Ubiquitin-like modifier-activating enzyme ATG7

Overview
NameUbiquitin-like modifier-activating enzyme ATG7
Smed IDSMED30006497
Length (bp)2343
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin-like modifier-activating enzyme ATG7 (SMED30006497) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin-like modifier-activating enzyme ATG7 (SMED30006497) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin-like modifier-activating enzyme ATG7 (SMED30006497) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin-like modifier-activating enzyme ATG7 (SMED30006497) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006497

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30006497SMESG000005933.1 PL05001A1C04ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
reproductive organSMED30006497SMESG000005933.1 Contig36947newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006497SMESG000005933.1 Contig36947uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Human
Match: ATG7 (autophagy related 7 [Source:HGNC Symbol;Acc:HGNC:16935])

HSP 1 Score: 502.671 bits (1293), Expect = 7.875e-168
Identity = 276/681 (40.53%), Postives = 403/681 (59.18%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQM---FFTIFLEENGLRLNHFCH----FDIENKDCVLGFCDPSLDPKYPGWPLR--IILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S +D  FWH L ++KL EY+L E P  I G + +  + G   R  +   +F+ S+          G L+  NT E F   +K   L    + +I E+IK+G  L++P  + +F LLT+ DLKKY+F+YWF +PA   P +  L +    LDQ     +++     +D L +        +F I  +EN + ++   H    F  +     +G  DP    +YPGWPLR  ++L A   +    +  +++ V+C+R+  +   R    S +  ++L  +  +    K VGWEK +   + PR   ++  M+P +LAE++VDLNLKLM WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V HIT +DN+ +SYSNPVRQ L+++ED +     KA  A   L++I+P  N +G+ +S+PMPGHP+     ++     D  ++  L+  HDV+FLL+DTRE+RW P+V+     KLVINAALGFDT++VMRHG+  P+   +     +    + DL       N +PG +LGCYFC DVV P +ST+DR++DQQCTV+RPG+++IA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS KVLDQY  EGF FL KVF+    +LE++ GL  L  
Sbjct:   13 LQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQ-AANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEALECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQYPGWPLRNFLVLAAHRWS----SSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADRLQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFAN-IPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQ 687          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Human
Match: ATG7 (autophagy related 7 [Source:HGNC Symbol;Acc:HGNC:16935])

HSP 1 Score: 460.685 bits (1184), Expect = 5.434e-152
Identity = 262/681 (38.47%), Postives = 385/681 (56.53%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQM---FFTIFLEENGLRLNHFCH----FDIENKDCVLGFCDPSLDPKYPGWPLR--IILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S +D  FWH L ++KL EY+L E P  I G + +  + G   R  +   +F+ S+          G L+  NT E F   +K   L    + +I E+IK+G  L++P  + +F LLT+ DLKKY+F+YWF +PA   P +  L +    LDQ     +++     +D L +        +F I  +EN + ++   H    F  +     +G  DP    +YPGWPLR  ++L A   +    +  +++ V+C+R+  +   R    S +  ++L  +  +    K VGWEK +   + PR   ++  M+P +LAE++VDLNLKLM WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V HIT +DN+ +SYSNPVRQ L+++ED +     KA  A   L++I+P  N +G+ +S+PMPGHP+     ++     D  ++  L+  HDV+FLL+DTRE+RW P+V+     KLVINAALGFDT++VMRHG+  P+   +     +    + DL       N +PG +LGCYFC DVV P +ST+DR++DQQCTV+RPG+++IA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQ                           VLDQY  EGF FL KVF+    +LE++ GL  L  
Sbjct:   13 LQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQ-AANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEALECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQYPGWPLRNFLVLAAHRWS----SSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADRLQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFAN-IPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQ---------------------------VLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQ 660          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Human
Match: ATG7 (autophagy related 7 [Source:HGNC Symbol;Acc:HGNC:16935])

HSP 1 Score: 433.335 bits (1113), Expect = 4.979e-142
Identity = 247/651 (37.94%), Postives = 365/651 (56.07%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLEENGLRLNHFCH----FDIENKDCVLGFCDPSLDPKYPGWPLR--IILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEE 2014
            ++F+PF S +D  FWH L ++KL EY+L E P  I G + +  + G   R  +   +F+ S+          G L+  NT E F   +K   L    + +I E+IK+G  L++P  + +F LLT+                            IE L+ A         +    Q +      +F I  +EN + ++   H    F  +     +G  DP    +YPGWPLR  ++L A   +    +  +++ V+C+R+  +   R    S +  ++L  +  +    K VGWEK +   + PR   ++  M+P +LAE++VDLNLKLM WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V HIT +DN+ +SYSNPVRQ L+++ED +     KA  A   L++I+P  N +G+ +S+PMPGHP+     ++     D  ++  L+  HDV+FLL+DTRE+RW P+V+     KLVINAALGFDT++VMRHG+  P+   +     +    + DL       N +PG +LGCYFC DVV P +ST+DR++DQQCTV+RPG+++IA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS K+ D   +E
Sbjct:   13 LQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQ-AANEIWESIKSGTALENPVLLNKFLLLTFA---------------------------IEALECA---------YDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQYPGWPLRNFLVLAAHRWS----SSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADRLQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFAN-IPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKIWDMSDDE 621          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Human
Match: ATG7 (autophagy related 7 [Source:HGNC Symbol;Acc:HGNC:16935])

