATACA
CGAGTTATGGCAGCCTATCCTGCAATTTGGCAAAGAACTGGCGTTGTGTC
AAAATTTTGGCCGAGTGTTAGCCGAATAGATGATAAATATGGCGATCAGA
ATTTAATATGCTCATGTCCTTCAGTTGAAGAAATAGTTCAGTCATCAGAA
CTTTTATTTAAATAGTACAGAAAAGTAAAACTAATTAAAGGATGACAGTT
TATCAGCTTTTCTTAATTGTGTGATAAAATTGAGAACTTATAATTGAATA
AATGTTTTTTCCTATTTTCTAATATGTAGCAGCTGTGTAACCATGGGTAA
AACTGATGCACTTTTATTATTTACTTATTTAAATAAATTATGTGCATGAA
ATGATTATTTAAAGAATTTCAAAACAGAAAAATAAAGGATGAAGTGAAAA
AAAATTTCATTTATTTTATTACTAGTTGTTGTAAGGTGC
back to top

protein sequence of SMED30006517-orf-1

>SMED30006517-orf-1 ID=SMED30006517-orf-1|Name=SMED30006517-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1025bp
MALFANRLRLPVRKCCYSMEILNFKWNTYLTISRREFCDEKRFTNQKFEF
IKRHIGPSESDKKLMLEKLGVKTIKEMIELTIPKSIKCQKFIKLSDPLTE
GELVTNLRKIADRNKVWRSYIGMGYNSCIIPAPIARNIFENPGWITSYTP
YQPEISQGRLESLLNFQTMICDLTGMEVANASLLDEGTAAAEALGVTIRR
NRRKKFFIDSRCHRQTIDVVKTRADAFGIEIVTGNASTADFSSKEYAGVL
LQYPDTNGTICLNMRKIVENAKQSDTMTIVAGDLLSWTILKPPGEYDIDI
VIGSSQRFGLPLGYGGPHAAFFATKKEYIRMMPGRMVGVSKDVNGNPAYR
LALQTREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKEIADRIH
LLTLILAEGSSTGGHKILNDGLVFDTLHILPGGDKEQLRNHAFTIIQKRA
ESLKINLQYRPDYSVVVSLDETVTYNDLNDLLSIFSSTKSINEILNNLSD
DVTKLRINRSNNELSRTSSYLTHPVFNSHHSETCLVRYMKKLENKDLSLV
HSMIPLGSCTMKLNSTVELNACSWPEFSQIHPFVPINQVQGYAELFKQLE
RDLCEITGYEKFSLQPNSGAQGEYAGLRVILSYFTAIEQSNRKICLIPTS
AHGTNPASAQMAGMIVKPVKVNKEGAVDMKDLELQISKYRDNLAAIMVTY
PSTNGVFDKDIRVICDMVHENGGQVYLDGANMNAQVGLCRPGDYGSDVSH
LNLHKTFCIPHGGGGPGVGPIGVKEHLAPYLPTHLILPPTILTGEAVSGM
DSFGPVTSAPFGSASILPISWAYIKLMGFQGLKQASEVAILNANYMMKRL
DGYYKSKFVNENGFCAHEFIIDCQEFKNCGIEVIDISKRLMDYGFHSPTM
SWPVISALMIEPTESEDKAECDRLCDALIQIREEIRMIEEGKLDLHSNPL
KMAPHSQEVVCSDNWDRKYTRVMAAYPAIWQRTGVVSKFWPSVSRIDDKY
GDQNLICSCPSVEEIVQSSELLFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0003824catalytic activity
GO:0004375glycine dehydrogenase (decarboxylating) activity
GO:0016829lyase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003437GcvP
IPR020581GDC_P
IPR015422PyrdxlP-dep_Trfase_dom1
IPR015421PyrdxlP-dep_Trfase_major
IPR020580GDC-P_N
IPR015424PyrdxlP-dep_Trfase
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006546glycine catabolic process
GO:0006520cellular amino acid metabolic process
GO:0006544glycine metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 679..699
NoneNo IPR availablePANTHERPTHR11773:SF1GLYCINE DEHYDROGENASE (DECARBOXYLATING), MITOCHONDRIALcoord: 40..1017
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 132..390
e-value: 1.1E-106
score: 357.9
coord: 570..797
e-value: 2.3E-61
score: 209.3
IPR003437Glycine dehydrogenase (decarboxylating)TIGRFAMTIGR00461TIGR00461coord: 53..1009
e-value: 0.0
score: 1350.5
IPR020581Glycine cleavage system P proteinPFAMPF02347GDC-Pcoord: 52..485
e-value: 1.5E-176
score: 587.5
coord: 526..786
e-value: 4.9E-9
score: 35.5
IPR020581Glycine cleavage system P proteinPANTHERPTHR11773GLYCINE DEHYDROGENASE, DECARBOXYLATINGcoord: 40..1017
IPR020581Glycine cleavage system P proteinCDDcd00613GDC-Pcoord: 532..928
e-value: 3.19219E-135
score: 411.24
IPR020581Glycine cleavage system P proteinCDDcd00613GDC-Pcoord: 100..485
e-value: 4.9484E-163
score: 483.272
IPR015422Pyridoxal phosphate-dependent transferase domain 1GENE3DG3DSA:3.90.1150.10coord: 821..959
e-value: 2.7E-40
score: 139.0
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 53..482
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 529..1010