Innexin

Overview
NameInnexin
Smed IDSMED30006503
Length (bp)1654
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30006503) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30006503) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30006503) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30006503) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006503

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30006503SMESG000016539.1 NB.24.11bncbi_smed_estsPMID:17670787
Oviedo et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30006503SMESG000016539.1 dd_Smed_v4_13475_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006503SMESG000016539.1 dd_Smed_v4_13475_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006503SMESG000016539.1 dd_Smed_v4_13475_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30006503SMESG000016539.1 dd_Smed_v4_13475_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30006503SMESG000016539.1 dd_Smed_v4_13475_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006503SMESG000016539.1 dd_Smed_v4_13475_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006503SMESG000068735.1 dd_Smed_v4_15435_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006503SMESG000068735.1 dd_Smed_v4_15435_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006503SMESG000068735.1 dd_Smed_v4_15435_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 252.677 bits (644), Expect = 1.396e-78
Identity = 132/356 (37.08%), Postives = 207/356 (58.15%), Query Frame = 1
Query:  466 DFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPL----LLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNN--SPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKY 1515
            D  D+LNY +T+ +I +F  +VS +QYVG PIQCWVP  FT   E Y E+ CWVQNTYFL     +P N  E  + + + YYQWV   L L+A+L Y+P + W+L S +  +    L++ A ++ L D + R +A+  +  ++EE      +    N    +   IC+ +  +  T +++  ++L   N VGQI+L+ T+LG R  ++G+Q+L  + +G +W++SG+FPRVT C   ++  G     +TVQCVL +N F EK+++FLWFW+F LA  T C+   W     +P R+  F+ +YL  ++     D +   RFV + L  DGV LLR V++ A +L   +++  LW  Y
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAER-ENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLG-NVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 243.432 bits (620), Expect = 4.142e-75
Identity = 135/387 (34.88%), Postives = 215/387 (55.56%), Query Frame = 1
Query:  415 VFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQ--KHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSH-----RFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKY----KRSRFTCTD 1542
            ++ +  +FK  +     DF D+LNY +TS +I  F  IVS +QYVG PIQCWVP +FT AWE Y E+ CWV+NTY+L  +   P   LE  D+  + ++YYQWV   L L+A+  Y+P + W+   H         L + A +A + D D R   +  +   +E+  E     QR  + +          +  T +++  ++L +GN V Q++++ ++LG  + F+G  ILR + +G +W+ SG FPRVT C   +R  G     +TVQCVL +N F EK+++FLWFW+F +A V+  +   W I   +P +  +FI +YLRA     + D +   +FV   LG DGV  +R +S+ A D++A ++   LW  +    ++ +F  T+
Sbjct:    3 LYYLAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFP---LEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALE----IQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLG-NVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNSTE 379          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 243.432 bits (620), Expect = 4.142e-75
Identity = 135/387 (34.88%), Postives = 215/387 (55.56%), Query Frame = 1
Query:  415 VFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQ--KHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSH-----RFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKY----KRSRFTCTD 1542
            ++ +  +FK  +     DF D+LNY +TS +I  F  IVS +QYVG PIQCWVP +FT AWE Y E+ CWV+NTY+L  +   P   LE  D+  + ++YYQWV   L L+A+  Y+P + W+   H         L + A +A + D D R   +  +   +E+  E     QR  + +          +  T +++  ++L +GN V Q++++ ++LG  + F+G  ILR + +G +W+ SG FPRVT C   +R  G     +TVQCVL +N F EK+++FLWFW+F +A V+  +   W I   +P +  +FI +YLRA     + D +   +FV   LG DGV  +R +S+ A D++A ++   LW  +    ++ +F  T+
Sbjct:    3 LYYLAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFP---LEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALE----IQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLG-NVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNSTE 379          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 242.276 bits (617), Expect = 4.845e-74
Identity = 133/375 (35.47%), Postives = 209/375 (55.73%), Query Frame = 1
Query:  415 VFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQ--KHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSH-----RFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYK 1518
            ++ +  +FK  +     DF D+LNY +TS +I  F  IVS +QYVG PIQCWVP +FT AWE Y E+ CWV+NTY+L  +   P   LE  D+  + ++YYQWV   L L+A+  Y+P + W+   H         L + A +A + D D R   +  +   +E+  E     QR  + +          +  T +++  ++L +GN V Q++++ ++LG  + F+G  ILR + +G +W+ SG FPRVT C   +R  G     +TVQCVL +N F EK+++FLWFW+F +A V+  +   W I   +P +  +FI +YLRA     + D +   +FV   LG DGV  +R +S+ A D++A ++   LW  + 
Sbjct:    3 LYYLAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFP---LEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALE----IQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLG-NVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFN 367          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-13 (Innexin [Source:UniProtKB/TrEMBL;Acc:O44887])