HSP 1 Score: 100.908 bits (250), Expect = 6.746e-24
Identity = 57/159 (35.85%), Postives = 87/159 (54.72%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQ 568
            ++F+PF S +D  FWH L ++KL EY+L E P  I G + +  + G   R  +   +F+ S+          G L+  NT E F   +K   L    + +I E+IK+G  L++P  + +F LLT+ DLKKY+F+YWF +PA   P +  L +    LDQ
Sbjct:   13 LQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQ-AANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQ 170          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Human
Match: ATG7 (autophagy related 7 [Source:HGNC Symbol;Acc:HGNC:16935])

HSP 1 Score: 72.7886 bits (177), Expect = 4.934e-15
Identity = 37/71 (52.11%), Postives = 46/71 (64.79%), Query Frame = 2
Query: 1883 SCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            + LG  PHQIRG++S F++V P   A   CTACS KVLDQY  EGF FL KVF+    +LE++ GL  L  
Sbjct:   18 TSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQ 88          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Celegans
Match: atg-7 (AuTophaGy (Yeast Atg homolog) [Source:UniProtKB/TrEMBL;Acc:G5EBK4])

HSP 1 Score: 404.445 bits (1038), Expect = 4.518e-131
Identity = 239/672 (35.57%), Postives = 372/672 (55.36%), Query Frame = 2
Query:   89 LIKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLEENGLRLNHFCHFDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNFDFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDLQNSID 2101
            +  F PF + +D  FW+ + ++KL ++KL E P  I          G   +  + +     SS        + G L + NT E F   +K + +    ++KI E+I   ++L++P  + QF+++ + DLKK+ ++YW   PA  +P   E+K+EI  L      +++     LFD  ++ +  +F         L L+   +    ++ CV+   DPS      GW +R +L A++   + P  K    ++  R+   DSI    + ++ + E +      +  K VGWE+  N  L P    ++   +P  L E +VDLNL L+KWRL PD+ LE+ S+ K L+ G GTLGC++AR L+ W V HI+ +DNS+VSY+NPVRQ+L ++ED+     KAE A+ +++ I+P      + L+VPMPGH +   E  V  +E+D  K+  LV +HDV+FL LD+REARW P+VL   H K+ I+ A+GFDTY+++RHG+                   +  +++   + VP  +L CYFC+DV  P NST DR++DQQCTV RPG SMIA+ +AVEL+ S+LQ+ D  K    AS D  D  + LG  PHQIRG++  F  + P  +    C AC   +  Q+ + G++F+  V + P  LEEV GL +LQNS++
Sbjct:    1 MATFVPFVTCLDTGFWNEVNKKKLNDWKLDETPKCISSQLSLHQTEGF--KCHLSLSYDSLSSLESTTGLSMSGTLLLYNTIESFKMVDKSDLIRS-EAEKIWESITTRKWLQNPRLLSQFFIIAFADLKKFKYYYWTCVPALVYP--SEIKQEITPLSSLGADHKI-----LFDFYRKNNFPIFLYSKQSSKMLELSELENNTNPDEICVV-VADPSPVAYSAGWMVRNVLAAVA--HLHPTWKHC-HIISLRS--ADSIGIKYTWTLPSAECSADGAQNAVPKAVGWERNANDKLQPISVDLSKEFDPKILMERSVDLNLSLIKWRLHPDIQLERYSQLKVLILGAGTLGCNIARCLIGWGVRHISFLDNSTVSYNNPVRQSLSEFEDARLGRGKAETAQAAIQRIFPSIQATAHRLTVPMPGHSID--EKDVPELEKDIAKLEQLVKDHDVVFLALDSREARWLPTVLASRHKKIAISVAIGFDTYVIIRHGIG---------------SRSESVSDVSSSDSVPYSQLSCYFCSDVTAPGNSTFDRTLDQQCTVARPGTSMIASGIAVELLSSVLQYPDPLKTP--ASHD--DNTTVLGAAPHQIRGFLGRFQQILPSVKRFDQCVACGDAIAAQFQQNGWKFVRDVMNSPGRLEEVTGLDELQNSVN 635          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Fly
Match: Atg7 (gene:FBgn0034366 transcript:FBtr0086712)

