Histone acetyltransferase

Overview
NameHistone acetyltransferase
Smed IDSMED30006506
Length (bp)2255
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone acetyltransferase (SMED30006506) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone acetyltransferase (SMED30006506) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone acetyltransferase (SMED30006506) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone acetyltransferase (SMED30006506) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006506

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006506SMESG000049001.1 SmedASXL_017191SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006506SMESG000049001.1 SmedASXL_017191SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30006506SMESG000049001.1 dd_Smed_v4_4706_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT5 (lysine acetyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:5275])

HSP 1 Score: 443.351 bits (1139), Expect = 4.584e-148
Identity = 239/500 (47.80%), Postives = 324/500 (64.80%), Query Frame = 2
Query:   26 NKLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSAL---KNEDQMSLVTMDDR----NCFSYLQEP------VANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
             ++ EG +LPV  ++ D    +  AEIL  ++    G K +YVH+ ++NKRLD+WV+ +R+ + ++ FP K+        + T          SP  E   ++ E V     + S T+ +++       + ++     R    NC    ++       + +    TGS++  S + H DIVTRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY +S  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++                      + LK E +  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:   38 GEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDIS--GRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKE------AKTPTKNGLPGSRPGSPEREVK-RKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLV--SDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEIL----------------------MGLKSE-SGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW 494          
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT5 (lysine acetyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:5275])

HSP 1 Score: 441.81 bits (1135), Expect = 5.276e-148
Identity = 239/500 (47.80%), Postives = 324/500 (64.80%), Query Frame = 2
Query:   26 NKLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSAL---KNEDQMSLVTMDDR----NCFSYLQEP------VANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
             ++ EG +LPV  ++ D    +  AEIL  ++    G K +YVH+ ++NKRLD+WV+ +R+ + ++ FP K+        + T          SP  E   ++ E V     + S T+ +++       + ++     R    NC    ++       + +    TGS++  S + H DIVTRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY +S  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++                      + LK E +  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:    5 GEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDIS--GRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKE------AKTPTKNGLPGSRPGSPEREVK-RKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLV--SDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEIL----------------------MGLKSE-SGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW 461          
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT5 (lysine acetyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:5275])

HSP 1 Score: 409.838 bits (1052), Expect = 6.021e-138
Identity = 202/335 (60.30%), Postives = 252/335 (75.22%), Query Frame = 2
Query:  473 TGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            TGS++  S + H DIVTRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY +S  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++                      + LK E +  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:    2 TGSLV--SDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEIL----------------------MGLKSE-SGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW 302          
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT5 (lysine acetyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:5275])

HSP 1 Score: 412.535 bits (1059), Expect = 7.977e-136
Identity = 202/335 (60.30%), Postives = 252/335 (75.22%), Query Frame = 2
Query:  473 TGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            TGS++  S + H DIVTRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY +S  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++                      + LK E +  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:  213 TGSLV--SDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEIL----------------------MGLKSE-SGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW 513          

HSP 2 Score: 53.1434 bits (126), Expect = 1.498e-6
Identity = 26/72 (36.11%), Postives = 46/72 (63.89%), Query Frame = 2
Query:   26 NKLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKK 232
             ++ EG +LPV  ++ D    +  AEIL  ++    G K +YVH+ ++NKRLD+WV+ +R+ + ++ FP K+
Sbjct:    5 GEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDIS--GRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKE 74          
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT5 (lysine acetyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:5275])

HSP 1 Score: 413.305 bits (1061), Expect = 9.120e-136
Identity = 202/335 (60.30%), Postives = 252/335 (75.22%), Query Frame = 2
Query:  473 TGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            TGS++  S + H DIVTRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY +S  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++                      + LK E +  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:  246 TGSLV--SDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEIL----------------------MGLKSE-SGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW 546          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: mys-1 (Histone acetyltransferase Tip60 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9TYU5])

HSP 1 Score: 395.971 bits (1016), Expect = 1.110e-130
Identity = 220/492 (44.72%), Postives = 294/492 (59.76%), Query Frame = 2
Query:   23 FNKLCEGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQT--------GSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVT--KKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKR 1468
            + K+ EG +L V +   +   +AE++ +R     G+ ++YVH+ + N+RLD+WV  DR+ +     P K   K                  +   E N    EN   K         S  K   ++ L+ MDD    S   +P+  +   T        GSM +  H E  D +TR+RN++ I LG+SRI+PWYF+PYP++LT LD I+ICEFCLKY KS  CL+RH+EKC + HPPGN+IY  + LSFFEIDGRKNK YAQNLCLLAKLFLDHKTLYYDTDPFLFY+L E DE+G HIVGYFSKEKES ++ NVACIL LPP+Q+KGYG LLIEFSYELSK+E KTGSPEKPLSDLGLLSYRSYW   IM+ +                          + F    P   + +        D+ + TSI  +D+ +TL  +++  Y KG ++IV++  K+ + + +   AK+K RI+   L W PK++ K+
Sbjct:   27 YEKVTEGCRLLVMMASQEEERWAEVI-SRCRAANGSIKFYVHYIDCNRRLDEWVQSDRLNLASCELPKKGGKK-----------------GAHLREENRDSNENEGKK---------SGRKR--KIPLLPMDDLKAESV--DPLQAISTMTSGSTPSLRGSMSMVGHSE--DAMTRIRNVECIELGRSRIQPWYFAPYPQQLTSLDCIYICEFCLKYLKSKTCLKRHMEKCAMCHPPGNQIYSHDKLSFFEIDGRKNKSYAQNLCLLAKLFLDHKTLYYDTDPFLFYVLTEEDEKGHHIVGYFSKEKESAEEYNVACILVLPPFQKKGYGSLLIEFSYELSKIEQKTGSPEKPLSDLGLLSYRSYWSMAIMKEL--------------------------FAFKRRHPGEDITV-------QDISQSTSIKREDVVSTLQQLDLYKYYKGSYIIVISDEKRQVYEKRIEAAKKKTRINPAALQWRPKEYGKK 452          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: mys-2 (Histone acetyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A131MBB1])

HSP 1 Score: 262.307 bits (669), Expect = 1.062e-78
Identity = 145/344 (42.15%), Postives = 207/344 (60.17%), Query Frame = 2
Query:  101 KARENKRLGTKE--YYVHFDEYNKRLDDWVSEDRMKMHEMVF-PTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSST--SSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEV 1117
            K+ EN   G KE  YYVH++E ++R D+W++ D++ ++E+V  P  K+                               E++  +I +       S AL    + +L        +S+L+  + N L  T + +   H+E     T+++NI  I +G   I  WY+SP+P +   LD I++CE+CL Y       ++H++ C++R PPGNEIYRK+ LS +E+DG   K Y Q LCLL+KLF+DHKTLY+D D F+FY+LCE DE G HIVGYFS+E ES   NN+ACI+  PP+Q+KGYGKLLI+FSYELS+ E   G PEKPLSDLG +SYRSYW   +M++
Sbjct:   75 KSIENHEQGAKELMYYVHYEELDRRNDEWITLDKILVNEVVVEPVIKV-------------------------PTKAPVEDLHKEIVVGPPVIKPSGALTRSQRRTL------EEYSHLKTDL-NDLDATTARLEREHEER----TKVKNIPQITIGAHEILAWYYSPFPPDCENLD-IYMCEYCLLYTPHHERFKQHIDTCKVRQPPGNEIYRKDHLSVYEVDGSGQKLYCQCLCLLSKLFMDHKTLYFDVDDFMFYVLCETDEHGAHIVGYFSREVESA--NNLACIMVFPPFQKKGYGKLLIQFSYELSRREGYIGMPEKPLSDLGKVSYRSYWWWRLMKL 379          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: mys-2 (Histone acetyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A131MBB1])

HSP 1 Score: 262.692 bits (670), Expect = 1.122e-78
Identity = 145/344 (42.15%), Postives = 207/344 (60.17%), Query Frame = 2
Query:  101 KARENKRLGTKE--YYVHFDEYNKRLDDWVSEDRMKMHEMVF-PTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSST--SSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEV 1117
            K+ EN   G KE  YYVH++E ++R D+W++ D++ ++E+V  P  K+                               E++  +I +       S AL    + +L        +S+L+  + N L  T + +   H+E     T+++NI  I +G   I  WY+SP+P +   LD I++CE+CL Y       ++H++ C++R PPGNEIYRK+ LS +E+DG   K Y Q LCLL+KLF+DHKTLY+D D F+FY+LCE DE G HIVGYFS+E ES   NN+ACI+  PP+Q+KGYGKLLI+FSYELS+ E   G PEKPLSDLG +SYRSYW   +M++
Sbjct:   75 KSIENHEQGAKELMYYVHYEELDRRNDEWITLDKILVNEVVVEPVIKV-------------------------PTKAPVEDLHKEIVVGPPVIKPSGALTRSQRRTLEE------YSHLKTDL-NDLDATTARLEREHEER----TKVKNIPQITIGAHEILAWYYSPFPPDCENLD-IYMCEYCLLYTPHHERFKQHIDTCKVRQPPGNEIYRKDHLSVYEVDGSGQKLYCQCLCLLSKLFMDHKTLYFDVDDFMFYVLCETDEHGAHIVGYFSREVESA--NNLACIMVFPPFQKKGYGKLLIQFSYELSRREGYIGMPEKPLSDLGKVSYRSYWWWRLMKL 379          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: lsy-12 (Histone acetyltransferase [Source:UniProtKB/TrEMBL;Acc:L8E6K3])

HSP 1 Score: 206.838 bits (525), Expect = 2.897e-58
Identity = 97/192 (50.52%), Postives = 127/192 (66.15%), Query Frame = 2
Query:  545 IVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVI 1120
            I  G   +K WY SP+P E   +  +FICEFC  Y +S   +Q H +KC LR PPG EIYRK  +S FE+DGR  K+Y Q LCL++++FL+ KT++YDT+PF FYI+   D+ G H  GYFSKEK   D NN++CI+TLP YQ  G G+ LI+ SY LS+ E   G PE+PLS+LG  +Y  YW  TI   +
Sbjct:  216 IHFGAFIMKTWYGSPFPAEFINVKKLFICEFCFFYARSDEIMQNHAKKCMLRAPPGLEIYRKGDISVFEVDGRLQKEYCQTLCLVSRMFLESKTVFYDTEPFFFYIVTINDDIGCHFAGYFSKEKYEPDVNNLSCIMTLPCYQEMGLGRFLIDISYALSRKEKWFGGPEQPLSELGRKAYGGYWRTTIASCL 407          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: lsy-12 (Histone acetyltransferase [Source:UniProtKB/TrEMBL;Acc:L8E6K3])

HSP 1 Score: 206.838 bits (525), Expect = 2.897e-58
Identity = 97/192 (50.52%), Postives = 127/192 (66.15%), Query Frame = 2
Query:  545 IVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVI 1120
            I  G   +K WY SP+P E   +  +FICEFC  Y +S   +Q H +KC LR PPG EIYRK  +S FE+DGR  K+Y Q LCL++++FL+ KT++YDT+PF FYI+   D+ G H  GYFSKEK   D NN++CI+TLP YQ  G G+ LI+ SY LS+ E   G PE+PLS+LG  +Y  YW  TI   +
Sbjct:  216 IHFGAFIMKTWYGSPFPAEFINVKKLFICEFCFFYARSDEIMQNHAKKCMLRAPPGLEIYRKGDISVFEVDGRLQKEYCQTLCLVSRMFLESKTVFYDTEPFFFYIVTINDDIGCHFAGYFSKEKYEPDVNNLSCIMTLPCYQEMGLGRFLIDISYALSRKEKWFGGPEQPLSELGRKAYGGYWRTTIASCL 407          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: Tip60 (gene:FBgn0026080 transcript:FBtr0070668)

HSP 1 Score: 419.083 bits (1076), Expect = 2.220e-138
Identity = 206/335 (61.49%), Postives = 252/335 (75.22%), Query Frame = 2
Query:  470 QTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGR 1474
            Q+GSM+  +HQ+  D+VTRM+N++MI LG+ RIKPWYFSPYP+EL ++  I+ICEFCLKY KS  CL+RHL KC LRHPPGNEIYRK+ +SFFEIDGRKNK YAQNLCLLAKLFLDHKTLYYDTDPFLFY++ E+D  GFHIVGYFSKEKES +D NVACILT+PPYQRKGYGKLLIEFSYELSK E KTGSPEKPLSDLGLLSYRSYW QTI+E+ I                   PS   +      KP  T+         +D+ E TSI  +D+ +TL  +N+I Y KGQ+++ + + ++++ + +M KRK RID+K L+W PKDWSKR +
Sbjct:  242 QSGSMV--THQD--DVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMPCIYICEFCLKYRKSRKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQN----------------PSTDGE------KPTITI---------NDICECTSIKKEDVISTLQNLNLINYYKGQYIVCINRVIIEQHRRAMDKRKIRIDSKCLHWTPKDWSKRSK 541          