HSP 1 Score: 234.572 bits (597), Expect = 1.011e-71
Identity = 134/371 (36.12%), Postives = 204/371 (54.99%), Query Frame = 1
Query:  466 DFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLR----SAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERD---CDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSR 1557
            D  D+LNY +T  L+VIF   +S +QYVG+PIQCW+P +FT AWE Y E+ C+VQNTYF+ P + +P ++++  +   + YYQWV   LGLQA+L YLP LFW+L +    + L+     A++A   D+  R +A     A + E     +RF +  S  + +  S+      T ++L  + L +   V Q  ++  +LG  + F+G+ IL  + +G +W++SG+FPRVT C   +R  G K   +TVQCVL +N F EKVYVFLWFW   +   TF N + W   L     R   I  YL+     S ++ R+    D+FV   L +DGV +   + +    + + DV   +W      RF   +D+ S+
Sbjct:   18 DSIDRLNYYWTPMLLVIFALTLSAKQYVGQPIQCWIPAQFTGAWEQYSENYCFVQNTYFISPDKYIPDSEIDR-EGAEIGYYQWVPFILGLQAILFYLPSLFWRLMNFNSGVALKKMLFGAKKADRVDEKARNEAAKSTGAHLYESLTLQSRFAKYTSA-FTYGGSYL-----TYLYLFVKFLYLVQIVFQFIILNNFLGTSYTFWGLGILSDILNGREWEESGHFPRVTMCDFEVRVLGNK-HRHTVQCVLMINMFNEKVYVFLWFWLVIVGVATFLNLVNWTRKLMFRSARKAHIKSYLQIEDNFSDDNSRNGQILDKFVDYKLKSDGVFITHLIDNNGGSVFSHDVIVDMW-----DRFLQDEDNRSQ 375          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 92.8189 bits (229), Expect = 3.807e-20
Identity = 81/288 (28.12%), Postives = 127/288 (44.10%), Query Frame = 1
Query:  478 QLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPS-----------QPVPINDLETFDQ-KHVTYYQWVTIFLGLQAVLSYLPHLFWQL-GSHRFPLLLRSAREAALPD--KDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWK---QSGYFPRVTYCRVLIRRWGVKDASYTVQ--CVLSLNYFLEKVYVFLWFWFFSLACVT 1281
            +++Y+ T  +++ F  +V+ RQY+G PI C V +      + Y    CW+ +T F +P            QP   + +E  D+ K+  YYQWV   L  QA+L Y+P   W+     R  +L+       + D  K+ RKK +            F     R+N   +RF               V   L+  N +GQIY +  +L      +G  +L+      D +    +  FP+VT C     ++G   +  T    CVL LN   EK+YVFLWFWF  L+ ++
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILV---------DYFIGNLNRHNFYAFRF--------------FVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCT--FHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMS 282          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 92.8189 bits (229), Expect = 3.807e-20
Identity = 81/288 (28.12%), Postives = 127/288 (44.10%), Query Frame = 1
Query:  478 QLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPS-----------QPVPINDLETFDQ-KHVTYYQWVTIFLGLQAVLSYLPHLFWQL-GSHRFPLLLRSAREAALPD--KDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWK---QSGYFPRVTYCRVLIRRWGVKDASYTVQ--CVLSLNYFLEKVYVFLWFWFFSLACVT 1281
            +++Y+ T  +++ F  +V+ RQY+G PI C V +      + Y    CW+ +T F +P            QP   + +E  D+ K+  YYQWV   L  QA+L Y+P   W+     R  +L+       + D  K+ RKK +            F     R+N   +RF               V   L+  N +GQIY +  +L      +G  +L+      D +    +  FP+VT C     ++G   +  T    CVL LN   EK+YVFLWFWF  L+ ++
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILV---------DYFIGNLNRHNFYAFRF--------------FVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCT--FHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMS 282          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 92.8189 bits (229), Expect = 3.807e-20
Identity = 81/288 (28.12%), Postives = 127/288 (44.10%), Query Frame = 1
Query:  478 QLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPS-----------QPVPINDLETFDQ-KHVTYYQWVTIFLGLQAVLSYLPHLFWQL-GSHRFPLLLRSAREAALPD--KDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWK---QSGYFPRVTYCRVLIRRWGVKDASYTVQ--CVLSLNYFLEKVYVFLWFWFFSLACVT 1281
            +++Y+ T  +++ F  +V+ RQY+G PI C V +      + Y    CW+ +T F +P            QP   + +E  D+ K+  YYQWV   L  QA+L Y+P   W+     R  +L+       + D  K+ RKK +            F     R+N   +RF               V   L+  N +GQIY +  +L      +G  +L+      D +    +  FP+VT C     ++G   +  T    CVL LN   EK+YVFLWFWF  L+ ++
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILV---------DYFIGNLNRHNFYAFRF--------------FVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCT--FHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMS 282          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 92.8189 bits (229), Expect = 3.807e-20
Identity = 81/288 (28.12%), Postives = 127/288 (44.10%), Query Frame = 1
Query:  478 QLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPS-----------QPVPINDLETFDQ-KHVTYYQWVTIFLGLQAVLSYLPHLFWQL-GSHRFPLLLRSAREAALPD--KDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWK---QSGYFPRVTYCRVLIRRWGVKDASYTVQ--CVLSLNYFLEKVYVFLWFWFFSLACVT 1281
            +++Y+ T  +++ F  +V+ RQY+G PI C V +      + Y    CW+ +T F +P            QP   + +E  D+ K+  YYQWV   L  QA+L Y+P   W+     R  +L+       + D  K+ RKK +            F     R+N   +RF               V   L+  N +GQIY +  +L      +G  +L+      D +    +  FP+VT C     ++G   +  T    CVL LN   EK+YVFLWFWF  L+ ++
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILV---------DYFIGNLNRHNFYAFRF--------------FVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCT--FHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMS 282          
BLAST of Innexin vs. Ensembl Fly
Match: shakB (gene:FBgn0085387 transcript:FBtr0112571)