HSP 1 Score: 453.751 bits (1166), Expect = 1.554e-149
Identity = 279/709 (39.35%), Postives = 406/709 (57.26%), Query Frame = 2
Query:   89 LIKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSS----FVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIF--LEENGLRLNHFCHFDIENKD-CVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSD-IKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSV--NKVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGK-------KAAVDASRDNFDFV--SCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDLQ--NS--IDFDCVT-AFTDSDDD 2140
            +++F+P++S V  +FWH LA  KL+  +LS+   +I G++ +     S     +   ++ + +    F H  I    G ++  NT E+F   +K++ L   G K++L ++ +G  L+ PS + +F++L++ DLK ++++YWFAFP P   + P LK +  +       N       L  +      Q FF ++  +E+N          D +N + C  GF DPS + ++P W +R    A      P    + ++ L  R++   +I  +    V+  E    DL+ S+ IKFVGWE  +N  + PR   M  SM+P KLAEN+V+LNLKLMKWRL+PDL+LE IS+ KCLLFG GTLGC VAR LL+W   HITL+D+  V +SNPVRQ L+ + D+V  N++ KA  A + LKEI P A   GY L +PMPGH +   E+ ++  +E    I  LV +HDVIFLL D+RE+RW P++LG    K+VINAALGFD+YLVMRHG   +               GD   E+     + GD+LGCYFC DV  P NS KDR++DQQCTVTRPGVS IAA+ AVEL+V+LLQH   +       ++    S +  + V    LG  PH IRG +  + ++ P  +    C ACS  VL++Y +EG  FL K F+   +LE++ G+ + +  NS  IDFD      +DSD+D
Sbjct:    8 ILQFAPWESFVSPTFWHKLAELKLDHDRLSDSKRSITGHYTN--RNASGCLLEVDYTAYNRMAKPPKFSHSAI----GTIYNKNTIEEFKALDKLQLLADEG-KELLADMCSGGALRDPSLLTRFFVLSFADLKCHSYYYWFAFPCP---LTPTLKLQGAVQKLRDLPNSSSYIMAL--KALPTESQNFFILYANVEKNIFEARSLSSLDDKNVEFCYFGFADPS-EYEHPAWIMRNYA-AFLLQQCPSFVGKPLKFLGLRHNQQMNIDDSLVWKVIQTE--ACDLSQSENIKFVGWELNKNGKMGPRMVCMRDSMDPAKLAENSVNLNLKLMKWRLVPDLNLEIISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNRM-KATTAAQRLKEINPSAETAGYVLEIPMPGHTI--GESLLAQTKEHLKVIEKLVQDHDVIFLLTDSRESRWLPTLLGAAKEKIVINAALGFDSYLVMRHGTTRKEA-------------GDDGQEIEGLKCINGDQLGCYFCNDVTAPGNSLKDRTLDQQCTVTRPGVSNIAASYAVELLVALLQHPRKELAPAYYAQSGRGRSEETEEKVPEGLLGILPHSIRGMLCNYENILPATQKFAQCIACSAAVLNEYKKEGHAFLFKTFETAKFLEDLTGISEFKRLNSEIIDFDDEEFDMSDSDED 684          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Fly
Match: Atg7 (gene:FBgn0034366 transcript:FBtr0086711)

HSP 1 Score: 375.17 bits (962), Expect = 2.052e-121
Identity = 207/431 (48.03%), Postives = 272/431 (63.11%), Query Frame = 2
Query:  902 IELTGIDLTTSD-IKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSV--NKVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGK-------KAAVDASRDNFDFV--SCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDLQ--NS--IDFDCVT-AFTDSDDD 2140
            I+    DL+ S+ IKFVGWE  +N  + PR   M  SM+P KLAEN+V+LNLKLMKWRL+PDL+LE IS+ KCLLFG GTLGC VAR LL+W   HITL+D+  V +SNPVRQ L+ + D+V  N++ KA  A + LKEI P A   GY L +PMPGH +   E+ ++  +E    I  LV +HDVIFLL D+RE+RW P++LG    K+VINAALGFD+YLVMRHG   +               GD   E+     + GD+LGCYFC DV  P NS KDR++DQQCTVTRPGVS IAA+ AVEL+V+LLQH   +       ++    S +  + V    LG  PH IRG +  + ++ P  +    C ACS  VL++Y +EG  FL K F+   +LE++ G+ + +  NS  IDFD      +DSD+D
Sbjct:   96 IQTEACDLSQSENIKFVGWELNKNGKMGPRMVCMRDSMDPAKLAENSVNLNLKLMKWRLVPDLNLEIISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNRM-KATTAAQRLKEINPSAETAGYVLEIPMPGHTIG--ESLLAQTKEHLKVIEKLVQDHDVIFLLTDSRESRWLPTLLGAAKEKIVINAALGFDSYLVMRHGTTRKEA-------------GDDGQEIEGLKCINGDQLGCYFCNDVTAPGNSLKDRTLDQQCTVTRPGVSNIAASYAVELLVALLQHPRKELAPAYYAQSGRGRSEETEEKVPEGLLGILPHSIRGMLCNYENILPATQKFAQCIACSAAVLNEYKKEGHAFLFKTFETAKFLEDLTGISEFKRLNSEIIDFDDEEFDMSDSDED 510          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Fly
Match: Uba4 (gene:FBgn0032054 transcript:FBtr0079683)

HSP 1 Score: 51.2174 bits (121), Expect = 3.140e-6
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 2
Query: 1070 LIPDLDLE---KISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVNKAEQAEKSLKEIYPHANVKGYT 1339
            ++PD  ++   K+  +  L+ G+G LGC  A+ L A    H+ L+D   V  SN  RQ L   ED    ++KAE A  +L E+ PH  ++ ++
Sbjct:   77 ILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHS-EDRCG-MSKAESARIALLELNPHCEIQCHS 167          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Fly
Match: Uba4 (gene:FBgn0032054 transcript:FBtr0333414)

HSP 1 Score: 51.2174 bits (121), Expect = 3.140e-6
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 2
Query: 1070 LIPDLDLE---KISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVNKAEQAEKSLKEIYPHANVKGYT 1339
            ++PD  ++   K+  +  L+ G+G LGC  A+ L A    H+ L+D   V  SN  RQ L   ED    ++KAE A  +L E+ PH  ++ ++
Sbjct:   77 ILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHS-EDRCG-MSKAESARIALLELNPHCEIQCHS 167          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Fly
Match: Uba4 (gene:FBgn0032054 transcript:FBtr0333413)