HSP 2 Score: 57.3806 bits (137), Expect = 3.784e-8
Identity = 25/66 (37.88%), Postives = 45/66 (68.18%), Query Frame = 2
Query:   32 LCEGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTK 229
            L EG +LPV++  +D +  AEI+  +E    G +++YVH+ ++NKRLD+WV+E+ +   ++ FP +
Sbjct:   23 LTEGCRLPVRMHKTDDWPLAEIVSIKELD--GRRQFYVHYVDFNKRLDEWVNEEDLYTRKVQFPRR 86          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: Tip60 (gene:FBgn0026080 transcript:FBtr0333186)

HSP 1 Score: 419.083 bits (1076), Expect = 2.220e-138
Identity = 206/335 (61.49%), Postives = 252/335 (75.22%), Query Frame = 2
Query:  470 QTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGR 1474
            Q+GSM+  +HQ+  D+VTRM+N++MI LG+ RIKPWYFSPYP+EL ++  I+ICEFCLKY KS  CL+RHL KC LRHPPGNEIYRK+ +SFFEIDGRKNK YAQNLCLLAKLFLDHKTLYYDTDPFLFY++ E+D  GFHIVGYFSKEKES +D NVACILT+PPYQRKGYGKLLIEFSYELSK E KTGSPEKPLSDLGLLSYRSYW QTI+E+ I                   PS   +      KP  T+         +D+ E TSI  +D+ +TL  +N+I Y KGQ+++ + + ++++ + +M KRK RID+K L+W PKDWSKR +
Sbjct:  242 QSGSMV--THQD--DVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMPCIYICEFCLKYRKSRKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQN----------------PSTDGE------KPTITI---------NDICECTSIKKEDVISTLQNLNLINYYKGQYIVCINRVIIEQHRRAMDKRKIRIDSKCLHWTPKDWSKRSK 541          

HSP 2 Score: 57.3806 bits (137), Expect = 3.784e-8
Identity = 25/66 (37.88%), Postives = 45/66 (68.18%), Query Frame = 2
Query:   32 LCEGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTK 229
            L EG +LPV++  +D +  AEI+  +E    G +++YVH+ ++NKRLD+WV+E+ +   ++ FP +
Sbjct:   23 LTEGCRLPVRMHKTDDWPLAEIVSIKELD--GRRQFYVHYVDFNKRLDEWVNEEDLYTRKVQFPRR 86          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: Tip60 (gene:FBgn0026080 transcript:FBtr0333185)

HSP 1 Score: 368.237 bits (944), Expect = 1.424e-119
Identity = 170/218 (77.98%), Postives = 193/218 (88.53%), Query Frame = 2
Query:  470 QTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVII 1123
            Q+GSM+  +HQ+  D+VTRM+N++MI LG+ RIKPWYFSPYP+EL ++  I+ICEFCLKY KS  CL+RHL KC LRHPPGNEIYRK+ +SFFEIDGRKNK YAQNLCLLAKLFLDHKTLYYDTDPFLFY++ E+D  GFHIVGYFSKEKES +D NVACILT+PPYQRKGYGKLLIEFSYELSK E KTGSPEKPLSDLGLLSYRSYW QTI+E+ I
Sbjct:  242 QSGSMV--THQD--DVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMPCIYICEFCLKYRKSRKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFI 455          

HSP 2 Score: 57.7658 bits (138), Expect = 2.576e-8
Identity = 25/66 (37.88%), Postives = 45/66 (68.18%), Query Frame = 2
Query:   32 LCEGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTK 229
            L EG +LPV++  +D +  AEI+  +E    G +++YVH+ ++NKRLD+WV+E+ +   ++ FP +
Sbjct:   23 LTEGCRLPVRMHKTDDWPLAEIVSIKELD--GRRQFYVHYVDFNKRLDEWVNEEDLYTRKVQFPRR 86          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: mof (gene:FBgn0014340 transcript:FBtr0070829)

HSP 1 Score: 288.886 bits (738), Expect = 1.572e-85
Identity = 177/472 (37.50%), Postives = 254/472 (53.81%), Query Frame = 2
Query:   65 KDSDIYHFAEILKARENKRLGTK-EYYVHFDEYNKRLDDWVSEDRMKMHE------MVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKML-DKFKASMAKR-KYRIDAKLLNWHPK 1453
            ++    H  ++L++R  +      EYYVH+   N+RLD WV   R+  +        V P   +  D  + S   L      + +   E   + A    Y   L+   +S    ++ +M+       +  +++Q+  A +     ++     +EH+ I T+++ ID +  G   I  WYFSP+PEE  +   +++CE+CLKY +       HL +C  R PPG EIYRK  +S +E++G++   Y Q LCL+AKLFLDHK LY+D DPFLFYILCE D+EG HIVGYFSKEK+S ++ NVACIL LPP+QRKG+GKLLI FSYELS+ E   GSPEKPLSDLG LSYRSYW  T++E++               +   P  I++K                      ++ E + I   D+  TL +M +I Y KGQ+VI VT K + D  +    K+ K  ID   L W P+
Sbjct:  387 REDGTVHRGQVLQSRTTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPAPPLAPDQPSTSREMLAQQAAAAAAASSERQKRAANKDYY---LSYCENSRYDYSDRKMTRYQKRRYDEINHVQKSHAELTATQAAL----EKEHESI-TKIKYIDKLQFGNYEIDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAYHLHECDRRRPPGREIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSYWAYTLLELM--------------KTRCAPEQITIK----------------------ELSEMSGITHDDIIYTLQSMKMIKYWKGQNVICVTSKTIQDHLQLPQFKQPKLTIDTDYLVWSPQ 814          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: chm (gene:FBgn0028387 transcript:FBtr0079443)

HSP 1 Score: 276.174 bits (705), Expect = 5.954e-81
Identity = 140/313 (44.73%), Postives = 200/313 (63.90%), Query Frame = 2
Query:  530 RNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKE----KESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKY--RIDAKLLNWHP 1450
            + I  I +GK ++K WY SPYP++   L  ++ICEFCL+Y KS   ++RH EKC  RHPPG+EIYRK  L  +++DG++ K+Y Q+LCLLAK FLDHKTLYYD +PFLFYI+   D +G HIVGYFSK     +E N   NV+CILTLPPYQRKGYG+LLI+FSY L+++E K GSPEKPLSDLGL+SYRSYW   +++ + + + +               +I++K                      DV ++T+I   D+ +TL  + ++ Y KG+H+++  + +LD+++  + +R    +ID   L W P
Sbjct:  526 KGIKYISMGKYKMKVWYQSPYPDDAARLPKMYICEFCLRYQKSETGIKRHAEKCVWRHPPGDEIYRKGKLQVWQVDGKRYKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYIMTLADVDGCHIVGYFSKHIPFLQEKNSFYNVSCILTLPPYQRKGYGRLLIDFSYLLTRVEGKIGSPEKPLSDLGLISYRSYWKDVLLDYLCNRSGN---------------TIAIK----------------------DVSQETAIYSYDIVSTLQALGMMKYWKGKHIVLKKQDVLDEYEERVKRRGTFPKIDDSCLRWQP 801          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat5a (K(lysine) acetyltransferase 5a [Source:ZFIN;Acc:ZDB-GENE-040718-57])

HSP 1 Score: 421.009 bits (1081), Expect = 3.421e-139
Identity = 244/549 (44.44%), Postives = 324/549 (59.02%), Query Frame = 2
Query:   29 KLCEGVKLPV---KLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKI----------------HKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSST---SSSALKNEDQMSLVTMDDRNCFSYL----QEPVANVLPQTGSMMVTSH--------------------QEHQDIV---TRM-------RNIDMIV----------LGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            ++ EG +LPV     ++ D +  AEIL  ++    G K YYVH+ ++NKRLD+WV+ DR+ + ++ FP K+                  +D   +    + S +  S         ++AE+V    ++ ++T   S  A     Q +L T      F+       EP+ + L   G+  +  H                    Q+  D +    RM       R+ D IV          LG+ R+KPWYFSPYP+ELT L  I++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E+++D                      LK E    +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ +++  + +M KR  RID K L++ PKDWSKRG+W
Sbjct:    7 EITEGCRLPVLRRNQENEDEWPLAEILSVKDIS--GRKLYYVHYVDFNKRLDEWVTPDRLDIKKLQFPKKEAKTPMKNGLSGSRPSSPERDVKKSLDLHVQSASAPSRGKTVPTPKRKAESVSLATQVTAATPVPSLPASTEASQAALYTAIRDASFNIKSREEHEPLTS-LTTNGTTSIQRHLIPPQPGRKRKNCGGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIGCIELGRHRLKPWYFSPYPQELTSLPIIYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKAYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDPKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMD----------------------LKSE-NGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVEGHECAMQKRHLRIDPKCLHFTPKDWSKRGKW 520          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat5a (K(lysine) acetyltransferase 5a [Source:ZFIN;Acc:ZDB-GENE-040718-57])

HSP 1 Score: 417.542 bits (1072), Expect = 1.271e-137
Identity = 204/335 (60.90%), Postives = 250/335 (74.63%), Query Frame = 2
Query:  473 TGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            TGS++  S + H DIVTRM+NI  I LG+ R+KPWYFSPYP+ELT L  I++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E+++D                      LK E    +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ +++  + +M KR  RID K L++ PKDWSKRG+W
Sbjct:  241 TGSLV--SDRSHDDIVTRMKNIGCIELGRHRLKPWYFSPYPQELTSLPIIYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKAYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDPKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMD----------------------LKSE-NGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVEGHECAMQKRHLRIDPKCLHFTPKDWSKRGKW 541          

HSP 2 Score: 56.225 bits (134), Expect = 1.223e-7
Identity = 28/71 (39.44%), Postives = 46/71 (64.79%), Query Frame = 2
Query:   29 KLCEGVKLPV---KLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKK 232
            ++ EG +LPV     ++ D +  AEIL  ++    G K YYVH+ ++NKRLD+WV+ DR+ + ++ FP K+
Sbjct:    7 EITEGCRLPVLRRNQENEDEWPLAEILSVKDIS--GRKLYYVHYVDFNKRLDEWVTPDRLDIKKLQFPKKE 75          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat5b (K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZDB-GENE-030131-985])

HSP 1 Score: 416.387 bits (1069), Expect = 3.314e-137
Identity = 201/335 (60.00%), Postives = 252/335 (75.22%), Query Frame = 2
Query:  473 TGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            TGS++  S + H DI+TRM+NID I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++++                      LK E    +P  T+         +++ E TS+  +D+ +TL  +N+I Y KGQ+++ +++ +++  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:  238 TGSLV--SDRSHDDIITRMKNIDCIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKMYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDSKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMN----------------------LKSE-NGERPQMTI---------NEISEITSVKKEDVISTLQYLNLINYYKGQYILTLSEDIVEGHERAMHKRHLRIDSKCLHFTPKDWSKRGKW 538          

HSP 2 Score: 56.9954 bits (136), Expect = 6.000e-8
Identity = 29/71 (40.85%), Postives = 46/71 (64.79%), Query Frame = 2
Query:   29 KLCEGVKLPVKLKDS---DIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKK 232
            ++ EG +LPV  K+    D +  AEIL  ++    G K YYVH+ ++NKRLD+WV+ DR+ + ++ FP K+
Sbjct:    7 EIVEGCRLPVLRKNQENEDEWPLAEILSVKDIP--GRKLYYVHYIDFNKRLDEWVTPDRLDLKKLQFPKKE 75          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat8 (K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB-GENE-030131-7510])

HSP 1 Score: 335.495 bits (859), Expect = 1.650e-106
Identity = 186/460 (40.43%), Postives = 264/460 (57.39%), Query Frame = 2
Query:   80 YHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQE-AENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRK--YRIDAKLLNWHP 1450
            +H AE++++R N++ G +E+YVH+  +N+RLD+WV + R+ + + V                      D       E    E  +  E KI  N        +  D+++           ++Q+  A + P T ++     +EH+ I T+++ +D I +G   I  WYFSP+PE+  +   ++ICE+CLKY K     + HL +C+ R PPG EIYRKN +S +E+DG+ +K Y QNLCLLAKLFLDHKTLY+D +PF+FYIL E +++G HIVGYFSKEKES D NNVACILTLPPYQR+GYGK LI FSYELSKLE+  GSPEKPLSDLG LSYRSYW   ++E++ D                   ++S+K                      D+ + TSI   D+ +TL ++N++ Y KGQHVI VT K++++   S   +K    +D   L W P
Sbjct:  113 WHSAEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVGKARLALTKTV---------------------KDAVRKSVEEGGGGELVDQPERKITRNQK------RKHDEIN-----------HVQKTYAEMDPTTAAL----EKEHEAI-TKVKYVDKIQIGNFEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKYEKTFRYHLSQCQWRQPPGKEIYRKNNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRG----------------TLSIK----------------------DLSQMTSITQSDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDTHCLKWAP 491          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat8 (K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB-GENE-030131-7510])