HSP 1 Score: 92.4337 bits (228), Expect = 5.262e-20
Identity = 74/274 (27.01%), Postives = 122/274 (44.53%), Query Frame = 1
Query:  478 QLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFL----LPSQPVPI-------NDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGY---FPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFW 1257
            +L+Y  T  +++ F  I++ RQYVG PI C   ++     ED L   CW+Q+TY L    L  Q V +       +D +  D+KH  YYQWV   L  QA+L Y P   W+             +  AL         I  L   I  +AE   + +     ++    +   ++     + V  +L++ N +GQ++LM  +       FG++++  + +  + +       FPR+T C         +   +   C+L LN   EK+Y+FLWFW
Sbjct:   25 RLHYSITVMILMSFSLIITTRQYVGNPIDCVHTKDIP---EDVLNTYCWIQSTYTLKSLFLKKQGVSVPYPGIGNSDGDPADKKHYKYYQWVCFCLFFQAILFYTPRWLWKSWE--------GGKIHAL---------IMDLDIGICSEAEKKQKKKLLLDYLWE---NLRYHNWWAYRYYVCELLALINVIGQMFLMNRFFDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 275          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 1.776e-77
Identity = 132/356 (37.08%), Postives = 207/356 (58.15%), Query Frame = 1
Query:  466 DFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPL----LLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNN--SPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKY 1515
            D  D+LNY +T+ +I +F  +VS +QYVG PIQCWVP  FT   E Y E+ CWVQNTYFL     +P N  E  + + + YYQWV   L L+A+L Y+P + W+L S +  +    L++ A ++ L D + R +A+  +  ++EE      +    N    +   IC+ +  +  T +++  ++L   N VGQI+L+ T+LG R  ++G+Q+L  + +G +W++SG+FPRVT C   ++  G     +TVQCVL +N F EK+++FLWFW+F LA  T C+   W     +P R+  F+ +YL  ++     D +   RFV + L  DGV LLR V++ A +L   +++  LW  Y
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAER-ENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLG-NVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 5.620e-62
Identity = 119/382 (31.15%), Postives = 203/382 (53.14%), Query Frame = 1
Query:  415 VFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQ-----LGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRN------TTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSN---DERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYK 1518
            ++ +   F+  Y     DF D+LNY +T+ ++  F  +VS +QYVG PIQCWVP  FT A E Y E+ CWVQNTY++   + +P  ++ +   + + YYQWV   L ++A+L Y+P + W+             L++ A +A L D +++ + +  +   ++++ + +   ++ +S           N         T +++  +VL   N + Q +L+   LG     +G  +L+ +    +W+Q+G FPRVT C   +R  G     +TVQCVL +N F EK+++FLWFWF +   VT CNT+ W + + IP +   F+ +YLR L    +    D+    +F  N L  DGV +LR +S+ A +L++ ++   LW  + 
Sbjct:  123 LYYLASAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIP-REIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLG-NIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFN 502          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.371e-59
Identity = 123/370 (33.24%), Postives = 200/370 (54.05%), Query Frame = 1
Query:  457 EGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLET--FDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSH----RFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFIC--SFAPNSRNTT-IFLVSRVLSIGNSVGQIYLMQTYLGY-RHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDER-------DCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKY 1515
            E  D++D+LNY  T  +++ F  ++S +Q+ G+PI+C  P +F  +WE Y E+ CW Q+TYF+ P+Q V +   E      + ++YYQWV  FL LQA     P   W+  S+    R   ++  A+++A  ++++R+K I IL   +     F A  +R    +++ +   +F  +S   + I+L ++VL   N   Q+YLM  +LG  RH ++G  +++ +  G  W++SGYFPR   C   +R+       Y+VQCVL +N F EK++V LWFW+  L   +  + + W I L  P     F+ Q+L AL  + + ++R       D  +FV   L  DGV +LR VSS A  + A D+   L+  Y
Sbjct:   18 EDDDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPGSWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKVQVHKTVTFLNFQYSSGFISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYGFGVVQDIVQGEPWERSGYFPRAAVCDFEVRQVA-NIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHL-ALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAY 385          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q27295|EAT5_CAEEL (Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN=eat-5 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.744e-58
Identity = 116/395 (29.37%), Postives = 204/395 (51.65%), Query Frame = 1
Query:  472 ADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPL----LLRSAREAALPDKDLRKKAISILTASI---------EEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDR--------------FVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIH 1575
             D+LNY +++ +I+     ++ RQYVG P+QCWVP +FT AWE Y E  C+V NTY++ P+  VP+   E   Q+ + YYQW    + ++A   YLP +FW + S +  +    L+ +A++A   + + RKK I I+   I         EE+    A+ QR        I         T ++LV++++ + NS  Q Y    +LG   P++G++IL  +  G DW+ SG FPR+  C   +R  G     Y++QCVL+LN F EK+++FL+ WF  +  VT  +++    N+    +  +F+ Q+L    Q  +++++  +R              F  +    D ++LL+ +++   D++  ++  ++W ++           L RF++N H
Sbjct:   20 TDRLNYYYSTLIIMGMSLTITARQYVGSPLQCWVPAQFTKAWEQYAEDYCFVYNTYWVKPNDKVPLTVEERVSQQ-LIYYQWAPFIMAIEAAFFYLPVIFWSMLSTKSGINIIKLVETAQKAEGAESEERKKQIDIICRHISNNLRKRRNEEETTKMAKIQR--------IFGMQHGKYITNVYLVTKLIYMTNSFLQFYSTNKFLGQNDPYWGMRILDDILKGTDWEHSGNFPRIAMCDFQVRVLG-NLQRYSIQCVLTLNMFNEKIFLFLYIWFLLVFFVTLFDSIFLCYNMFSSHKLVEFLQQFLDNQDQDENDEKKPEERKVYRKEQHSILLSEFCLHKFTPDIIILLKMINNHTGDIVCTEIVGRMWNEFLERDAKLV---LQRFVDNDH 401          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 196.823 bits (499), Expect = 7.069e-56
Identity = 113/358 (31.56%), Postives = 178/358 (49.72%), Query Frame = 1
Query:  466 DFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFW-----QLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRS 1524
            D  D+L+Y  T+ L+  F  +VS +QYVG  IQCW+P EF   WE Y E  C++QNT+F+     +P  D+E   +  + YYQWV I L +QA + YLP   W     Q G   FP ++  A      D + R K ++ L   I +  +  ++ +      YRF       S  + +++  +++ + N   Q  ++  +LG     +G      + +G +W+ SG FPRVT C   +R+       YTVQCVL +N F EK+Y+F+WFWF  +   TF NTL     L     R+ +I   L        +++     F  N L  DGVLL+R +   A  ++  ++  +L+ K+  +
Sbjct:   22 DAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFFIPERSEIP-GDVEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGL-DFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYRFGKGLG--SMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLA-NVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGEN 374          
BLAST of Innexin vs. TrEMBL
Match: A0A4S2LVS8 (Innexin OS=Opisthorchis felineus OX=147828 GN=inx PE=3 SV=1)