HSP 1 Score: 51.2174 bits (121), Expect = 3.140e-6
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 2
Query: 1070 LIPDLDLE---KISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVNKAEQAEKSLKEIYPHANVKGYT 1339
            ++PD  ++   K+  +  L+ G+G LGC  A+ L A    H+ L+D   V  SN  RQ L   ED    ++KAE A  +L E+ PH  ++ ++
Sbjct:   77 ILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHS-EDRCG-MSKAESARIALLELNPHCEIQCHS 167          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Zebrafish
Match: atg7 (ATG7 autophagy related 7 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-030131-1633])

HSP 1 Score: 444.891 bits (1143), Expect = 1.619e-145
Identity = 262/687 (38.14%), Postives = 388/687 (56.48%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFL---EENGLR---LNHFCHFDIENKDCVLGFCDP-SLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLT---TSDIKFVGWEKYRNQDLPRCAKMASS-MNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-------APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S ++  FWH L ++KL EY+L E P  I G + +   VG   R  +   +F+             G L+  NT E F + +K   L+   + +I   I++G  L+  S + +F LLT+ DLKKY+F+YWF FPA  F    +L      L+Q     ++      +D L           FL    E  +    L     F  + K  +        L P++PGWPLR +L  ++      ++   + VLC+R+  +  +R  + S +  + L+    +   T+DI  + WEK  +      A   S     ++LAE++VDLNLKLM+WRL+P LDLEK+   +CLL G GTLGC+VAR L+ W V HIT +DN+ +SYSNPVRQ L+++ED + K +KA  A   LK+I+P  N +G+ +S+PMPGHP+   + +V+  ++D  ++  L++EHDV+FLL+DTRE+RW P+V+     KL++NAALGFDT++VMRHG+          P  + SS  S   PA  + A     + +PG  LGCYFC DVV P +ST+DR++DQQCTV+RPG++MIA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQI   +S   +V  +           ++VL+ Y  EGF+FL KVF+    +LE++ GL  L  
Sbjct:   15 LQFAPFCSALEAGFWHQLTQKKLNEYRLDESPKNIKGYYYNGDAVGLPARLTLEFSAFDADGPTPARCCPASGTLYNTNTLEAFKSTDKKALLDK-AANEIWSAIQSGAALEDSSILNKFILLTFADLKKYHFYYWFCFPALCFVEGIQLLRAPLSLEQHFSDKQISSLQSAYDNLCASSGTTAVPHFLLKYSEESVEVAPLKELNSFFPDLKRVIYSTSHQCGLLPQHPGWPLRNLLVLLAKKWA--SQLDVVEVLCFRDRTLQGVRSVQHSIIFQLRLSDPAPSAAPTTDIN-IHWEKMIHSIQGNSAFFVSECQGKVRLAESSVDLNLKLMRWRLVPALDLEKVVSTRCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGK-SKALAAVDRLKKIFPGVNAEGFNMSIPMPGHPVNFSDLTVAQAQQDVEQLKKLISEHDVVFLLMDTRESRWLPTVIAASQRKLIVNAALGFDTFVVMRHGLKKPRESEESSPMSASSSSSSSNTPAATVTAGSSLFSNIPGHRLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAMIAGALAVELMVSVLQHPEGGYAVASSSDDRMNEPPTSLGLVPHQIVPLLSNVTNVLKYEMFWRKVIKSLKQVLENYEREGFQFLAKVFNSSHSFLEDLTGLTLLHQ 696          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Zebrafish
Match: atg7 (ATG7 autophagy related 7 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-030131-1633])

HSP 1 Score: 191.43 bits (485), Expect = 7.081e-56
Identity = 98/205 (47.80%), Postives = 139/205 (67.80%), Query Frame = 2
Query: 1322 NVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQP--------GVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNFDF-VSCLGTTPHQ 1909
            N +G+ +S+PMPGHP+   + +V+  ++D  ++  L++EHDV+FLL+DTRE+RW P+V+     KL++NAALGFDT++VMRHG+  +P          + SS  S   PA  + A     + +PG  LGCYFC DVV P +ST+DR++DQQCTV+RPG++MIA ALAVELMVS+LQH +G  A   +S D  +   + LG  PHQ
Sbjct:    1 NAEGFNMSIPMPGHPVNFSDLTVAQAQQDVEQLKKLISEHDVVFLLMDTRESRWLPTVIAASQRKLIVNAALGFDTFVVMRHGLK-KPRESEESSPMSASSSSSSSNTPAATVTAGSSLFSNIPGHRLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAMIAGALAVELMVSVLQHPEGGYAVASSSDDRMNEPPTSLGLVPHQ 204          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Zebrafish
Match: atg7 (ATG7 autophagy related 7 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-030131-1633])

HSP 1 Score: 123.635 bits (309), Expect = 4.520e-33
Identity = 56/98 (57.14%), Postives = 73/98 (74.49%), Query Frame = 2
Query: 1022 LAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVNKAEQAEKSLKEIYP 1315
            LAE++VDLNLKLM+WRL+P LDLEK+   +CLL G GTLGC+VAR L+ W V HIT +DN+ +SYSNPVRQ L+++ED +        +E+SLK   P
Sbjct:    2 LAESSVDLNLKLMRWRLVPALDLEKVVSTRCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCL--------SEESLKRSPP 91          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Zebrafish
Match: atg7 (ATG7 autophagy related 7 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-030131-1633])