HSP 1 Score: 335.495 bits (859), Expect = 1.650e-106
Identity = 186/460 (40.43%), Postives = 264/460 (57.39%), Query Frame = 2
Query:   80 YHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQE-AENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRK--YRIDAKLLNWHP 1450
            +H AE++++R N++ G +E+YVH+  +N+RLD+WV + R+ + + V                      D       E    E  +  E KI  N        +  D+++           ++Q+  A + P T ++     +EH+ I T+++ +D I +G   I  WYFSP+PE+  +   ++ICE+CLKY K     + HL +C+ R PPG EIYRKN +S +E+DG+ +K Y QNLCLLAKLFLDHKTLY+D +PF+FYIL E +++G HIVGYFSKEKES D NNVACILTLPPYQR+GYGK LI FSYELSKLE+  GSPEKPLSDLG LSYRSYW   ++E++ D                   ++S+K                      D+ + TSI   D+ +TL ++N++ Y KGQHVI VT K++++   S   +K    +D   L W P
Sbjct:  113 WHSAEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVGKARLALTKTV---------------------KDAVRKSVEEGGGGELVDQPERKITRNQK------RKHDEIN-----------HVQKTYAEMDPTTAAL----EKEHEAI-TKVKYVDKIQIGNFEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKYEKTFRYHLSQCQWRQPPGKEIYRKNNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRG----------------TLSIK----------------------DLSQMTSITQSDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDTHCLKWAP 491          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: cxcl12 (C-X-C motif chemokine ligand 12 [Source:Xenbase;Acc:XB-GENE-919853])

HSP 1 Score: 449.899 bits (1156), Expect = 3.667e-151
Identity = 243/494 (49.19%), Postives = 324/494 (65.59%), Query Frame = 2
Query:   29 KLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDR--NCFSYLQEP------VANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            ++ EG +LPV  K+ D    +  AEIL  +E    G K +YVH+ ++NKRLD+WV+ DR+ + ++ FP K+        + T         +SP  E  +  A      + L+    + A++     ++     R  NC S  ++       + +    TGS++  S + H DI+TRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFYI+ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++++                      LK E T  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ +++  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:    7 EIVEGCRLPVLRKNQDNEVEWPLAEILSIKE--LTGKKLFYVHYIDFNKRLDEWVTHDRLDLKKIQFPKKE------AKTPTKNGLPGSRPSSPEREVVSAWALKETGHVNLSCRDDNGAVRRPSAPAVQPGRKRKSNCLSADEDSQDSSDGIPSAPRMTGSLV--SDRSHDDIITRMKNIECIELGRHRLKPWYFSPYPQELTVLPVLYLCEFCLKYVKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYIMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILME----------------------LKTE-TGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVEGHEKAMQKRVLRIDSKCLHFTPKDWSKRGKW 458          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: cxcl12 (C-X-C motif chemokine ligand 12 [Source:Xenbase;Acc:XB-GENE-919853])

HSP 1 Score: 447.588 bits (1150), Expect = 3.374e-150
Identity = 245/498 (49.20%), Postives = 326/498 (65.46%), Query Frame = 2
Query:   29 KLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANA----QEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDR--NCFSYLQEP------VANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            ++ EG +LPV  K+ D    +  AEIL  +E    G K +YVH+ ++NKRLD+WV+ DR+ + ++ FP K+        + T         +SP  E  +    +E  +V    R +   +S  L+     ++     R  NC S  ++       + +    TGS++  S + H DI+TRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFYI+ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++++                      LK E T  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ +++  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:    7 EIVEGCRLPVLRKNQDNEVEWPLAEILSIKE--LTGKKLFYVHYIDFNKRLDEWVTHDRLDLKKIQFPKKE------AKTPTKNGLPGSRPSSPEREVVSAWALKETGHVNLSCRDDVDHNSYPLRRPSAPAVQPGRKRKSNCLSADEDSQDSSDGIPSAPRMTGSLV--SDRSHDDIITRMKNIECIELGRHRLKPWYFSPYPQELTVLPVLYLCEFCLKYVKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYIMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILME----------------------LKTE-TGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVEGHEKAMQKRVLRIDSKCLHFTPKDWSKRGKW 462          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: cxcl12 (C-X-C motif chemokine ligand 12 [Source:Xenbase;Acc:XB-GENE-919853])

HSP 1 Score: 444.891 bits (1143), Expect = 5.010e-149
Identity = 245/506 (48.42%), Postives = 325/506 (64.23%), Query Frame = 2
Query:   29 KLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANA----QEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDR--NCFSY------------LQEPVANVLPQTGSMM--VTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            ++ EG +LPV  K+ D    +  AEIL  +E    G K +YVH+ ++NKRLD+WV+ DR+ + ++ FP K+        + T         +SP  E  +    +E  +V    R +   +S  L+     ++     R  NC S+            L    ++ +P    M   + S + H DI+TRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFYI+ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++++                      LK E T  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ +++  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:    5 EIVEGCRLPVLRKNQDNEVEWPLAEILSIKE--LTGKKLFYVHYIDFNKRLDEWVTHDRLDLKKIQFPKKE------AKTPTKNGLPGSRPSSPEREVVSAWALKETGHVNLSCRDDVDHNSYPLRRPSAPAVQPGRKRKSNCLSFTDRCLDIFLYNSLYNDSSDGIPSAPRMTGSLVSDRSHDDIITRMKNIECIELGRHRLKPWYFSPYPQELTVLPVLYLCEFCLKYVKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYIMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILME----------------------LKTE-TGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVEGHEKAMQKRVLRIDSKCLHFTPKDWSKRGKW 470          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: cxcl12 (C-X-C motif chemokine ligand 12 [Source:Xenbase;Acc:XB-GENE-919853])

HSP 1 Score: 443.736 bits (1140), Expect = 1.209e-148
Identity = 246/520 (47.31%), Postives = 322/520 (61.92%), Query Frame = 2
Query:   29 KLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPV----------ANVLPQ------------------------TGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            ++ EG +LPV  K+ D    +  AEIL  +E    G K +YVH+ ++NKRLD+WV+ DR+ + ++ FP K+    +              +  P    ++ E E V          S+ ALK    ++L   DD+     +                V PQ                        TGS++  S + H DI+TRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFYI+ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++++                      LK E T  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ +++  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:    6 EIVEGCRLPVLRKNQDNEVEWPLAEILSIKE--LTGKKLFYVHYIDFNKRLDEWVTHDRLDLKKIQFPKKEAKTPTK-------------NGLPGSRPSSPEREVV----------SAWALKETGHVNLSCRDDKRKVDIVSPATPVPPPPETTQVTVFPQVKLLIQTYFDSQDSSDGIPSAPRMTGSLV--SDRSHDDIITRMKNIECIELGRHRLKPWYFSPYPQELTVLPVLYLCEFCLKYVKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYIMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILME----------------------LKTE-TGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVEGHEKAMQKRVLRIDSKCLHFTPKDWSKRGKW 466          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: cxcl12 (C-X-C motif chemokine ligand 12 [Source:Xenbase;Acc:XB-GENE-919853])

HSP 1 Score: 413.69 bits (1062), Expect = 1.993e-136
Identity = 203/335 (60.60%), Postives = 253/335 (75.52%), Query Frame = 2
Query:  473 TGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            TGS++  S + H DI+TRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFYI+ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++++                      LK E T  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ +++  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:  204 TGSLV--SDRSHDDIITRMKNIECIELGRHRLKPWYFSPYPQELTVLPVLYLCEFCLKYVKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYIMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILME----------------------LKTE-TGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVEGHEKAMQKRVLRIDSKCLHFTPKDWSKRGKW 504          

HSP 2 Score: 57.7658 bits (138), Expect = 5.564e-8
Identity = 30/74 (40.54%), Postives = 47/74 (63.51%), Query Frame = 2
Query:   20 MFNKLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKK 232
            M  ++ EG +LPV  K+ D    +  AEIL  +E    G K +YVH+ ++NKRLD+WV+ DR+ + ++ FP K+
Sbjct:    1 MAAEIVEGCRLPVLRKNQDNEVEWPLAEILSIKE--LTGKKLFYVHYIDFNKRLDEWVTHDRLDLKKIQFPKKE 72          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat5 (K(lysine) acetyltransferase 5 [Source:MGI Symbol;Acc:MGI:1932051])

HSP 1 Score: 443.351 bits (1139), Expect = 2.509e-148
Identity = 239/500 (47.80%), Postives = 324/500 (64.80%), Query Frame = 2
Query:   26 NKLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSAL---KNEDQMSLVTMDDR----NCFSYLQEP------VANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
             ++ EG +LPV  ++ D    +  AEIL  ++    G K +YVH+ ++NKRLD+WV+ +R+ + ++ FP K+        + T          SP  E   ++ E V     + S T+ +++       + ++     R    NC    ++       + +    TGS++  S + H DIVTRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY +S  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++                      + LK E +  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:   38 GEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDIS--GRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKE------AKTPTKNGLPGSRPGSPEREVK-RKVEVVSPATPVPSETAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLV--SDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEIL----------------------MGLKSE-SGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW 494          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat5 (K(lysine) acetyltransferase 5 [Source:MGI Symbol;Acc:MGI:1932051])

HSP 1 Score: 442.195 bits (1136), Expect = 2.951e-148
Identity = 239/500 (47.80%), Postives = 324/500 (64.80%), Query Frame = 2
Query:   26 NKLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSAL---KNEDQMSLVTMDDR----NCFSYLQEP------VANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
             ++ EG +LPV  ++ D    +  AEIL  ++    G K +YVH+ ++NKRLD+WV+ +R+ + ++ FP K+        + T          SP  E   ++ E V     + S T+ +++       + ++     R    NC    ++       + +    TGS++  S + H DIVTRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY +S  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++                      + LK E +  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:    5 GEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDIS--GRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKE------AKTPTKNGLPGSRPGSPEREVK-RKVEVVSPATPVPSETAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLV--SDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEIL----------------------MGLKSE-SGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW 461          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat5 (K(lysine) acetyltransferase 5 [Source:MGI Symbol;Acc:MGI:1932051])

HSP 1 Score: 412.92 bits (1060), Expect = 4.010e-136
Identity = 237/543 (43.65%), Postives = 324/543 (59.67%), Query Frame = 2
Query:   26 NKLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAE-NVEYKIRLNSSTSSSALKNED------QMSLVTMDDRNCFSYLQ-----EPV------ANVLPQTGSMM---------------VTSHQEHQD------IVTRM-------RNIDMIV----------LGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
             ++ EG +LPV  ++ D    +  AEIL  ++    G K +YVH+ ++NKRLD+WV+ +R+ + ++ FP K+    +      +   + +       +A+ +     V+  +R N      A+   +        S +  + R+    ++      PV      A+V PQ GS                 + + ++ QD         RM       R+ D IV          LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY +S  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++                      + LK E +  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:    5 GEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDIS--GRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEIL----------------------MGLKSE-SGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW 513          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat8 (K(lysine) acetyltransferase 8 [Source:MGI Symbol;Acc:MGI:1915023])

HSP 1 Score: 330.872 bits (847), Expect = 3.140e-105
Identity = 185/459 (40.31%), Postives = 265/459 (57.73%), Query Frame = 2
Query:   80 YHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKF--KASMAKRKYRIDAKLLNWHP 1450
            +H AE++++R N + G +E+YVH+  +N+RLD+WV ++R+ + + V                      D       +  ++ AE  E KI  N        +  D+++           ++Q+  A + P T ++     +EH+ I T+++ +D I +G   I  WYFSP+PE+  +   +++CE+CLKY K     + HL +C+ R PPG EIYRK+ +S +E+DG+ +K Y QNLCLLAKLFLDHKTLY+D +PF+FYIL E D +G HIVGYFSKEKES D NNVACILTLPPYQR+GYGK LI FSYELSKLE+  GSPEKPLSDLG LSYRSYW   ++E++ D                   ++S+K                      D+ + TSI   D+ +TL ++N++ Y KGQHVI VT K++++    A   K    +D+  L W P
Sbjct:   70 WHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTV---------------------KDAVQKNSEKYLSELAEQPERKITRNQK------RKHDEIN-----------HVQKTYAEMDPTTAAL----EKEHEAI-TKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRG----------------TLSIK----------------------DLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAP 447          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat5 (K(lysine) acetyltransferase 5 [Source:MGI Symbol;Acc:MGI:1932051])

HSP 1 Score: 297.36 bits (760), Expect = 5.234e-92
Identity = 171/387 (44.19%), Postives = 227/387 (58.66%), Query Frame = 2
Query:   26 NKLCEGVKLPVKLKDSDI---YHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAE-NVEYKIRLNSSTSSSALKNED------QMSLVTMDDRNCFSYLQ-----EPV------ANVLPQTGSMM---------------VTSHQEHQD------IVTRM-------RNIDMIV----------LGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFS 1009
             ++ EG +LPV  ++ D    +  AEIL  ++    G K +YVH+ ++NKRLD+WV+ +R+ + ++ FP K+    +      +   + +       +A+ +     V+  +R N      A+   +        S +  + R+    ++      PV      A+V PQ GS                 + + ++ QD         RM       R+ D IV          LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY +S  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFS
Sbjct:    5 GEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDIS--GRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFS 389          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q5RBG4|KAT5_PONAB (Histone acetyltransferase KAT5 OS=Pongo abelii OX=9601 GN=KAT5 PE=2 SV=1)