HSP 1 Score: 508.064 bits (1307), Expect = 1.452e-174
Identity = 227/400 (56.75%), Postives = 307/400 (76.75%), Query Frame = 1
Query:  400 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVAI 1596
            M    V +IG++F TPYGGEGVDF DQLNYQFT GL++IFI ++ IRQYVGKPIQCWVPQEFTH+WE+Y E++CWVQNTYFL PS  VP +D E    KH+ YYQW+ I L  Q +LS++P+L W++GS R P+LLRSA+EA++PD++LR+KAIS L A++EEQAE +AR++R  S + RF+C   PN+R T +F + R   IGNSVGQIYLM+ ++G     FG+++L  + SG DW+ SG FPRVT+C V +R+ G +K ASYT+QCVL +NYF+EKVYVFLWFWF  L C+T  +T+ WA N  +P RR  +I QY+RA++Q+S+ +ERDC RFV N LG DGVL+L+ VS  +SDLIALDV+A LW+ Y+ ++ T T++D++RFLE ++++S  A+
Sbjct:    1 MNPDSVLRIGKVFYTPYGGEGVDFVDQLNYQFTGGLLIIFIAVIGIRQYVGKPIQCWVPQEFTHSWEEYAENLCWVQNTYFLHPSDNVPEDDYELTKVKHIGYYQWIAIVLAGQVMLSWVPYLLWRVGSKRLPILLRSAKEASVPDRELRQKAISCLVATLEEQAESTARYRRMTSGLKRFLCQLRPNTRITFLFFIVRFCFIGNSVGQIYLMKHFIGTNSTMFGVEVLNDIVSGKDWETSGKFPRVTFCTVRVRKMGQIKPASYTLQCVLPINYFVEKVYVFLWFWFVILTCITLLSTIHWAFNTLLPVRRIAYIKQYIRAIRQLSNTEERDCTRFVNNNLGPDGVLILQVVSRVSSDLIALDVTATLWSNYRHAKITGTEEDINRFLETVNRNSTTAV 400          
BLAST of Innexin vs. TrEMBL
Match: A0A074ZMI3 (Innexin OS=Opisthorchis viverrini OX=6198 GN=inx PE=3 SV=1)