HSP 1 Score: 123.635 bits (309), Expect = 9.816e-31
Identity = 80/280 (28.57%), Postives = 131/280 (46.79%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFL---EENGLR---LNHFCHFDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELT 913
            ++F+PF S ++  FWH L ++KL EY+L E P  I G + +   VG   R  +   +F+             G L+  NT E F + +K   L+   + +I   I++G  L+  S + +F LLT+ DLKKY+F+YWF FPA  F    +L      L+Q     ++      +D L           FL    E  +    L     F  + K   +G  DP   P++PGWPLR +L  ++      ++   + VLC+R+  +  +R  + S +  + L+
Sbjct:    8 LQFAPFCSALEAGFWHQLTQKKLNEYRLDESPKNIKGYYYNGDAVGLPARLTLEFSAFDADGPTPARCCPASGTLYNTNTLEAFKSTDKKALLDK-AANEIWSAIQSGAALEDSSILNKFILLTFADLKKYHFYYWFCFPALCFVEGIQLLRAPLSLEQHFSDKQISSLQSAYDNLCASSGTTAVPHFLLKYSEESVEVAPLKELNSFFPDLKRVAVGVYDPCTLPQHPGWPLRNLLVLLAKKWA--SQLDVVEVLCFRDRTLQGVRSVQHSIIFQLRLS 284          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Mouse
Match: Atg7 (autophagy related 7 [Source:MGI Symbol;Acc:MGI:1921494])

HSP 1 Score: 498.434 bits (1282), Expect = 1.923e-166
Identity = 276/681 (40.53%), Postives = 398/681 (58.44%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFL---EENGLRLNHFCH----FDIENKDCVLGFCDPSLDPKYPGWPLR--IILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S +D  FWH L ++KL EY+L E P  I G + +  + G   R  +   +F+ S+    +     G L   NT E F   +K   L    + +I E IK+G  L++P  + +F LLT+ DLKKY+F+YWF  PA   P +  L      LDQ     ++      +D L           FL   +++ + ++   H    F  +     +G  DP    +YPGWPLR  ++L A   +       +++ VLC+R+  +   R    S +  ++L  +  +    K VGWEK +   + PR   ++  M+P +LAE++VDLNLKLM WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V H+T +DN+ +SYSNPVRQ L+++ED +     KA  A + L++I+P  N +G+ +S+PMPGHP+   + ++     D  ++  L+  HDVIFLL+DTRE+RW P+V+     KLVINAALGFDT++VMRHG+  P+   +     S      DL + L     +PG +LGCYFC DVV P +ST+DR++DQQCTV+RPG+++IA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS KVLDQY  EGF FL KVF+    +LE++ GL  L  
Sbjct:    9 LQFAPFNSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPTRLTLEFSAFDMSASTPAHCCPAMGTLHNTNTLEAFKTADKKLLLEQ-SANEIWEAIKSGAALENPMLLNKFLLLTFADLKKYHFYYWFCCPALCLPESIPLIRGPVSLDQRLSPKQIQALEHAYDDLCRAEGVTALPYFLFKYDDDTVLVSLLKHYSDFFQGQRTKITVGVYDPCNLAQYPGWPLRNFLVLAAHRWS----GSFQSVEVLCFRDRTMQGARDVTHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSGCMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHVTFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAAERLQKIFPGVNARGFNMSIPMPGHPVNFSDVTMEQARRDVEQLEQLIDNHDVIFLLMDTRESRWLPTVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFA--NIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSPKVLDQYEREGFTFLAKVFNSSHSFLEDLTGLTLLHQ 682          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Mouse
Match: Atg7 (autophagy related 7 [Source:MGI Symbol;Acc:MGI:1921494])

HSP 1 Score: 498.434 bits (1282), Expect = 1.923e-166
Identity = 276/681 (40.53%), Postives = 398/681 (58.44%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFL---EENGLRLNHFCH----FDIENKDCVLGFCDPSLDPKYPGWPLR--IILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S +D  FWH L ++KL EY+L E P  I G + +  + G   R  +   +F+ S+    +     G L   NT E F   +K   L    + +I E IK+G  L++P  + +F LLT+ DLKKY+F+YWF  PA   P +  L      LDQ     ++      +D L           FL   +++ + ++   H    F  +     +G  DP    +YPGWPLR  ++L A   +       +++ VLC+R+  +   R    S +  ++L  +  +    K VGWEK +   + PR   ++  M+P +LAE++VDLNLKLM WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V H+T +DN+ +SYSNPVRQ L+++ED +     KA  A + L++I+P  N +G+ +S+PMPGHP+   + ++     D  ++  L+  HDVIFLL+DTRE+RW P+V+     KLVINAALGFDT++VMRHG+  P+   +     S      DL + L     +PG +LGCYFC DVV P +ST+DR++DQQCTV+RPG+++IA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS KVLDQY  EGF FL KVF+    +LE++ GL  L  
Sbjct:    9 LQFAPFNSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPTRLTLEFSAFDMSASTPAHCCPAMGTLHNTNTLEAFKTADKKLLLEQ-SANEIWEAIKSGAALENPMLLNKFLLLTFADLKKYHFYYWFCCPALCLPESIPLIRGPVSLDQRLSPKQIQALEHAYDDLCRAEGVTALPYFLFKYDDDTVLVSLLKHYSDFFQGQRTKITVGVYDPCNLAQYPGWPLRNFLVLAAHRWS----GSFQSVEVLCFRDRTMQGARDVTHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSGCMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHVTFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAAERLQKIFPGVNARGFNMSIPMPGHPVNFSDVTMEQARRDVEQLEQLIDNHDVIFLLMDTRESRWLPTVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFA--NIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSPKVLDQYEREGFTFLAKVFNSSHSFLEDLTGLTLLHQ 682          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Mouse
Match: Atg7 (autophagy related 7 [Source:MGI Symbol;Acc:MGI:1921494])