HSP 1 Score: 441.81 bits (1135), Expect = 2.534e-147
Identity = 239/500 (47.80%), Postives = 324/500 (64.80%), Query Frame = 2
Query:   26 NKLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSAL---KNEDQMSLVTMDDR----NCFSYLQEP------VANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
             ++ EG +LPV  ++ D    +  AEIL  ++    G K +YVH+ ++NKRLD+WV+ +R+ + ++ FP K+        + T          SP  E   ++ E V     + S T+ +++       + ++     R    NC    ++       + +    TGS++  S + H DIVTRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY +S  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++                      + LK E +  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:    5 GEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDIS--GRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKE------AKTPTKNGLPGSRPGSPEREVK-RKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLV--SDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEIL----------------------MGLKSE-SGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW 461          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q960X4|TIP60_DROME (Histone acetyltransferase Tip60 OS=Drosophila melanogaster OX=7227 GN=Tip60 PE=1 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 2.225e-137
Identity = 206/335 (61.49%), Postives = 252/335 (75.22%), Query Frame = 2
Query:  470 QTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGR 1474
            Q+GSM+  +HQ+  D+VTRM+N++MI LG+ RIKPWYFSPYP+EL ++  I+ICEFCLKY KS  CL+RHL KC LRHPPGNEIYRK+ +SFFEIDGRKNK YAQNLCLLAKLFLDHKTLYYDTDPFLFY++ E+D  GFHIVGYFSKEKES +D NVACILT+PPYQRKGYGKLLIEFSYELSK E KTGSPEKPLSDLGLLSYRSYW QTI+E+ I                   PS   +      KP  T+         +D+ E TSI  +D+ +TL  +N+I Y KGQ+++ + + ++++ + +M KRK RID+K L+W PKDWSKR +
Sbjct:  242 QSGSMV--THQD--DVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMPCIYICEFCLKYRKSRKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQN----------------PSTDGE------KPTITI---------NDICECTSIKKEDVISTLQNLNLINYYKGQYIVCINRVIIEQHRRAMDKRKIRIDSKCLHWTPKDWSKRSK 541          

HSP 2 Score: 57.3806 bits (137), Expect = 3.793e-7
Identity = 25/66 (37.88%), Postives = 45/66 (68.18%), Query Frame = 2
Query:   32 LCEGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTK 229
            L EG +LPV++  +D +  AEI+  +E    G +++YVH+ ++NKRLD+WV+E+ +   ++ FP +
Sbjct:   23 LTEGCRLPVRMHKTDDWPLAEIVSIKELD--GRRQFYVHYVDFNKRLDEWVNEEDLYTRKVQFPRR 86          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q99MK2|KAT5_RAT (Histone acetyltransferase KAT5 OS=Rattus norvegicus OX=10116 GN=Kat5 PE=1 SV=2)

HSP 1 Score: 412.92 bits (1060), Expect = 2.805e-135
Identity = 237/543 (43.65%), Postives = 324/543 (59.67%), Query Frame = 2
Query:   26 NKLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAE-NVEYKIRLNSSTSSSALKNED------QMSLVTMDDRNCFSYLQ-----EPV------ANVLPQTGSMM---------------VTSHQEHQD------IVTRM-------RNIDMIV----------LGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
             ++ EG +LPV  ++ D    +  AEIL  ++    G K +YVH+ ++NKRLD+WV+ +R+ + ++ FP K+    +      +   + +       +A+ +     V+  +R N      A+   +        S +  + R+    ++      PV      A+V PQ GS                 + + ++ QD         RM       R+ D IV          LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY +S  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++                      + LK E +  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:    5 GEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDIS--GRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEIL----------------------MGLKSE-SGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW 513          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q8CHK4|KAT5_MOUSE (Histone acetyltransferase KAT5 OS=Mus musculus OX=10090 GN=Kat5 PE=1 SV=2)

HSP 1 Score: 412.92 bits (1060), Expect = 2.805e-135
Identity = 237/543 (43.65%), Postives = 324/543 (59.67%), Query Frame = 2
Query:   26 NKLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAE-NVEYKIRLNSSTSSSALKNED------QMSLVTMDDRNCFSYLQ-----EPV------ANVLPQTGSMM---------------VTSHQEHQD------IVTRM-------RNIDMIV----------LGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
             ++ EG +LPV  ++ D    +  AEIL  ++    G K +YVH+ ++NKRLD+WV+ +R+ + ++ FP K+    +      +   + +       +A+ +     V+  +R N      A+   +        S +  + R+    ++      PV      A+V PQ GS                 + + ++ QD         RM       R+ D IV          LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY +S  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++                      + LK E +  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:    5 GEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDIS--GRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEIL----------------------MGLKSE-SGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW 513          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q92993|KAT5_HUMAN (Histone acetyltransferase KAT5 OS=Homo sapiens OX=9606 GN=KAT5 PE=1 SV=2)

HSP 1 Score: 412.535 bits (1059), Expect = 3.831e-135
Identity = 202/335 (60.30%), Postives = 252/335 (75.22%), Query Frame = 2
Query:  473 TGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            TGS++  S + H DIVTRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY +S  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++                      + LK E +  +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID+K L++ PKDWSKRG+W
Sbjct:  213 TGSLV--SDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEIL----------------------MGLKSE-SGERPQITI---------NEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW 513          

HSP 2 Score: 53.1434 bits (126), Expect = 7.194e-6
Identity = 26/72 (36.11%), Postives = 46/72 (63.89%), Query Frame = 2
Query:   26 NKLCEGVKLPVKLKDSD---IYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKK 232
             ++ EG +LPV  ++ D    +  AEIL  ++    G K +YVH+ ++NKRLD+WV+ +R+ + ++ FP K+
Sbjct:    5 GEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDIS--GRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKE 74          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A517D2D1 (Histone acetyltransferase OS=Dugesia japonica OX=6161 GN=Tip60 PE=2 SV=1)

HSP 1 Score: 788.489 bits (2035), Expect = 0.000e+0
Identity = 409/497 (82.29%), Postives = 443/497 (89.13%), Query Frame = 2
Query:   17 IMFNKLCEGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXX----------XXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            +M+NKL EGVKLPVKLKDSD+YH AEILKARENK+LGTKEYYVHFDEYNKRLDDWVSEDRMK++EM+FP+KKIHKDSSTASL+A            + N+CSNSPFGE   QE+E+VE K+RL +S+SSSALKNE+Q+SLV+MDDRNCFSYLQEPV+NVLPQTGSMMV SHQEHQDIVTRMRNID+IVLGK RIKPWYFSPYPEELTELD+++ICEFCLKYFK+C CLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYD+ GFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVII  A +++  +NSSS +FDPPSISL                      +D+VEKTSINPKDL ATLNTMNIIYYSKGQHVIVVTKKMLD FKASM+KRKYRIDAKLLNWHPKDWSKRGRW
Sbjct:    1 MMYNKLYEGVKLPVKLKDSDVYHLAEILKARENKKLGTKEYYVHFDEYNKRLDDWVSEDRMKINEMIFPSKKIHKDSSTASLSALGGSSGNNNSSNNNNECSNSPFGETVNQESEHVELKMRLTTSSSSSALKNEEQISLVSMDDRNCFSYLQEPVSNVLPQTGSMMVASHQEHQDIVTRMRNIDLIVLGKYRIKPWYFSPYPEELTELDSVYICEFCLKYFKTCLCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDDRGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVII-DAANSNDNSNSSSLSFDPPSISL----------------------NDIVEKTSINPKDLTATLNTMNIIYYSKGQHVIVVTKKMLDNFKASMSKRKYRIDAKLLNWHPKDWSKRGRW 474          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A0X3PW26 (Histone acetyltransferase (Fragment) OS=Schistocephalus solidus OX=70667 GN=KAT5 PE=3 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 1.306e-163
Identity = 253/483 (52.38%), Postives = 332/483 (68.74%), Query Frame = 2
Query:   38 EGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNE---DQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            EG K+PV+L+ S  +H AEIL  RE +      YYVHFD++NKRLD+WV E R+    + +P K++ ++SS+ +LT++ + +     P       E E    + R++SS++ S+LK +   D+ S  ++   +   +  +P    LP+    MV+SH E QD+VTR+RN++ I +G+ RIKPWYFSPYP EL   D ++ICEFCLKY KS  CL+RHL KC+LRHPPGNEIYRK P SFFEIDGRKNK YAQ+LCLLAKLFLDHKTLYYDTDPFLFY+LCE D  G+HIVGYFSKEKES++D NVACILTLPPYQRKGYGKLLIEFSYELSK+E K GSPEKPLSDLGLLSYRSYW  T+M++ +       G           P+IS+                      +++VE+TS+   D+ ATL+ +N++YY KGQ++I ++K+ L+  K +++KR  R+D   L+W PKDWSKRGRW
Sbjct:   38 EGCKVPVRLRHSRYFHAAEILGVRETE--DGVFYYVHFDDFNKRLDEWVEESRLDFDRIEWPAKRLPRESSSTALTSMATVDSSIKLPISVECGPEPEPNVTRSRMHSSSNLSSLKRKHPSDEDSTSSLQTNDLDDHTDKPKLTTLPRQTGSMVSSHHE-QDVVTRIRNLEWIEIGQYRIKPWYFSPYPVELVSADCVYICEFCLKYLKSRTCLRRHLTKCQLRHPPGNEIYRKIPHSFFEIDGRKNKTYAQHLCLLAKLFLDHKTLYYDTDPFLFYVLCETDSRGYHIVGYFSKEKESSEDYNVACILTLPPYQRKGYGKLLIEFSYELSKIEGKLGSPEKPLSDLGLLSYRSYWAMTLMDIFLSTKPPEPGQE---------PAISI----------------------NEIVERTSMKRDDVIATLSYLNVLYYVKGQYLIFLSKENLELHKRAISKRLVRVDPTCLSWKPKDWSKRGRW 486          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A4Z2CM24 (Histone acetyltransferase OS=Schistosoma japonicum OX=6182 GN=EWB00_009345 PE=3 SV=1)

HSP 1 Score: 487.649 bits (1254), Expect = 1.314e-162
Identity = 256/489 (52.35%), Postives = 326/489 (66.67%), Query Frame = 2
Query:   38 EGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAE-NVEYKIRLNSSTSSSALKN--------EDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            EG KLPVKL DSD +H AEIL  R+        YYVH+D+YNKRLD+WVS DR+   ++  P KK  K+  T   T   + ++  NS   E    E++ N   K R +SS+  + LK         E  + L   +D N F +     +   P+    MV+SH E QD VTRMRN++ I LG+ RIKPWYFSPYP+EL  +  ++ICEFCLKY KS  CL+RHL KC LR+PPGNE+YRK P SFFEIDGRKNK YAQ+LCLLAKLFLDHKTLYYDTDPFLFY+LCE D  G+H+VGYFSKEKES++D NVACIL LPP+QRKGYGK LIEFSYELSK+E K+GSPEKPLSDLGLLSYRSYW QTI+E++++   +  G           P++S+                      +D+V++T I   D+ ATL+ +N++YY KGQHVI +++ ++     +M +R  R+D+KLLNW  +DWSKRGRW
Sbjct:   11 EGCKLPVKLPDSDFFHTAEILGTRDVG--DCTYYYVHYDDYNKRLDEWVSADRLDFSKIERPLKKSTKEPVTPVFTLSSTDDEVVNS--AELRNSESDLNPPIKHRSSSSSCLTQLKRKRPPDDIYEGPIHLTLQNDLNDFVFDDSAASTGKPRQTGSMVSSHHE-QDTVTRMRNLEWIELGRYRIKPWYFSPYPQELATVPCVYICEFCLKYLKSFTCLRRHLAKCTLRNPPGNEVYRKLPHSFFEIDGRKNKTYAQHLCLLAKLFLDHKTLYYDTDPFLFYVLCEIDSRGYHLVGYFSKEKESSEDYNVACILVLPPFQRKGYGKYLIEFSYELSKIEGKSGSPEKPLSDLGLLSYRSYWAQTILELLLNSKAAETGQD---------PALSI----------------------NDIVDRTCIKRDDVIATLSHLNVLYYVKGQHVIYLSRDLIQAHNKAMQRRNLRVDSKLLNWKARDWSKRGRW 463          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: Q5DDR3 (Histone acetyltransferase OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 486.878 bits (1252), Expect = 2.599e-162
Identity = 255/488 (52.25%), Postives = 324/488 (66.39%), Query Frame = 2
Query:   38 EGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKN--------EDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            EG KLPVKL DSD +H AEIL  R+        YYVH+D+YNKRLD+WVS DR+   ++  P KK  K+  T   T   + ++  NS     N+    N   K R +SS+  + LK         E  + L   +D N F +     +   P+    MV+SH E QD VTRMRN++ I LG+ RIKPWYFSPYP+EL  +  ++ICEFCLKY KS  CL+RHL KC LR+PPGNE+YRK P SFFEIDGRKNK YAQ+LCLLAKLFLDHKTLYYDTDPFLFY+LCE D  G+H+VGYFSKEKES++D NVACIL LPP+QRKGYGK LIEFSYELSK+E K+GSPEKPLSDLGLLSYRSYW QTI+E++++   +  G           P++S+                      +D+V++T I   D+ ATL+ +N++YY KGQHVI +++ ++     +M +R  R+D+KLLNW  +DWSKRGRW
Sbjct:   11 EGCKLPVKLPDSDFFHTAEILGTRDVG--DCTYYYVHYDDYNKRLDEWVSADRLDFSKIERPLKKSTKEPVTPVFTLSSTDDEVVNSA-ELRNSDSDLNPPIKHRSSSSSCLTQLKRKRPPDDIYEGPIHLTLQNDLNDFVFDDSAASTGKPRQTGSMVSSHHE-QDTVTRMRNLEWIELGRYRIKPWYFSPYPQELATVPCVYICEFCLKYLKSFTCLRRHLAKCTLRNPPGNEVYRKLPHSFFEIDGRKNKTYAQHLCLLAKLFLDHKTLYYDTDPFLFYVLCEIDSRGYHLVGYFSKEKESSEDYNVACILVLPPFQRKGYGKYLIEFSYELSKIEGKSGSPEKPLSDLGLLSYRSYWAQTILELLLNSKAAETGQD---------PALSI----------------------NDIVDRTCIKRDDVIATLSHLNVLYYVKGQHVIYLSRDLIQAHNKAMQRRNLRVDSKLLNWKARDWSKRGRW 463          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: G4LXT0 (Histone acetyltransferase OS=Schistosoma mansoni OX=6183 GN=Smp_053140 PE=3 SV=1)