HSP 1 Score: 508.064 bits (1307), Expect = 1.452e-174
Identity = 227/400 (56.75%), Postives = 307/400 (76.75%), Query Frame = 1
Query:  400 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVAI 1596
            M    V +IG++F TPYGGEGVDF DQLNYQFT GL++IFI ++ IRQYVGKPIQCWVPQEFTH+WE+Y E++CWVQNTYFL PS  VP +D E    KH+ YYQW+ I L  Q +LS++P+L W++GS R P+LLRSA+EA++PD++LR+KAIS L A++EEQAE +AR++R  S + RF+C   PN+R T +F + R   IGNSVGQIYLM+ ++G     FG+++L  + SG DW+ SG FPRVT+C V +R+ G +K ASYT+QCVL +NYF+EKVYVFLWFWF  L C+T  +T+ WA N  +P RR  +I QY+RA++Q+S+ +ERDC RFV N LG DGVL+L+ VS  +SDLIALDV+A LW+ Y+ ++ T T++D++RFLE ++++S  A+
Sbjct:    1 MNPDSVLRIGKVFYTPYGGEGVDFVDQLNYQFTGGLLIIFIAVIGIRQYVGKPIQCWVPQEFTHSWEEYAENLCWVQNTYFLHPSDNVPEDDYELTKVKHIGYYQWIAIVLAGQVMLSWVPYLLWRVGSKRLPILLRSAKEASVPDRELRQKAISCLVATLEEQAESTARYRRMTSGLKRFLCQLRPNTRITFLFFIVRFCFIGNSVGQIYLMKHFIGTNSTMFGVEVLNDIVSGKDWETSGKFPRVTFCTVRVRKMGQIKPASYTLQCVLPINYFVEKVYVFLWFWFVILTCITLLSTIHWAFNTLLPVRRIAYIKQYIRAIRQLSNTEERDCTRFVNNNLGPDGVLILQVVSRVSSDLIALDVTATLWSNYRHAKITGTEEDINRFLETVNRNSTTAV 400          
BLAST of Innexin vs. TrEMBL
Match: A0A4S2LXE0 (Innexin OS=Opisthorchis felineus OX=147828 GN=inx PE=3 SV=1)

HSP 1 Score: 507.294 bits (1305), Expect = 3.581e-174
Identity = 226/399 (56.64%), Postives = 311/399 (77.94%), Query Frame = 1
Query:  397 LMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGV 1590
            L++ GFVFK+GRLF+TPYGGEGVDF DQLNYQ+T GL++IFI I+S+RQYVGKPIQCWVPQEFT +WE+Y E++CWV NTYFLLP++ +P + ++    K + YYQWV I +  QA+LS++PHL W++GS R PLLL+SAREAA+PD++LR KA+S L A++EEQAE  +RF+R  S + R +C   PN+R TT+FL+ R+L + NSVGQIY+M+ + G+    FG+++L+ +++G +W+++G+FPRVTYC + +R+ G  K ASYT+QCVL +N F EK+YVFLWFWF  L  +T  NTL WA+N  +P RR  +I QYL+AL+ +SS +ERDC RFV N LGADGV +L  VS  ASDLIALDV+A LW  Y++++ T T++D++R LE +++SS V
Sbjct:    8 LLDGGFVFKLGRLFRTPYGGEGVDFIDQLNYQYTGGLMIIFIAIISLRQYVGKPIQCWVPQEFTKSWEEYAENLCWVSNTYFLLPNEEIPTDQVDYEKVKFIGYYQWVVIVMAGQALLSWVPHLLWRVGSRRLPLLLKSAREAAIPDRELRLKAVSCLVATLEEQAESQSRFRRIKSLLNRCLCGVTPNARLTTLFLLVRMLFVANSVGQIYMMKRFTGFNSTLFGMKLLQDLSAGVEWERTGHFPRVTYCTIKVRKMGQTKPASYTLQCVLPINNFTEKIYVFLWFWFAILGILTTLNTLQWAMNTILPVRRVNYIKQYLKALRLISSTEERDCARFVNNTLGADGVFILHVVSKIASDLIALDVTATLWRNYRQAKITGTEEDVNRLLETVNRSSAV 406          
BLAST of Innexin vs. TrEMBL
Match: A0A504YQY5 (Innexin OS=Fasciola gigantica OX=46835 GN=inx PE=3 SV=1)