HSP 1 Score: 498.434 bits (1282), Expect = 1.923e-166
Identity = 276/681 (40.53%), Postives = 398/681 (58.44%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFL---EENGLRLNHFCH----FDIENKDCVLGFCDPSLDPKYPGWPLR--IILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S +D  FWH L ++KL EY+L E P  I G + +  + G   R  +   +F+ S+    +     G L   NT E F   +K   L    + +I E IK+G  L++P  + +F LLT+ DLKKY+F+YWF  PA   P +  L      LDQ     ++      +D L           FL   +++ + ++   H    F  +     +G  DP    +YPGWPLR  ++L A   +       +++ VLC+R+  +   R    S +  ++L  +  +    K VGWEK +   + PR   ++  M+P +LAE++VDLNLKLM WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V H+T +DN+ +SYSNPVRQ L+++ED +     KA  A + L++I+P  N +G+ +S+PMPGHP+   + ++     D  ++  L+  HDVIFLL+DTRE+RW P+V+     KLVINAALGFDT++VMRHG+  P+   +     S      DL + L     +PG +LGCYFC DVV P +ST+DR++DQQCTV+RPG+++IA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS KVLDQY  EGF FL KVF+    +LE++ GL  L  
Sbjct:    9 LQFAPFNSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPTRLTLEFSAFDMSASTPAHCCPAMGTLHNTNTLEAFKTADKKLLLEQ-SANEIWEAIKSGAALENPMLLNKFLLLTFADLKKYHFYYWFCCPALCLPESIPLIRGPVSLDQRLSPKQIQALEHAYDDLCRAEGVTALPYFLFKYDDDTVLVSLLKHYSDFFQGQRTKITVGVYDPCNLAQYPGWPLRNFLVLAAHRWS----GSFQSVEVLCFRDRTMQGARDVTHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSGCMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHVTFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAAERLQKIFPGVNARGFNMSIPMPGHPVNFSDVTMEQARRDVEQLEQLIDNHDVIFLLMDTRESRWLPTVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFA--NIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSPKVLDQYEREGFTFLAKVFNSSHSFLEDLTGLTLLHQ 682          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Mouse
Match: Atg7 (autophagy related 7 [Source:MGI Symbol;Acc:MGI:1921494])

HSP 1 Score: 497.664 bits (1280), Expect = 1.284e-165
Identity = 276/681 (40.53%), Postives = 398/681 (58.44%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFL---EENGLRLNHFCH----FDIENKDCVLGFCDPSLDPKYPGWPLR--IILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S +D  FWH L ++KL EY+L E P  I G + +  + G   R  +   +F+ S+    +     G L   NT E F   +K   L    + +I E IK+G  L++P  + +F LLT+ DLKKY+F+YWF  PA   P +  L      LDQ     ++      +D L           FL   +++ + ++   H    F  +     +G  DP    +YPGWPLR  ++L A   +       +++ VLC+R+  +   R    S +  ++L  +  +    K VGWEK +   + PR   ++  M+P +LAE++VDLNLKLM WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V H+T +DN+ +SYSNPVRQ L+++ED +     KA  A + L++I+P  N +G+ +S+PMPGHP+   + ++     D  ++  L+  HDVIFLL+DTRE+RW P+V+     KLVINAALGFDT++VMRHG+  P+   +     S      DL + L     +PG +LGCYFC DVV P +ST+DR++DQQCTV+RPG+++IA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS KVLDQY  EGF FL KVF+    +LE++ GL  L  
Sbjct:   52 LQFAPFNSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPTRLTLEFSAFDMSASTPAHCCPAMGTLHNTNTLEAFKTADKKLLLEQ-SANEIWEAIKSGAALENPMLLNKFLLLTFADLKKYHFYYWFCCPALCLPESIPLIRGPVSLDQRLSPKQIQALEHAYDDLCRAEGVTALPYFLFKYDDDTVLVSLLKHYSDFFQGQRTKITVGVYDPCNLAQYPGWPLRNFLVLAAHRWS----GSFQSVEVLCFRDRTMQGARDVTHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSGCMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHVTFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAAERLQKIFPGVNARGFNMSIPMPGHPVNFSDVTMEQARRDVEQLEQLIDNHDVIFLLMDTRESRWLPTVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFA--NIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSPKVLDQYEREGFTFLAKVFNSSHSFLEDLTGLTLLHQ 725          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Mouse
Match: Atg7 (autophagy related 7 [Source:MGI Symbol;Acc:MGI:1921494])