HSP 1 Score: 485.337 bits (1248), Expect = 9.738e-162
Identity = 257/489 (52.56%), Postives = 327/489 (66.87%), Query Frame = 2
Query:   38 EGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAE-NVEYKIRLNSSTSSSALKN--------EDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            EG KLPVKL DSD +H AEIL  R+        YYVH+D+YNKRLD+WVS DR+    +  P KK  K+  T   +   + ++  +S   E    E++ N   K R +SS+S + LK         E  + L   +D N   +   P +   P+    MV+SH E QD VTRMRN++ I LG+ RIKPWYFSPYP+EL  +  ++ICEFCLKY KS  CL+RHL KC LR+PPGNE+YRK P SFFEIDGRKNK YAQ+LCLLAKLFLDHKTLYYDTDPFLFY+LCE D  G+H+VGYFSKEKES++D NVACIL LPP+QRKGYGK LIEFSYELSK+E K+GSPEKPLSDLGLLSYRSYW QTI+E++++   +  G           P++S+                      +D+V++T I   D+ ATL+ +N++YY KGQHVI +++ ++   + SM +R  R+DAKLLNW  +DWSKRGRW
Sbjct:   11 EGCKLPVKLPDSDFFHNAEILGTRDVG--DCTYYYVHYDDYNKRLDEWVSADRLDFSRIERPLKKSTKEPVTPVFSLSSTEDEVISS--AELRTSESDLNPPLKYRSSSSSSLTQLKRKRPPDDIYEGPIHLTLQNDLNDLVFDDSPTSAGKPRQTGSMVSSHHE-QDTVTRMRNLEWIELGRYRIKPWYFSPYPQELASVPCVYICEFCLKYLKSFTCLRRHLAKCTLRNPPGNEVYRKLPHSFFEIDGRKNKTYAQHLCLLAKLFLDHKTLYYDTDPFLFYVLCEVDSRGYHLVGYFSKEKESSEDYNVACILVLPPFQRKGYGKYLIEFSYELSKIEGKSGSPEKPLSDLGLLSYRSYWAQTILELLLNSKATETGQD---------PALSI----------------------NDIVDRTCIKRDDVIATLSHLNVLYYVKGQHVIYLSRDLIQAHQKSMQRRNLRVDAKLLNWKSRDWSKRGRW 463          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: kat5b (K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZDB-GENE-030131-985])

HSP 1 Score: 441.81 bits (1135), Expect = 8.046e-148
Identity = 237/519 (45.66%), Postives = 323/519 (62.24%), Query Frame = 2
Query:   29 KLCEGVKLPVKLKDS---DIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTS-SSALKNEDQMSLVTMDDRNCFSYL------------------------------QEPVANVLPQTGSMM--VTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            ++ EG +LPV  K+    D +  AEIL  ++   LG K +YVH+ ++NKRLD+WV+ DR+ M ++ FP K+    +      +  S+ +       + N Q A        L +    + A     + ++++   ++C + L                               +  ++ +P    M   + S + H DI+TRM+NID I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E+++D+ +             + P I++                      +++ E TS+  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID K L++ PKDWSKRG+W
Sbjct:    2 EIVEGCRLPVLRKNQENEDEWPLAEILSVKDT--LGRKLFYVHYIDFNKRLDEWVTPDRLDMKKLQFPKKEAKTPTKNGLPGSRPSSPEREVRKSLDLNVQAASAPSRGKTLPTPVQLTLAHSTPKKYTILSYHIKSCMNGLTMTCFLKCPNWILSDTFFPHALNSSLWPQDSQDSSDGIPTAPRMTGSLVSDRSHDDIITRMKNIDCIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKTYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKSDNG----------ERPQITI----------------------NEISEITSVKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMQKRHLRIDPKCLHFTPKDWSKRGKW 486          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: kat5b (K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZDB-GENE-030131-985])

HSP 1 Score: 423.32 bits (1087), Expect = 2.265e-140
Identity = 240/545 (44.04%), Postives = 327/545 (60.00%), Query Frame = 2
Query:   29 KLCEGVKLPVKLKDS---DIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKI----------------HKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTM--DDRNCFSYL---QEPVAN-----------VLP--QTGSMMVT--SHQEHQD------IVTRM-------RNIDMIV----------LGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            ++ EG +LPV  K+    D +  AEIL  ++   LG K +YVH+ ++NKRLD+WV+ DR+ M ++ FP K+                  ++   +    + + +  S         ++AE V    ++  +TS  +L +  + +  ++    R  F+      EP+ +           VLP  Q G    T  + ++ QD         RM       R+ D I+          LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E+++D+ +               P I++                      +++ E TS+  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID K L++ PKDWSKRG+W
Sbjct:    2 EIVEGCRLPVLRKNQENEDEWPLAEILSVKDT--LGRKLFYVHYIDFNKRLDEWVTPDRLDMKKLQFPKKEAKTPTKNGLPGSRPSSPEREVRKSLDLNVQAASAPSRGKTLPTPKRKAETVSLASQVTPATSVPSLPSSAEATQASVYPAARETFTTKTREDEPLTSITTVTNGTTRRVLPPSQPGRKRKTCGTDEDSQDSSDGIPTAPRMTGSLVSDRSHDDIITRMKNIDCIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKTYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKSDNGER----------PQITI----------------------NEISEITSVKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMQKRHLRIDPKCLHFTPKDWSKRGKW 512          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: kat5b (K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZDB-GENE-030131-985])

HSP 1 Score: 424.091 bits (1089), Expect = 9.174e-140
Identity = 240/550 (43.64%), Postives = 326/550 (59.27%), Query Frame = 2
Query:   29 KLCEGVKLPVKLKDS---DIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTM--DDRNCFSYL---QEPVANVL------------------------------------PQTGSMMVTSHQEHQD------IVTRM-------RNIDMIV----------LGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            ++ EG +LPV  K+    D +  AEIL  ++   LG K +YVH+ ++NKRLD+WV+ DR+ M ++ FP K+        + T         +SP  E   ++AE V    ++  +TS  +L +  + +  ++    R  F+      EP+ ++                                     P+T S  +   ++ QD         RM       R+ D I+          LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E+++D+ +             + P I++                      +++ E TS+  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID K L++ PKDWSKRG+W
Sbjct:   67 EIVEGCRLPVLRKNQENEDEWPLAEILSVKDT--LGRKLFYVHYIDFNKRLDEWVTPDRLDMKKLQFPKKE------AKTPTKNGLPGSRPSSPEREVK-RKAETVSLASQVTPATSVPSLPSSAEATQASVYPAARETFTTKTREDEPLTSITTVTNGTTRRVLPPSQPGRKRKTCGTDEMIKVFQYNSPRTTSGCLPPGEDSQDSSDGIPTAPRMTGSLVSDRSHDDIITRMKNIDCIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKTYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKSDNG----------ERPQITI----------------------NEISEITSVKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMQKRHLRIDPKCLHFTPKDWSKRGKW 575          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: kat5b (K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZDB-GENE-030131-985])

HSP 1 Score: 416.772 bits (1070), Expect = 1.526e-137
Identity = 200/335 (59.70%), Postives = 250/335 (74.63%), Query Frame = 2
Query:  473 TGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            TGS++  S + H DI+TRM+NID I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E+++D+ +               P I++                      +++ E TS+  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID K L++ PKDWSKRG+W
Sbjct:  233 TGSLV--SDRSHDDIITRMKNIDCIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKTYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKSDNGER----------PQITI----------------------NEISEITSVKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMQKRHLRIDPKCLHFTPKDWSKRGKW 533          

HSP 2 Score: 60.4622 bits (145), Expect = 4.264e-9
Identity = 30/71 (42.25%), Postives = 47/71 (66.20%), Query Frame = 2
Query:   29 KLCEGVKLPVKLKDS---DIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKK 232
            ++ EG +LPV  K+    D +  AEIL  ++   LG K +YVH+ ++NKRLD+WV+ DR+ M ++ FP K+
Sbjct:    2 EIVEGCRLPVLRKNQENEDEWPLAEILSVKDT--LGRKLFYVHYIDFNKRLDEWVTPDRLDMKKLQFPKKE 70          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: kat5b (K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZDB-GENE-030131-985])

HSP 1 Score: 418.313 bits (1074), Expect = 3.915e-137
Identity = 200/335 (59.70%), Postives = 251/335 (74.93%), Query Frame = 2
Query:  473 TGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            TGS++  S + H DI+TRM+NID I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E+++D+ +             + P I++                      +++ E TS+  +D+ +TL  +N+I Y KGQ+++ +++ ++D  + +M KR  RID K L++ PKDWSKRG+W
Sbjct:  298 TGSLV--SDRSHDDIITRMKNIDCIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKTYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKSDNG----------ERPQITI----------------------NEISEITSVKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMQKRHLRIDPKCLHFTPKDWSKRGKW 598          

HSP 2 Score: 60.4622 bits (145), Expect = 4.293e-9
Identity = 30/71 (42.25%), Postives = 47/71 (66.20%), Query Frame = 2
Query:   29 KLCEGVKLPVKLKDS---DIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKK 232
            ++ EG +LPV  K+    D +  AEIL  ++   LG K +YVH+ ++NKRLD+WV+ DR+ M ++ FP K+
Sbjct:   67 EIVEGCRLPVLRKNQENEDEWPLAEILSVKDT--LGRKLFYVHYIDFNKRLDEWVTPDRLDMKKLQFPKKE 135          
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: kat5b (K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZDB-GENE-030131-985])

HSP 1 Score: 416.387 bits (1069), Expect = 2.005e-138
Identity = 203/343 (59.18%), Postives = 256/343 (74.64%), Query Frame = 2
Query:  449 PVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            P  ++  QTGS++  S + H DIVTRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRH+ KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++  +D +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYG LLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E++ID                      LK E    +P  T+         +++ E TSI  +D+ +TL  +N+I Y KGQ+++ ++ ++++  + +MAKR+ RID+K L++ PKDWSKRG+W
Sbjct:  198 PAVSLPRQTGSLV--SDKSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTSLPVLYLCEFCLKYLKSLTCLQRHMHKCNLRHPPGNEIYRKGNISFFEIDGRKNKAYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTTFDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGTLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILID----------------------LKAE-NGERPQITI---------NEISELTSIKKEDVISTLQHLNLINYYKGQYILNLSYEIIEGHQKAMAKRELRIDSKCLHFTPKDWSKRGKW 506          
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007004.1 (pep scaffold:Pmarinus_7.0:GL480995:3484:21994:1 gene:ENSPMAG00000006332.1 transcript:ENSPMAT00000007004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 281.952 bits (720), Expect = 7.201e-89
Identity = 137/277 (49.46%), Postives = 181/277 (65.34%), Query Frame = 2
Query:  533 NIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIV 1363
             I  IV G+  +  WY SPYPEE T L  +++CEFCLKY KS   L+RH+ KC  +HPPG+EIYR   +S FE+DG+KNK Y QNLCLLAKLFLDHKTLYYD +PFLFY++ E D  G H+VGYFSKEK S  + NV+CILT+P + R+GYGK+LIEFSY LSK+E+K GSPE+PLSDLGL+SYRSYW   ++  +                 F    IS+K                      ++ ++T+INP D+ +TL  + ++ Y KG+H+++
Sbjct:  100 GIRTIVFGRYELDTWYHSPYPEEYTRLGKLYVCEFCLKYMKSPTILRRHMAKCVWKHPPGDEIYRNGTVSVFEVDGKKNKTYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEGDNAGCHLVGYFSKEKNSFLNYNVSCILTMPQFMRQGYGKMLIEFSYLLSKMEDKIGSPERPLSDLGLISYRSYWKGVVLRYL---------------HGFHGKEISIK----------------------EISQETAINPADIVSTLQYLQMLKYWKGKHLVL 339          
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: kat7b (K(lysine) acetyltransferase 7b [Source:ZFIN;Acc:ZDB-GENE-030131-1901])