HSP 1 Score: 505.368 bits (1300), Expect = 1.838e-173
Identity = 226/396 (57.07%), Postives = 304/396 (76.77%), Query Frame = 1
Query:  400 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSS 1584
            M    V +IG++F TPYGGEGVDF DQLNYQFT GL++IFI ++ IRQYVGKPIQCWVPQEFTH+WE+Y E++CWVQNTYFL PS  VP +D E    KH+ YYQW+ I L  Q +LS++P+L W++GS R P+LLRSA+EA++PD++LR+KAIS L A++EEQAE +AR++R  S + RF+C   PN+R T +F + R   +GNS+GQIYLM+ ++G     FGI +L  + +G DW+ SG FPRVT+C V +R+ G +K ASYT+QCVL +NYF+EKVYVFLWFWF  L CVT  +T+ WA N  +P RR  +I QY+RA++Q+S+ +ERDC RFV N LG DGVL+L+ VS  +SDLIALDV+A LW+ Y+ ++ T T++D++RFLEN+++ S
Sbjct:    1 MNPDAVLRIGKVFYTPYGGEGVDFVDQLNYQFTGGLLIIFIAVIGIRQYVGKPIQCWVPQEFTHSWEEYAENLCWVQNTYFLHPSDQVPEDDYELTHVKHIGYYQWIAIVLAGQVMLSWIPYLLWRVGSKRLPVLLRSAKEASVPDRELRQKAISCLVATLEEQAESTARYRRMTSNLKRFLCQLRPNTRITFLFFIVRFCFLGNSIGQIYLMKNFIGTNSTMFGIDVLNDLITGKDWETSGKFPRVTFCTVRVRKMGQIKPASYTLQCVLPINYFVEKVYVFLWFWFVILTCVTILSTIHWAFNTLLPVRRVAYIKQYIRAIRQLSNTEERDCTRFVNNNLGPDGVLILQVVSRVSSDLIALDVTATLWSNYRHAKITGTEEDINRFLENVNRGS 396          
BLAST of Innexin vs. TrEMBL
Match: A0A4E0RMZ1 (Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 SV=1)

HSP 1 Score: 505.368 bits (1300), Expect = 1.838e-173
Identity = 226/396 (57.07%), Postives = 304/396 (76.77%), Query Frame = 1
Query:  400 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSS 1584
            M    V +IG++F TPYGGEGVDF DQLNYQFT GL++IFI ++ IRQYVGKPIQCWVPQEFTH+WE+Y E++CWVQNTYFL PS  VP +D E    KH+ YYQW+ I L  Q +LS++P+L W++GS R P+LLRSA+EA++PD++LR+KAIS L A++EEQAE +AR++R  S + RF+C   PN+R T +F + R   +GNS+GQIYLM+ ++G     FGI +L  + +G DW+ SG FPRVT+C V +R+ G +K ASYT+QCVL +NYF+EKVYVFLWFWF  L CVT  +T+ WA N  +P RR  +I QY+RA++Q+S+ +ERDC RFV N LG DGVL+L+ VS  +SDLIALDV+A LW+ Y+ ++ T T++D++RFLEN+++ S
Sbjct:    1 MNPDAVLRIGKVFYTPYGGEGVDFVDQLNYQFTGGLLIIFIAVIGIRQYVGKPIQCWVPQEFTHSWEEYAENLCWVQNTYFLHPSDQVPEDDYELTHVKHIGYYQWIAIVLAGQVMLSWIPYLLWRVGSKRLPVLLRSAKEASVPDRELRQKAISCLVATLEEQAESTARYRRMTSNLKRFLCQLRPNTRITFLFFIVRFCFLGNSIGQIYLMKNFIGTNSTMFGIDVLNDLITGKDWETSGKFPRVTFCTVRVRKMGQIKPASYTLQCVLPINYFVEKVYVFLWFWFVILTCVTILSTIHWAFNTLLPVRRVAYIKQYIRAIRQLSNTEERDCTRFVNNNLGPDGVLILQVVSRVSSDLIALDVTATLWSNYRHAKITGTEEDINRFLENVNRGS 396          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000016539.1 (SMESG000016539.1)

HSP 1 Score: 768.074 bits (1982), Expect = 0.000e+0
Identity = 376/400 (94.00%), Postives = 387/400 (96.75%), Query Frame = 1
Query:  400 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVAIV 1599
            M+SG + + G LF   YGG GVDF D+LN+QFT  +I+I I+++S RQY+GKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVAIV
Sbjct:    1 MDSGSILRFGNLFHLNYGG-GVDFVDKLNHQFTGAIILIIISLISARQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVAIV 399          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000068735.1 (SMESG000068735.1)

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 249/412 (60.44%), Postives = 321/412 (77.91%), Query Frame = 1
Query:  367 MARXXXXXXXLMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVAIV 1599
            MARGAGGGGGLMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFT AWE+Y E++CWV NTYFLL  Q +P++D E  + K+++YYQW+ I L  QA+LS++PHL W++ S R P+LLRSAREA LPD+DLR KA+S + AS+EEQA+ + R +R      R +    PN+R T +F+V R++ IGN+VGQIYLMQ ++G  +  FG  +L+ + +G DW+ +G FPRVTYC +L+RR G VK ASYT+QCVL +N+F+EKVYVFLWFWF  +A +T  +TL W  N  +P +R  ++ QYL+A++ ++S +ERDC RFV N LG DGV LL  VSS ASDLI+LDV+A LW  +++++ T T++DLSR LE  ++ +G +IV
Sbjct:    1 MARGAGGGGGLMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNR-AGSSIV 411          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000033444.1 (SMESG000033444.1)