HSP 1 Score: 456.833 bits (1174), Expect = 1.085e-150
Identity = 262/681 (38.47%), Postives = 380/681 (55.80%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFL---EENGLRLNHFCH----FDIENKDCVLGFCDPSLDPKYPGWPLR--IILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S +D  FWH L ++KL EY+L E P  I G + +  + G   R  +   +F+ S+    +     G L   NT E F   +K   L    + +I E IK+G  L++P  + +F LLT+ DLKKY+F+YWF  PA   P +  L      LDQ     ++      +D L           FL   +++ + ++   H    F  +     +G  DP    +YPGWPLR  ++L A   +       +++ VLC+R+  +   R    S +  ++L  +  +    K VGWEK +   + PR   ++  M+P +LAE++VDLNLKLM WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V H+T +DN+ +SYSNPVRQ L+++ED +     KA  A + L++I+P  N +G+ +S+PMPGHP+   + ++     D  ++  L+  HDVIFLL+DTRE+RW P+V+     KLVINAALGFDT++VMRHG+  P+   +     S      DL + L     +PG +LGCYFC DVV P +ST+DR++DQQCTV+RPG+++IA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQ                           VLDQY  EGF FL KVF+    +LE++ GL  L  
Sbjct:    9 LQFAPFNSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPTRLTLEFSAFDMSASTPAHCCPAMGTLHNTNTLEAFKTADKKLLLEQ-SANEIWEAIKSGAALENPMLLNKFLLLTFADLKKYHFYYWFCCPALCLPESIPLIRGPVSLDQRLSPKQIQALEHAYDDLCRAEGVTALPYFLFKYDDDTVLVSLLKHYSDFFQGQRTKITVGVYDPCNLAQYPGWPLRNFLVLAAHRWS----GSFQSVEVLCFRDRTMQGARDVTHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSGCMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHVTFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAAERLQKIFPGVNARGFNMSIPMPGHPVNFSDVTMEQARRDVEQLEQLIDNHDVIFLLMDTRESRWLPTVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFA--NIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQ---------------------------VLDQYEREGFTFLAKVFNSSHSFLEDLTGLTLLHQ 655          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. UniProt/SwissProt
Match: sp|O95352|ATG7_HUMAN (Ubiquitin-like modifier-activating enzyme ATG7 OS=Homo sapiens OX=9606 GN=ATG7 PE=1 SV=1)

HSP 1 Score: 502.671 bits (1293), Expect = 3.782e-167
Identity = 276/681 (40.53%), Postives = 403/681 (59.18%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQM---FFTIFLEENGLRLNHFCH----FDIENKDCVLGFCDPSLDPKYPGWPLR--IILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S +D  FWH L ++KL EY+L E P  I G + +  + G   R  +   +F+ S+          G L+  NT E F   +K   L    + +I E+IK+G  L++P  + +F LLT+ DLKKY+F+YWF +PA   P +  L +    LDQ     +++     +D L +        +F I  +EN + ++   H    F  +     +G  DP    +YPGWPLR  ++L A   +    +  +++ V+C+R+  +   R    S +  ++L  +  +    K VGWEK +   + PR   ++  M+P +LAE++VDLNLKLM WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V HIT +DN+ +SYSNPVRQ L+++ED +     KA  A   L++I+P  N +G+ +S+PMPGHP+     ++     D  ++  L+  HDV+FLL+DTRE+RW P+V+     KLVINAALGFDT++VMRHG+  P+   +     +    + DL       N +PG +LGCYFC DVV P +ST+DR++DQQCTV+RPG+++IA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS KVLDQY  EGF FL KVF+    +LE++ GL  L  
Sbjct:   13 LQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQ-AANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEALECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQYPGWPLRNFLVLAAHRWS----SSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADRLQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFAN-IPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQ 687          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. UniProt/SwissProt
Match: sp|Q5ZKY2|ATG7_CHICK (Ubiquitin-like modifier-activating enzyme ATG7 OS=Gallus gallus OX=9031 GN=ATG7 PE=2 SV=1)