HSP 1 Score: 287.73 bits (735), Expect = 1.625e-88
Identity = 147/312 (47.12%), Postives = 194/312 (62.18%), Query Frame = 2
Query:  536 IDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKF---KASMAKRKYRIDAKLLNWHPKDWS 1462
            I  I+ G+  +  WY SPYPEE   L  +++CEFCLKY KS   L+RH EKC  +HPPG+EIYRK  +S FE+DG+KNK Y QNLCLLAKLFLDHKTLYYD +PFLFY++ E D  G HI+GYFSKEK S  + NV+CILT+P + R+GYGK+LI+FSY LSK ENK GSPE+PLSDLGL+SYRSYW + ++  +                AF    IS+K                      ++ + T++NP D+  TL  + ++ Y KG+H+++  + ++D F   +AS       ID   L W P   S
Sbjct:  267 IKSIMFGRYELDTWYHSPYPEEYARLGRLYVCEFCLKYMKSQTILRRHTEKCVWKHPPGDEIYRKGTISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEGDNTGCHIIGYFSKEKNSFLNYNVSCILTMPQFMRQGYGKMLIDFSYLLSKEENKIGSPERPLSDLGLISYRSYWKEVLLRYL---------------HAFQGKEISIK----------------------EISQDTAVNPVDIVNTLQALQMLKYWKGKHLVLKRQDVIDDFLEKEASKPVSNKVIDPASLKWTPSKCS 541          
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: ESA1 (Catalytic subunit of the histone acetyltransferase complex (NuA4); acetylates four conserved internal lysines of histone H4 N-terminal tail and can acetylate histone H2A; master regulator of cellular acetylation balance; required for cell cycle progression and transcriptional silencing at the rDNA locus and regulation of autophagy; human ortholog TIP60/KAT5 is implicated in cancer and other diseases, functionally complements lethality of the esa1 null mutation [Source:SGD;Acc:S000005770])

HSP 1 Score: 343.584 bits (880), Expect = 2.496e-111
Identity = 195/470 (41.49%), Postives = 269/470 (57.23%), Query Frame = 2
Query:   44 VKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKM-HEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHP 1450
            +K    ++ +D    AEIL    N R    ++YVH+  YNKRLD+W++ DR+ +  E+++P  K+                + S +P  + + Q+  +         S  ++ + + D +++  + D N      E     L  +GSM    H+     V R+RN++ I++GK  I+PWYFSPYP ELT+ D I+I +F L+YF S    +R+ +KC LRHPPGNEIYR + +SFFEIDGRK + + +NLCLL+KLFLDHKTLYYD DPFLFY +   DE G H+VGYFSKEKES D  NVACILTLP YQR GYGKLLIEFSYELSK ENK GSPEKPLSDLGLLSYR+YW  T++ ++++                                              ++   TS+   D+  T  T+NI+ Y KGQH+I + + +LD++    AK++  ID   L W P
Sbjct:   23 IKCQCWVQKNDEERLAEILSI--NTRKAPPKFYVHYVNYNKRLDEWITTDRINLDKEVLYP--KLKATDEDNKKQKKKKATNTSETP--QDSLQDGVD-------GFSRENTDVMDLDNLNVQGIKDENIS---HEDEIKKLRTSGSMTQNPHE-----VARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKE--------------------------------------ITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKP 433          
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: SAS3 (Histone acetyltransferase catalytic subunit of NuA3 complex; acetylates histone H3, involved in transcriptional silencing; homolog of the mammalian MOZ proto-oncogene; mutant has aneuploidy tolerance; sas3gcn5 double mutation is lethal [Source:SGD;Acc:S000000148])

HSP 1 Score: 242.276 bits (617), Expect = 2.381e-69
Identity = 130/268 (48.51%), Postives = 172/268 (64.18%), Query Frame = 2
Query:  395 QMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSH----QEHQDI------VTRMRN------IDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDE---------EGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVII 1123
            + +L T +D+  F    E   +     G++ + +H    QE++D       V R++N      I+ IVL    IKPWY SP+PE + +   +FICEFCLKY  S +   RH  KC    PPGNEIYR   LS +EIDGR+N  Y QNLCLLAK F++ KTLYYD +PF+FYIL E ++           FH VGYFSKEK +++D N++CILTLP YQRKGYG+ L+EFSY LS+ E+K G+PEKPLSDLGLL+YR++W     EV++
Sbjct:  209 KRTLPTWEDKIKFLTFLENSKSATYINGNVSLCNHNETDQENEDRKKRKGKVPRIKNKVWFSQIEYIVLRNYEIKPWYTSPFPEHINQNKMVFICEFCLKYMTSRYTFYRHQLKCLTFKPPGNEIYRDGKLSVWEIDGRENVLYCQNLCLLAKCFINSKTLYYDVEPFIFYILTEREDTENHPYQNAAKFHFVGYFSKEKFNSNDYNLSCILTLPIYQRKGYGQFLMEFSYLLSRKESKFGTPEKPLSDLGLLTYRTFWKIKCAEVLL 476          
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: SAS2 (Histone acetyltransferase (HAT) catalytic subunit of the SAS complex; acetylates free histones and nucleosomes and regulates transcriptional silencing; member of the MYSTacetyltransferase family; other members are Sas4p and Sas5p [Source:SGD;Acc:S000004734])

HSP 1 Score: 137.502 bits (345), Expect = 4.962e-36
Identity = 71/173 (41.04%), Postives = 101/173 (58.38%), Query Frame = 2
Query:  611 LDAIFICEFCLKYFKSCFCLQRHLEKCRLRH-PPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIID 1126
            LD +F+CE+C KY         H+  C  ++  PG   Y+    +   + G K + + Q LCL  KL+LD+K++Y+  D + FYI+  Y+      +G+FSK+  S   NN+ACIL  PPYQR+G G LLIEFSY+LS+LE     PE PLS  GL+ Y  YW Q +   +I+
Sbjct:   97 LDTLFVCEYCFKYTDDQTRFVGHVASCPFQYRVPGKIKYKSPEYTIRRVKGSKYQLFCQCLCLFTKLYLDNKSMYFKVDHYEFYIV--YETGSTKPMGFFSKDLVSYQQNNLACILIFPPYQRRGLGLLLIEFSYKLSQLEGVISGPEVPLSPFGLIGYLKYWSQILCWHLIE 267          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO34934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMW6])

HSP 1 Score: 449.129 bits (1154), Expect = 3.252e-151
Identity = 243/507 (47.93%), Postives = 324/507 (63.91%), Query Frame = 2
Query:   38 EGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFP----TKKIHKDXXXXXXXXXXXXNDCSNSPFG---------EANAQEAENVEY--KIRLNSSTSS-----SALKNEDQMSLVTMDDRNCFSYLQEPVANVLP-------QTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            EG ++PV++ +SD +  AEI+  RE  +    EYYVHF ++NKRLD+WV+EDR+    +  P    TKKI K ++ +   +          P           +ANA +  + E   K      T+S     SAL+ +  +   T+       +   P  +  P       Q GS++    + + DIVTRM+NI M+ LGK RIKPWYFSPYP+E T L  +++C+FCLK+ KS  CL+RH+ KC L HPPGNEIYR   +SFFEIDGRKNK+YAQNLCLLAK+FLDHKTLYYDTDPFLFYI+ E D  GFHIVGYFSKEKES +D NVACILTLP YQRKGYGKLLIEFSYELSK E KTG+PEKPLSDLGLLSYRSYW QTI+E+++ + +             +PPSI++                      +++ E TSI  +D+ +TL  + +I+Y KGQ+++ + K++L+  + +M+KRK RID+  L+W+PKDW+KRG+W
Sbjct:    8 EGCRMPVRMNNSDEWPLAEIISKRE--KGDEFEYYVHFIDFNKRLDEWVTEDRLDKTRIQLPKKEDTKKISKGAAGSRPPSPERDMVNGTGPRTNKILTGRKRKANAMDKSSDEILNKCLGTFETTSPTLVFSALELKQDLHSPTLSGMVRLFFQDSPTKDTPPTKMSSLRQHGSLV--QDRSNDDIVTRMKNIQMVQLGKFRIKPWYFSPYPQEFTNLPMVYLCDFCLKFVKSFHCLKRHMVKCNLFHPPGNEIYRNGTISFFEIDGRKNKQYAQNLCLLAKMFLDHKTLYYDTDPFLFYIMTESDGAGFHIVGYFSKEKESTEDYNVACILTLPQYQRKGYGKLLIEFSYELSKFEGKTGTPEKPLSDLGLLSYRSYWSQTILEILVGLKSEDG----------NPPSITI----------------------NEICELTSIRKEDVVSTLQHLGLIHYYKGQYILSLGKEVLEGHRRAMSKRKIRIDSNCLHWNPKDWAKRGKW 478          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO39884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8T4])

HSP 1 Score: 317.005 bits (811), Expect = 2.037e-101
Identity = 183/456 (40.13%), Postives = 253/456 (55.48%), Query Frame = 2
Query:   89 AEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRK--YRIDAKLLNWHP 1450
            AEI++++     G   YYVH+  +N+RLD+WV   R+ + +                       ND  + P  + +  + +  E KI  N       +                 +++Q+  A + P T ++     +EH+ I T+++ ID    GK  I  WYFSPYP+E  +L+ ++ICE+C+KY K     + H+ KC +R PPG EIYRK  +S +E+DG++ K Y QN+CLLAKLFLDHKTLY+D +PFLFYIL E D EG H+VGYFSKEKES D NNVACILTLPPYQRKGYGK LI FSYELSK+E   GSPEKPLSDLG LSYRSYW   +++++ +                   ++S+K                      D+   TSI  +D+  TL ++N++ Y KGQHVI VT K++++   S   RK    +D   L W P
Sbjct:   12 AEIIQSKVEDD-GKTVYYVHYHGFNRRLDEWVEAARVDLQQ-----------------------ND--DKPIID-DKLDVDGPERKITRNQKRKHDEI-----------------NHVQKTYAEMDPTTAAL----EKEHEAI-TKIKFIDKAQFGKYEIDTWYFSPYPDEYGKLNKLWICEYCIKYMKFEKTFRDHIGKCEMRQPPGKEIYRKGSVSVYEVDGKEQKLYCQNICLLAKLFLDHKTLYFDVEPFLFYILTEVDREGAHMVGYFSKEKESPDGNNVACILTLPPYQRKGYGKFLINFSYELSKIEQTVGSPEKPLSDLGKLSYRSYWSWVLLDILRNFRG----------------TLSIK----------------------DLSAMTSITQEDIIGTLQSLNMVKYWKGQHVICVTPKLVEEHVKSAQYRKPVLTVDNSCLRWAP 380          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO39738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S982])

HSP 1 Score: 170.629 bits (431), Expect = 1.171e-49
Identity = 76/115 (66.09%), Postives = 97/115 (84.35%), Query Frame = 2
Query:  776 YAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVI 1120
            Y QNLCLLAKLFLDHKTLYYD +PFLFY+L + D++G H+VGYFSKEK      NV+CI+T+P YQR+G+G+LLI+FSY LS++E ++GSPEKPLSDLGL+SYRSYW   ++E +
Sbjct:   17 YCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDKKGCHLVGYFSKEKSCQQKYNVSCIMTMPHYQRQGFGRLLIDFSYLLSRIEGQSGSPEKPLSDLGLISYRSYWKSVMLEYM 131          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO39739 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S983])

HSP 1 Score: 93.2041 bits (230), Expect = 7.645e-23
Identity = 51/117 (43.59%), Postives = 64/117 (54.70%), Query Frame = 2
Query:  407 VTMDDRNCFSYLQEPVANVLPQTGSMMVT-SHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEI 754
            VT  D   F   QE           MMVT +   H ++    R+  +I  G+  I  WY SPYP+E   L  +FICEFCLKY KS   +QRH+ KC   HPP NEIYRK+ +S FE+
Sbjct:    1 VTEADLALFKKAQEKA------NSKMMVTPTSAPHPNV----RSPALIQFGRHEIHTWYSSPYPQEYARLSKLFICEFCLKYMKSSSIVQRHITKCGWFHPPANEIYRKDDISVFEV 107          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO29009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4V3])

HSP 1 Score: 91.6633 bits (226), Expect = 7.004e-22
Identity = 54/162 (33.33%), Postives = 86/162 (53.09%), Query Frame = 2
Query:  974 RKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKY---RIDAKLLNWHP 1450
            ++GYGK+LI+FSY LSK E K GSPEKPLSDLGL+SYRSYW   +++ +                 +   +IS+K                      D+ ++T+I+P D+ +TL  + ++ Y KG+H+++ + ++ ++F   +A R      ID   L W P
Sbjct:    2 KQGYGKMLIDFSYLLSKTECKVGSPEKPLSDLGLISYRSYWKNIVLKYL---------------HCYGYDTISIK----------------------DISQETAIHPNDIVSTLQYLGLLKYWKGKHLVLRSPELFEEFAKRVAARPANYQEIDPTCLQWSP 126          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat5b (lysine acetyltransferase 5 [Source:NCBI gene;Acc:101161500])