HSP 1 Score: 463.766 bits (1192), Expect = 1.109e-160
Identity = 218/399 (54.64%), Postives = 299/399 (74.94%), Query Frame = 1
Query:  400 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVA 1593
            MESG  F+IG+LF+ PYGGEGVDF DQLNYQFTSGL+++FI I+ IRQYVGKPIQCWVPQEFT +WE+Y E++CWVQNTYFLLP + VP ND E    ++++YYQWV I L  QAV+S++PHL W++ S R P+LLRSAREA+ PD+++R+KAIS L A++EEQ E  ARF++      + +    P +R T +F+  R+L I N+VGQI++M+ ++G     FGI + R + +GN+ + S  FPRVTYC + +R+ G +K  SYT+QCVL +NYF+EKVYVFLWFWF  L+ +T  NT+ W +N+C+P RR QF+ QYL+ALK ++S DERDC RFV+  LG DG+ LL++VS  +SDLIALDV+  LW  YKR++    +DD+ R ++++++SS V 
Sbjct:    1 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV 399          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000032206.1 (SMESG000032206.1)

HSP 1 Score: 450.284 bits (1157), Expect = 1.412e-155
Identity = 208/400 (52.00%), Postives = 291/400 (72.75%), Query Frame = 1
Query:  400 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLS-RFLE---NIHKSS 1584
            M+S  + K+GR+F++P GG+GV F D LNYQ++S ++V+FI I+  RQY+GKPIQCWVPQEFT AWEDY E++CWVQNTYFL P + VP +D+E    + ++YYQW+ I +G QAVL YLP + W++GS RFP+LLR+++EA LPD++LR+KA++ L A++EEQA  + RF++NNS IY+ +C   P                G  + Q+YLM+ +LG  H  FG+ I + + +G+DWK SG+FPRVT+C V IR+ G +K A YT+QCVL +NYF+EK+Y FLWFWF SLAC T  NTL W I+L +  R+  F++ YL+ALKQ+SS +ERDC RFV+ +LG DG+ LLRAV++ ASDL+ALDV+  +W  YK ++ T T++D++  +LE    IHK S
Sbjct:    1 MDSDSILKLGRIFRSPLGGDGVSFIDVLNYQYSSAVLVVFIAIIGTRQYIGKPIQCWVPQEFTRAWEDYAENICWVQNTYFLPPEKAVPDSDVELHSAEFISYYQWIVIVMGAQAVLCYLPQIIWRVGSRRFPVLLRNSKEAILPDRELRRKAVACLVAALEEQAIRNCRFRKNNSTIYKLLCGLGP----------------GAELRQLYLMRDFLGTNHTTFGVMIFQDILAGHDWKVSGHFPRVTFCPVEIRKMGQIKPAIYTLQCVLPINYFVEKIYAFLWFWFVSLACATSFNTLQWFIDLFVKNRQVVFVSNYLKALKQLSSTEERDCGRFVEVVLGNDGIFLLRAVANVASDLMALDVTGIMWRNYKHAKVTGTEEDMAIVWLEAHTKIHKPS 384          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000051126.1 (SMESG000051126.1)