HSP 1 Score: 417.542 bits (1072), Expect = 3.473e-137
Identity = 199/335 (59.40%), Postives = 250/335 (74.63%), Query Frame = 2
Query:  473 TGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            TGS++  S + H DI+TRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E+++D+                             +P  T+         +++ E TS+  +D+ +TL  +N+I Y KGQ+++ ++++++D  + +M KR  RID K L++ PKDWSKRG+W
Sbjct:  280 TGSLV--SDRSHDDIITRMKNIECIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKNYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDSKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKPD-----------------------NGERPQITI---------NEISEITSVKKEDVISTLQYLNLINYYKGQYILTLSEEIVDGHEKAMQKRHLRIDPKCLHFTPKDWSKRGKW 580          

HSP 2 Score: 58.151 bits (139), Expect = 2.689e-8
Identity = 30/71 (42.25%), Postives = 46/71 (64.79%), Query Frame = 2
Query:   29 KLCEGVKLPVKLKDS---DIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKK 232
            ++ EG +LPV  K+    D +  AEIL  +E    G K +YVH+ ++NKRLD+WV+ DR+ M ++ FP K+
Sbjct:    9 EIVEGCRLPVLRKNQEHEDEWPLAEILSLKEVS--GRKLFYVHYIDFNKRLDEWVTADRLDMKKLQFPKKE 77          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat5b (lysine acetyltransferase 5 [Source:NCBI gene;Acc:101161500])

HSP 1 Score: 417.157 bits (1071), Expect = 3.737e-137
Identity = 199/335 (59.40%), Postives = 250/335 (74.63%), Query Frame = 2
Query:  473 TGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            TGS++  S + H DI+TRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E+++D+                             +P  T+         +++ E TS+  +D+ +TL  +N+I Y KGQ+++ ++++++D  + +M KR  RID K L++ PKDWSKRG+W
Sbjct:  263 TGSLV--SDRSHDDIITRMKNIECIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKNYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDSKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKPD-----------------------NGERPQITI---------NEISEITSVKKEDVISTLQYLNLINYYKGQYILTLSEEIVDGHEKAMQKRHLRIDPKCLHFTPKDWSKRGKW 563          

HSP 2 Score: 58.151 bits (139), Expect = 2.526e-8
Identity = 30/71 (42.25%), Postives = 46/71 (64.79%), Query Frame = 2
Query:   29 KLCEGVKLPVKLKDS---DIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKK 232
            ++ EG +LPV  K+    D +  AEIL  +E    G K +YVH+ ++NKRLD+WV+ DR+ M ++ FP K+
Sbjct:    9 EIVEGCRLPVLRKNQEHEDEWPLAEILSLKEVS--GRKLFYVHYIDFNKRLDEWVTADRLDMKKLQFPKKE 77          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat5b (lysine acetyltransferase 5 [Source:NCBI gene;Acc:101161500])

HSP 1 Score: 416.772 bits (1070), Expect = 4.632e-137
Identity = 199/335 (59.40%), Postives = 250/335 (74.63%), Query Frame = 2
Query:  473 TGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            TGS++  S + H DI+TRM+NI+ I LG+ R+KPWYFSPYP+ELT L  +++CEFCLKY KS  CLQRHL KC LRHPPGNEIYRK  +SFFEIDGRKNK Y+QNLCLLAK FLDHKTLYYDTDPFLFY++ EYD +GFHIVGYFSKEKES +D NVACILTLPPYQR+GYGKLLIEFSYELSK+E KTG+PEKPLSDLGLLSYRSYW QTI+E+++D+                             +P  T+         +++ E TS+  +D+ +TL  +N+I Y KGQ+++ ++++++D  + +M KR  RID K L++ PKDWSKRG+W
Sbjct:  263 TGSLV--SDRSHDDIITRMKNIECIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKNYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDSKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKPD-----------------------NGERPQITI---------NEISEITSVKKEDVISTLQYLNLINYYKGQYILTLSEEIVDGHEKAMQKRHLRIDPKCLHFTPKDWSKRGKW 563          

HSP 2 Score: 58.151 bits (139), Expect = 2.683e-8
Identity = 30/71 (42.25%), Postives = 46/71 (64.79%), Query Frame = 2
Query:   29 KLCEGVKLPVKLKDS---DIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKK 232
            ++ EG +LPV  K+    D +  AEIL  +E    G K +YVH+ ++NKRLD+WV+ DR+ M ++ FP K+
Sbjct:    9 EIVEGCRLPVLRKNQEHEDEWPLAEILSLKEVS--GRKLFYVHYIDFNKRLDEWVTADRLDMKKLQFPKKE 77          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat8 (lysine acetyltransferase 8 [Source:NCBI gene;Acc:101155932])

HSP 1 Score: 334.339 bits (856), Expect = 3.910e-106
Identity = 188/459 (40.96%), Postives = 266/459 (57.95%), Query Frame = 2
Query:   80 YHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRK--YRIDAKLLNWHP 1450
            +H AE++++R N++ G +E+YVH+  +N+RLD+WV + R+ + + V       KD+   S        D  + P            E KI  N        +  D+++           ++Q+  A + P T ++     +EH+ I T+++ +D I +G   I  WYFSP+PE+  +   ++ICE+CLKY K     + HL  C+ R PPG EIYR++ +S +E+DGR +K Y QNLCLLAKLFLDHKTLY+D +PF+FYIL E +++G HIVGYFSKEKES D NNVACILTLPPYQR+GYGK LI FSYELSKLEN  GSPEKPLSDLG LSYRSYW   ++E++ D                   ++S+K                      D+ + TSI   D+ +TL ++N++ Y KGQHVI VT K++++   S   +K    +D   L W P
Sbjct:  106 WHTAEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVGKSRLALTKTV-------KDAVRKSTEVGGV-GDLGDQP------------ERKITRNQK------RKHDEIN-----------HVQKTYAEMDPTTAAL----EKEHEAI-TKVKYVDKIQIGNFEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKYEKTFRYHLSHCQWRQPPGKEIYRRSNISVYEVDGRDHKIYCQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLENSVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRG----------------TLSIK----------------------DLSQMTSITQSDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDTMCLKWAP 484          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat8 (lysine acetyltransferase 8 [Source:NCBI gene;Acc:101155932])

HSP 1 Score: 333.954 bits (855), Expect = 4.887e-106
Identity = 188/459 (40.96%), Postives = 266/459 (57.95%), Query Frame = 2
Query:   80 YHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRK--YRIDAKLLNWHP 1450
            +H AE++++R N++ G +E+YVH+  +N+RLD+WV + R+ + + V       KD+   S        D  + P            E KI  N        +  D+++           ++Q+  A + P T ++     +EH+ I T+++ +D I +G   I  WYFSP+PE+  +   ++ICE+CLKY K     + HL  C+ R PPG EIYR++ +S +E+DGR +K Y QNLCLLAKLFLDHKTLY+D +PF+FYIL E +++G HIVGYFSKEKES D NNVACILTLPPYQR+GYGK LI FSYELSKLEN  GSPEKPLSDLG LSYRSYW   ++E++ D                   ++S+K                      D+ + TSI   D+ +TL ++N++ Y KGQHVI VT K++++   S   +K    +D   L W P
Sbjct:  106 WHTAEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVGKSRLALTKTV-------KDAVRKSTEVGGV-GDLGDQP------------ERKITRNQK------RKHDEIN-----------HVQKTYAEMDPTTAAL----EKEHEAI-TKVKYVDKIQIGNFEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKYEKTFRYHLSHCQWRQPPGKEIYRRSNISVYEVDGRDHKIYCQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLENSVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRG----------------TLSIK----------------------DLSQMTSITQSDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDTLCLKWAP 484          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000049001.1 (SMESG000049001.1)

HSP 1 Score: 897.501 bits (2318), Expect = 0.000e+0
Identity = 463/486 (95.27%), Postives = 464/486 (95.47%), Query Frame = 2
Query:   20 MFNKLCEGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 1477
            MFNKLCEGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDSSTASLTALVSTNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVANSADGAANSSSSAFDPPSISL                      +DVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW
Sbjct:    1 MFNKLCEGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDSSTASLTALVSTNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVANSADGAANSSSSAFDPPSISL----------------------NDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW 464          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000040171.1 (SMESG000040171.1)