HSP 1 Score: 433.335 bits (1113), Expect = 1.134e-148
Identity = 194/399 (48.62%), Postives = 289/399 (72.43%), Query Frame = 1
Query:  400 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPI---YRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSS 1584
            ME+    KIG+ F T YGG  +DF DQLNYQ+++GL+ IFI+I+  RQYVGKPIQCWVPQ+FT +WE+Y E++CW+Q+TY LL ++ +P +D E    K+++YYQWV I +G QA++SYLPHL W+L S R P+LL++AREA++PD+++R KAI  +   +EE  E   R++R    I   Y F C F P++R T +FL  R L I N++GQIYLM+ ++   + +FGI+++  +  G +WK  G FPR+TYC + +R++G +K AS+T QCVL +N+F+EK+YVFLW WF  LA +T  NTL W + +C+P+++ QFI +YL+ALK +S+++ R+C RFV   LG DG+ +L+AVS  +SDLIALDV+A LW  Y++++    +DD++R++E   K++
Sbjct:    1 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTGLLFIFISIIGFRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFC-FNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFTLLAVLTTLNTLQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMETSLKTN 398          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-91.396e-7837.08Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
inx-14.142e-7534.88Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-14.142e-7534.88Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-14.845e-7435.47Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-131.011e-7136.12Innexin [Source:UniProtKB/TrEMBL;Acc:O44887][more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx23.807e-2028.13gene:FBgn0027108 transcript:FBtr0301860[more]
Inx23.807e-2028.13gene:FBgn0027108 transcript:FBtr0071005[more]
Inx23.807e-2028.13gene:FBgn0027108 transcript:FBtr0332314[more]
Inx23.807e-2028.13gene:FBgn0027108 transcript:FBtr0071006[more]
shakB5.262e-2027.01gene:FBgn0085387 transcript:FBtr0112571[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL1.776e-7737.08Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL5.620e-6231.15Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q23157|INX11_CAEEL1.371e-5933.24Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|Q27295|EAT5_CAEEL1.744e-5829.37Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q19746|INX3_CAEEL7.069e-5631.56Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LVS81.452e-17456.75Innexin OS=Opisthorchis felineus OX=147828 GN=inx ... [more]
A0A074ZMI31.452e-17456.75Innexin OS=Opisthorchis viverrini OX=6198 GN=inx P... [more]
A0A4S2LXE03.581e-17456.64Innexin OS=Opisthorchis felineus OX=147828 GN=inx ... [more]
A0A504YQY51.838e-17357.07Innexin OS=Fasciola gigantica OX=46835 GN=inx PE=3... [more]
A0A4E0RMZ11.838e-17357.07Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 S... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016539.10.000e+094.00SMESG000016539.1[more]
SMESG000068735.10.000e+060.44SMESG000068735.1[more]
SMESG000033444.11.109e-16054.64SMESG000033444.1[more]
SMESG000032206.11.412e-15552.00SMESG000032206.1[more]
SMESG000051126.11.134e-14848.62SMESG000051126.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006503 ID=SMED30006503|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1654bp
ATACTCAGCCTTCGTTACTCAGTTTAGGTATGGAATTATCTTGCTTGCTG
CTTGTCTTGCACTGCTGCATATTTTGAAATTTTTTTTGAATAACACTACT
GCAACTGGTACCCTCCTTGTTAGATTGAATATTATTGATTTGTGGCTCAA
ATTATCCGTCAATATCTGCTGTGAATATTGAATTCTAATATTCTTTTACT
GTGCAACTTTGTCTAATGGCCATTTATTCTATATTCTATCAAATCATATC
TTACAAACTGTAATGACACAAAATTTGACTAATAACCAATCTTTGAACAA
TATTCAATTCAAACTGGATTTTTCGATATTTTGCCAATAATTTTCGTTTG
TTTTGGATTTTGAAAAATGGCAAGAGGAGCCGGAGGTGGTGGTGGATTAA
TGGAAAGTGGATTTGTATTCAAAATTGGTCGACTTTTTAAAACTCCATAT
GGAGGTGAAGGAGTCGACTTCGCAGATCAATTAAATTATCAGTTTACTAG
TGGATTGATTGTTATTTTCATTACTATTGTCAGTATTCGCCAATATGTCG
GAAAACCAATTCAATGTTGGGTTCCACAGGAGTTCACTCATGCTTGGGAA
GATTATTTAGAACACATGTGTTGGGTCCAAAACACTTACTTCCTCTTACC
TTCGCAACCGGTGCCAATAAATGATTTAGAAACATTTGATCAAAAGCATG
TTACATATTATCAATGGGTGACCATATTTCTTGGCCTTCAGGCAGTTTTA
TCTTATTTGCCTCATTTATTTTGGCAACTAGGATCTCATAGGTTTCCTTT
GTTGCTTCGAAGCGCAAGAGAAGCTGCGCTACCGGACAAAGATTTAAGAA
AAAAAGCAATATCGATATTAACAGCATCTATTGAAGAACAAGCTGAATTT
TCAGCTAGATTTCAACGAAATAATTCTCCAATTTATAGATTTATTTGTAG
TTTTGCACCGAATTCTCGAAATACCACCATTTTTCTCGTCAGTCGTGTTT
TAAGCATTGGGAATTCCGTCGGCCAAATTTATCTTATGCAAACTTATCTC
GGTTATCGACATCCATTTTTTGGCATTCAAATTCTCAGAAGTGTTACATC
AGGAAATGACTGGAAACAATCTGGCTATTTTCCCAGAGTGACATATTGCC
GAGTTCTAATAAGACGCTGGGGAGTAAAAGATGCAAGCTATACAGTACAG
TGTGTTCTCTCCTTAAATTATTTTCTGGAAAAGGTATATGTCTTCCTCTG
GTTTTGGTTTTTCAGTTTAGCCTGTGTGACCTTTTGCAATACTCTCATGT
GGGCAATCAATTTGTGTATTCCTTTTCGAAGAAATCAATTCATTACTCAA
TATTTGAGAGCACTCAAACAAGTTTCGTCTAACGACGAACGGGACTGTGA
CAGATTTGTAAAAAATATTCTTGGAGCAGATGGCGTCCTTCTCTTGAGAG
CAGTTTCCTCTGCAGCTAGCGATCTCATTGCGTTAGATGTATCTGCAAAG
CTTTGGGCAAAATATAAACGCTCACGATTCACTTGTACAGATGATGATTT
ATCTAGGTTCTTAGAAAATATTCATAAGTCTTCTGGAGTTGCTATTGTTT
AATCGTATTGATAAGATTGTTTTATTTTAAATAAAAAAATTCATTATGAA
AAAA
back to top

protein sequence of SMED30006503-orf-1

>SMED30006503-orf-1 ID=SMED30006503-orf-1|Name=SMED30006503-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=412bp
MARGAGGGGGLMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVI
FITIVSIRQYVGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVP
INDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSA
REAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNS
RNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWK
QSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFS
LACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKN
ILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLE
NIHKSSGVAIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002142parenchyma
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 38..57