HSP 1 Score: 271.166 bits (692), Expect = 1.174e-82
Identity = 163/441 (36.96%), Postives = 226/441 (51.25%), Query Frame = 2
Query:  134 EYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDXXXXXXXXXXXXNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVXXXXXXXXXXXXXXFDPPSISLKYEFTSWKPLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNII--YYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHP 1450
            EY+VH+   ++RLD+WV  + + +                                          N +++I+  S ++  AL  E     +T   +   + +    +       S+ +   +EHQ   TR++ I+ I  G   I+ WYFSPYPE+  +   ++ICE+CLKY K       H  +C  + PPG EIYRK  LS FEIDG + K Y QNLCLLAKLFLDHKTLYYD  PF+FY+LCE D EG H+VGYFSKEK S D+ N+ACILTLPP+QRKGYGK LI FSYEL+K+E   GSPEKPLSDLG LSYRSYW   I   ++D                  P+ S++                      D+   T I+  D+ + L + N++  Y+  G+ + +  K ++   +    K+  +ID   L W P
Sbjct:   40 EYFVHYHGNDRRLDEWVPYENIDV------------------------------------------NSKFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQ-AFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDY-----------------PNSSIE----------------------DISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQIDKSCLKWLP 398          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 221.861 bits (564), Expect = 2.572e-60
Identity = 105/194 (54.12%), Postives = 132/194 (68.04%), Query Frame = 2
Query:  545 IVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIID 1126
            I +G+  I  WY +PYP E   L+ ++ICE+CLK  KS      H++KC    PPGNEIYR   LS FE+DG  +K Y Q LCLLAKLFLDHKTLYYD +PFLFY+      +  HI+GYFSKEK S    N++CI+ LPPYQ+  YG+ LI+FSY LS+ E + GSPEKPLS LG +SY SYW   I+  I++
Sbjct:  656 IQIGRHVIDTWYSAPYPSEYARLNVLYICEYCLKPIKSYDVYVMHMQKCTFYFPPGNEIYRNGDLSVFEVDGYVSKLYCQQLCLLAKLFLDHKTLYYDVEPFLFYVAVISKNKSSHIIGYFSKEKRSTHKYNLSCIMVLPPYQKYNYGRFLIDFSYLLSRKEGQCGSPEKPLSILGRISYESYWKSKILPYILN 849          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 221.861 bits (564), Expect = 2.648e-60
Identity = 105/194 (54.12%), Postives = 132/194 (68.04%), Query Frame = 2
Query:  545 IVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIID 1126
            I +G+  I  WY +PYP E   L+ ++ICE+CLK  KS      H++KC    PPGNEIYR   LS FE+DG  +K Y Q LCLLAKLFLDHKTLYYD +PFLFY+      +  HI+GYFSKEK S    N++CI+ LPPYQ+  YG+ LI+FSY LS+ E + GSPEKPLS LG +SY SYW   I+  I++
Sbjct:  658 IQIGRHVIDTWYSAPYPSEYARLNVLYICEYCLKPIKSYDVYVMHMQKCTFYFPPGNEIYRNGDLSVFEVDGYVSKLYCQQLCLLAKLFLDHKTLYYDVEPFLFYVAVISKNKSSHIIGYFSKEKRSTHKYNLSCIMVLPPYQKYNYGRFLIDFSYLLSRKEGQCGSPEKPLSILGRISYESYWKSKILPYILN 851          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 221.861 bits (564), Expect = 2.771e-60
Identity = 105/194 (54.12%), Postives = 132/194 (68.04%), Query Frame = 2
Query:  545 IVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIID 1126
            I +G+  I  WY +PYP E   L+ ++ICE+CLK  KS      H++KC    PPGNEIYR   LS FE+DG  +K Y Q LCLLAKLFLDHKTLYYD +PFLFY+      +  HI+GYFSKEK S    N++CI+ LPPYQ+  YG+ LI+FSY LS+ E + GSPEKPLS LG +SY SYW   I+  I++
Sbjct:  656 IQIGRHVIDTWYSAPYPSEYARLNVLYICEYCLKPIKSYDVYVMHMQKCTFYFPPGNEIYRNGDLSVFEVDGYVSKLYCQQLCLLAKLFLDHKTLYYDVEPFLFYVAVISKNKSSHIIGYFSKEKRSTHKYNLSCIMVLPPYQKYNYGRFLIDFSYLLSRKEGQCGSPEKPLSILGRISYESYWKSKILPYILN 849          
The following BLAST results are available for this feature:
BLAST of Histone acetyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KAT54.584e-14847.80lysine acetyltransferase 5 [Source:HGNC Symbol;Acc... [more]
KAT55.276e-14847.80lysine acetyltransferase 5 [Source:HGNC Symbol;Acc... [more]
KAT56.021e-13860.30lysine acetyltransferase 5 [Source:HGNC Symbol;Acc... [more]
KAT57.977e-13660.30lysine acetyltransferase 5 [Source:HGNC Symbol;Acc... [more]
KAT59.120e-13660.30lysine acetyltransferase 5 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mys-11.110e-13044.72Histone acetyltransferase Tip60 homolog [Source:U... [more]
mys-21.062e-7842.15Histone acetyltransferase [Source:UniProtKB/TrEMB... [more]
mys-21.122e-7842.15Histone acetyltransferase [Source:UniProtKB/TrEMB... [more]
lsy-122.897e-5850.52Histone acetyltransferase [Source:UniProtKB/TrEMB... [more]
lsy-122.897e-5850.52Histone acetyltransferase [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tip602.220e-13861.49gene:FBgn0026080 transcript:FBtr0070668[more]
Tip602.220e-13861.49gene:FBgn0026080 transcript:FBtr0333186[more]
Tip601.424e-11977.98gene:FBgn0026080 transcript:FBtr0333185[more]
mof1.572e-8537.50gene:FBgn0014340 transcript:FBtr0070829[more]
chm5.954e-8144.73gene:FBgn0028387 transcript:FBtr0079443[more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat5a3.421e-13944.44K(lysine) acetyltransferase 5a [Source:ZFIN;Acc:ZD... [more]
kat5a1.271e-13760.90K(lysine) acetyltransferase 5a [Source:ZFIN;Acc:ZD... [more]
kat5b3.314e-13760.00K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZD... [more]
kat81.650e-10640.43K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB... [more]
kat81.650e-10640.43K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cxcl123.667e-15149.19C-X-C motif chemokine ligand 12 [Source:Xenbase;Ac... [more]
cxcl123.374e-15049.20C-X-C motif chemokine ligand 12 [Source:Xenbase;Ac... [more]
cxcl125.010e-14948.42C-X-C motif chemokine ligand 12 [Source:Xenbase;Ac... [more]
cxcl121.209e-14847.31C-X-C motif chemokine ligand 12 [Source:Xenbase;Ac... [more]
cxcl121.993e-13660.60C-X-C motif chemokine ligand 12 [Source:Xenbase;Ac... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kat52.509e-14847.80K(lysine) acetyltransferase 5 [Source:MGI Symbol;A... [more]
Kat52.951e-14847.80K(lysine) acetyltransferase 5 [Source:MGI Symbol;A... [more]
Kat54.010e-13643.65K(lysine) acetyltransferase 5 [Source:MGI Symbol;A... [more]
Kat83.140e-10540.31K(lysine) acetyltransferase 8 [Source:MGI Symbol;A... [more]
Kat55.234e-9244.19K(lysine) acetyltransferase 5 [Source:MGI Symbol;A... [more]
back to top
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RBG4|KAT5_PONAB2.534e-14747.80Histone acetyltransferase KAT5 OS=Pongo abelii OX=... [more]
sp|Q960X4|TIP60_DROME2.225e-13761.49Histone acetyltransferase Tip60 OS=Drosophila mela... [more]
sp|Q99MK2|KAT5_RAT2.805e-13543.65Histone acetyltransferase KAT5 OS=Rattus norvegicu... [more]
sp|Q8CHK4|KAT5_MOUSE2.805e-13543.65Histone acetyltransferase KAT5 OS=Mus musculus OX=... [more]
sp|Q92993|KAT5_HUMAN3.831e-13560.30Histone acetyltransferase KAT5 OS=Homo sapiens OX=... [more]
back to top
BLAST of Histone acetyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A517D2D10.000e+082.29Histone acetyltransferase OS=Dugesia japonica OX=6... [more]
A0A0X3PW261.306e-16352.38Histone acetyltransferase (Fragment) OS=Schistocep... [more]
A0A4Z2CM241.314e-16252.35Histone acetyltransferase OS=Schistosoma japonicum... [more]
Q5DDR32.599e-16252.25Histone acetyltransferase OS=Schistosoma japonicum... [more]
G4LXT09.738e-16252.56Histone acetyltransferase OS=Schistosoma mansoni O... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat5b8.046e-14845.66K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZD... [more]
kat5b2.265e-14044.04K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZD... [more]
kat5b9.174e-14043.64K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZD... [more]
kat5b1.526e-13759.70K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZD... [more]
kat5b3.915e-13759.70K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kat5b2.005e-13859.18K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000007004.17.201e-8949.46pep scaffold:Pmarinus_7.0:GL480995:3484:21994:1 ge... [more]
kat7b1.625e-8847.12K(lysine) acetyltransferase 7b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ESA12.496e-11141.49Catalytic subunit of the histone acetyltransferase... [more]
SAS32.381e-6948.51Histone acetyltransferase catalytic subunit of NuA... [more]
SAS24.962e-3641.04Histone acetyltransferase (HAT) catalytic subunit ... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO349343.252e-15147.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398842.037e-10140.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397381.171e-4966.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397397.645e-2343.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO290097.004e-2233.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat5b3.473e-13759.40lysine acetyltransferase 5 [Source:NCBI gene;Acc:1... [more]
kat5b3.737e-13759.40lysine acetyltransferase 5 [Source:NCBI gene;Acc:1... [more]
kat5b4.632e-13759.40lysine acetyltransferase 5 [Source:NCBI gene;Acc:1... [more]
kat83.910e-10640.96lysine acetyltransferase 8 [Source:NCBI gene;Acc:1... [more]
kat84.887e-10640.96lysine acetyltransferase 8 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Histone acetyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049001.10.000e+095.27SMESG000049001.1[more]
SMESG000040171.11.174e-8236.96SMESG000040171.1[more]
SMESG000062900.12.572e-6054.12SMESG000062900.1[more]
SMESG000062900.12.648e-6054.12SMESG000062900.1[more]
SMESG000062900.12.771e-6054.12SMESG000062900.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006506 ID=SMED30006506|Name=Histone acetyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2255bp
TTTAACTAAATTTTAGATTATGTTTAATAAGTTATGTGAAGGCGTAAAAT
TACCTGTTAAACTAAAAGACAGTGACATTTATCATTTCGCAGAAATCTTA
AAAGCGAGAGAAAATAAACGATTAGGGACTAAGGAATACTATGTTCATTT
TGATGAATACAATAAGCGGTTGGATGATTGGGTATCGGAAGATCGAATGA
AGATGCATGAGATGGTATTTCCTACGAAAAAAATCCACAAAGACTCCTCA
ACTGCATCTTTAACTGCATTGGTTAGTACAAATGATTGCTCAAATTCACC
TTTCGGTGAAGCTAATGCCCAAGAAGCGGAAAATGTGGAATACAAGATCC
GACTGAATTCCAGCACGAGTTCGTCGGCATTGAAAAATGAGGATCAAATG
TCCCTGGTGACGATGGATGACAGGAACTGTTTCAGCTACCTCCAGGAGCC
AGTTGCAAACGTGTTGCCACAGACCGGCAGTATGATGGTGACCAGCCACC
AGGAGCATCAGGACATCGTCACTAGGATGCGCAATATCGACATGATTGTC
CTCGGCAAGTCCCGCATCAAGCCCTGGTATTTCTCACCCTATCCAGAGGA
ACTGACCGAGCTGGATGCGATTTTCATCTGCGAGTTCTGTTTGAAATACT
TCAAGAGCTGTTTTTGTTTGCAGCGGCATTTAGAGAAATGCCGACTGCGC
CATCCGCCAGGCAATGAAATCTATCGCAAGAATCCACTGAGCTTTTTTGA
GATCGATGGCAGGAAAAATAAGAAATATGCCCAGAATCTGTGCCTGCTTG
CCAAGCTGTTCCTTGACCACAAAACCTTGTATTACGACACAGATCCGTTC
CTGTTCTACATTCTCTGCGAGTACGACGAGGAGGGGTTCCACATTGTTGG
CTACTTCAGCAAGGAAAAGGAATCGAATGACGACAACAATGTCGCGTGCA
TCCTGACGTTGCCGCCATACCAACGGAAAGGTTACGGCAAGCTGTTGATA
GAATTCAGCTACGAACTCAGCAAGCTGGAGAACAAAACCGGTTCCCCCGA
GAAACCGCTGAGTGACCTTGGGTTGCTATCGTACCGCAGCTATTGGTGCC
AGACAATCATGGAAGTCATCATTGATGTGGCCAATTCCGCTGACGGCGCA
GCCAATTCCTCCTCATCGGCATTCGATCCGCCCTCGATCTCATTGAAGTA
TGAATTTACTAGTTGGAAACCATTGGCAACGGTATTTATATATATATATG
TGTGTGTGTGCAGTGACGTCGTGGAGAAAACCTCCATCAACCCGAAGGAT
CTCAACGCCACCCTGAACACAATGAACATCATCTACTACAGCAAAGGCCA
ACACGTCATTGTCGTCACCAAAAAGATGCTCGACAAATTCAAGGCCTCCA
TGGCCAAGCGGAAGTACCGAATCGATGCGAAACTTCTCAACTGGCATCCA
AAGGATTGGTCCAAACGAGGTCGCTGGTAACCAGATTTTATGATGTTGTA
AATAAATTGTTGATCGTCTTTCATTTGAACTCGCTCATCGCCATTGAATC
GTGGCTGGTGGAGCGCCTTTTTATCCTTGTTGCTATGGCAATCATGTTGG
ACATGTGTCTGCACGGTGAGTGAAATATGATTACAATAAAAGTCTGACTA
CTCAAAAACCTTTCAAGGTTATCACAATATTACAAAATATCTCAAGATCA
TCTAATGTAGAATCATTGATTTTTTCGTTTTAATTTAACTAAATCTCTGG
TCGACAACGTTTCATATGACAATTGAGTCATTTTTAGAACTTGTTCCGGA
TACTAATCTCATAGTTGGCCACACGGTTTACCGCTGGTTATCAACGATAA
AGCATCTTTTTGTTTCATTGAATCCTATTTCACGTCTGGTTATTTCATCC
AATGTGACTTTTGTTCCTATTATTATCGCTTTCCACACTTTCAATTTGTT
TTTGGCATTTTCAAAGTTGGTTACATTAAAATAAATTACAAGTTAGAAGA
AGGATGAAAGTTTGAGGAAAAGAAGTGTTGACGGATTTCAGTTTGAATGC
TAATGATATAAGCATTGAACACAACTTGTATAATTGAATCGGGCAGTCTA
AAGACTAAATCATTAATCACAGGATGCATAACATCTTACAAGAGGACTGT
AAAATATTCATAAGCTGGCAAGAAGTCCGAGATCTGTGTGAAAAATATGC
GGGGGCTTATTGTTGAAGATTAAAAGATCTTAGGAAGAATGTAAGATCGG
AAGAG
back to top

protein sequence of SMED30006506-orf-1

>SMED30006506-orf-1 ID=SMED30006506-orf-1|Name=SMED30006506-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=487bp
MFNKLCEGVKLPVKLKDSDIYHFAEILKARENKRLGTKEYYVHFDEYNKR
LDDWVSEDRMKMHEMVFPTKKIHKDSSTASLTALVSTNDCSNSPFGEANA
QEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLP
QTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDA
IFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKN
KKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEK
ESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDL
GLLSYRSYWCQTIMEVIIDVANSADGAANSSSSAFDPPSISLKYEFTSWK
PLATVFIYIYVCVCSDVVEKTSINPKDLNATLNTMNIIYYSKGQHVIVVT
KKMLDKFKASMAKRKYRIDAKLLNWHPKDWSKRGRW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0016747transferase activity, transferring acyl groups other than amino-acyl groups
GO:0004402histone acetyltransferase activity
Vocabulary: cellular component
TermDefinition
GO:0035267NuA4 histone acetyltransferase complex
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR040706Zf-MYST
IPR037995Esa1/KAT5/Tip60
IPR016181Acyl_CoA_acyltransferase
IPR025995Tudor-knot
IPR002717HAT_MYST-type
IPR016197Chromo-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0016573histone acetylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002717Histone acetyltransferase domain, MYST-typePFAMPF01853MOZ_SAScoord: 229..444
e-value: 7.7E-77
score: 257.0
IPR002717Histone acetyltransferase domain, MYST-typePROSITEPS51726MYST_HATcoord: 168..477
score: 71.153
NoneNo IPR availableGENE3DG3DSA:3.30.60.60coord: 168..225
e-value: 4.2E-26
score: 92.1
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 1..76
e-value: 2.5E-18
score: 67.6
NoneNo IPR availablePANTHERPTHR10615HISTONE ACETYLTRANSFERASEcoord: 24..483
NoneNo IPR availableCDDcd04301NAT_SFcoord: 280..329
e-value: 3.56815E-4
score: 36.8701
NoneNo IPR availableCDDcd18642CBD_MOF_likecoord: 19..71
e-value: 4.74792E-11
score: 56.2855
IPR025995RNA binding activity-knot of a chromodomainPFAMPF11717Tudor-knotcoord: 7..61
e-value: 5.8E-15
score: 54.9
IPR040706MYST, zinc finger domainPFAMPF17772zf-MYSTcoord: 170..224
e-value: 2.7E-22
score: 78.1
IPR037995Histone acetyltransferase Esa1/KAT5/Tip60PANTHERPTHR10615:SF161HISTONE ACETYLTRANSFERASE KAT5coord: 24..483
IPR016181Acyl-CoA N-acyltransferaseSUPERFAMILYSSF55729Acyl-CoA N-acyltransferases (Nat)coord: 169..477
IPR016197Chromo-like domain superfamilySUPERFAMILYSSF54160Chromo domain-likecoord: 4..74