HSP 1 Score: 501.901 bits (1291), Expect = 7.159e-167
Identity = 284/679 (41.83%), Postives = 405/679 (59.65%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFL---EENGLRLNHFCHFDI----ENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S ++  FWH L ++KL EY+L E P  I G + +    G   R  +   +F+ ++ +        G L+  NT E F + +K   L    + +I E+IK+G  L++P  + +F LLT+ DLKKY+F+YWF +PA  FP    + ++   L      N++    K +D+L +      F  FL    +N + ++    +D     +     +G  DP     YPGWPLR  L   S      N  +++ VLC+R+  +  +R    S +  I+L          K VGWEK +   + PR   ++  M+P +LAE++VDLNLKLM WRL+P LDLEKI  AKCLL G GTLGC VAR L+ W V  IT +DN+ +SYSNPVRQ L+++ED ++    KA  A + L++I+P  N +GY +S+PMPGHP+   E +++   +D   +  L+  HDV+FLL+DTRE+RW P+V+     KLVINAALGFDT++VMRHG+  P+   + ++ FS A    DL       N +PG +LGCYFC DVV P +ST+DR++DQQCTV+RPG++MIA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS KVLDQY  EGF FL KVF+    +LE++ GL  L  
Sbjct:   19 LQFAPFSSALNVGFWHELTQKKLNEYRLDETPKVIKGYYYNGDPSGFPARLTLEYSAFDINASIPARCCPAFGTLYNTNTFETFKSCDKKSLLEK-EANEIWESIKSGAALENPMLLNRFLLLTFADLKKYHFYYWFCYPALCFPDGIHVIQKPVCLGDRFSLNQIQALQKAYDELCQTEGVTAFPYFLIKYHDNSVVVSPLKKWDGFFQDQGGKVTVGVYDPCNLSHYPGWPLRNFLILASHKW--GNILQSIEVLCFRDRTMQGVRDITHSIIFEIKLPQGAFGPDCPKAVGWEKNQKGGMGPRVVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLEKIVSAKCLLLGAGTLGCSVARTLMGWGVRKITFVDNARISYSNPVRQPLYEFEDCLSGGKPKALAAAERLQKIFPGVNSEGYNMSIPMPGHPVNFSEVTMAQARKDVATLEELIDAHDVVFLLMDTRESRWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQETGNACFSTAPGPSDLLGSSLFSN-IPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAMIAGALAVELMVSVLQHPEGGYAVASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSPKVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQ 693          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. UniProt/SwissProt
Match: sp|Q9D906|ATG7_MOUSE (Ubiquitin-like modifier-activating enzyme ATG7 OS=Mus musculus OX=10090 GN=Atg7 PE=1 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 1.345e-165
Identity = 276/681 (40.53%), Postives = 398/681 (58.44%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFL---EENGLRLNHFCH----FDIENKDCVLGFCDPSLDPKYPGWPLR--IILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S +D  FWH L ++KL EY+L E P  I G + +  + G   R  +   +F+ S+    +     G L   NT E F   +K   L    + +I E IK+G  L++P  + +F LLT+ DLKKY+F+YWF  PA   P +  L      LDQ     ++      +D L           FL   +++ + ++   H    F  +     +G  DP    +YPGWPLR  ++L A   +       +++ VLC+R+  +   R    S +  ++L  +  +    K VGWEK +   + PR   ++  M+P +LAE++VDLNLKLM WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V H+T +DN+ +SYSNPVRQ L+++ED +     KA  A + L++I+P  N +G+ +S+PMPGHP+   + ++     D  ++  L+  HDVIFLL+DTRE+RW P+V+     KLVINAALGFDT++VMRHG+  P+   +     S      DL + L     +PG +LGCYFC DVV P +ST+DR++DQQCTV+RPG+++IA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS KVLDQY  EGF FL KVF+    +LE++ GL  L  
Sbjct:    9 LQFAPFNSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPTRLTLEFSAFDMSASTPAHCCPAMGTLHNTNTLEAFKTADKKLLLEQ-SANEIWEAIKSGAALENPMLLNKFLLLTFADLKKYHFYYWFCCPALCLPESIPLIRGPVSLDQRLSPKQIQALEHAYDDLCRAEGVTALPYFLFKYDDDTVLVSLLKHYSDFFQGQRTKITVGVYDPCNLAQYPGWPLRNFLVLAAHRWS----GSFQSVEVLCFRDRTMQGARDVTHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSGCMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHVTFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAAERLQKIFPGVNARGFNMSIPMPGHPVNFSDVTMEQARRDVEQLEQLIDNHDVIFLLMDTRESRWLPTVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFA--NIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSPKVLDQYEREGFTFLAKVFNSSHSFLEDLTGLTLLHQ 682          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. UniProt/SwissProt
Match: sp|Q641Y5|ATG7_RAT (Ubiquitin-like modifier-activating enzyme ATG7 OS=Rattus norvegicus OX=10116 GN=Atg7 PE=2 SV=1)

HSP 1 Score: 494.967 bits (1273), Expect = 3.401e-164
Identity = 275/681 (40.38%), Postives = 397/681 (58.30%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFL---EENGLRLNHFCH----FDIENKDCVLGFCDPSLDPKYPGWPLR--IILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S +D  FWH L ++KL EY+L E P  I G + +  + G   R  +   +F+ S+          G L   NT E F   +K   L    + +I E IK+G  L++P  + +F LLT+ DLKKY+F+YWF  PA   P +  L      LDQ     ++      +D L           FL   +++ + ++   H    F  +     +G  DP    ++PGWPLR  ++L A   +       +++ VLC+R+  +   R    S +  ++L  +  +    K VGWEK +   + PR   ++  M+P +LAE++VDLNLKLM WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V H+T +DN+ +SYSNPVRQ L+++ED +     KA  A + L++I+P  N  G+ +S+PMPGHP+   + ++     D  ++  L+  HDVIFLL+DTRE+RW P+V+     KLVINAALGFDT++VMRHG+  P+   +     S      DL + L     +PG +LGCYFC DVV P +ST+DR++DQQCTV+RPG+++IA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS KVLDQY +EGF FL KVF+    +LE++ GL  L  
Sbjct:    9 LQFAPFNSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPTRLTLEFSAFDMSAPTPARCCPAMGTLHNTNTLEAFKTADKKLLLEQ-SANEIWEAIKSGAALENPMLLNKFLLLTFADLKKYHFYYWFCCPALCLPESIPLIRGPVGLDQRLSPKQIQALEHAYDDLCRTEGVTALPYFLFKYDDDTVLVSLLKHYSDFFQGQRTKLTVGVYDPCNLTQHPGWPLRNFLVLAAHRWS----GSFQSVEVLCFRDRTMQGARDVTHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSGCMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHVTFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAAERLQKIFPGVNASGFNMSIPMPGHPVNFSDVTMEQARRDVEQLEELIDSHDVIFLLMDTRESRWLPTVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFA--NIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEQEGFTFLAKVFNSSHSFLEDLTGLTLLHQ 682          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. UniProt/SwissProt
Match: sp|Q86CR9|ATG7_DICDI (Ubiquitin-like modifier-activating enzyme atg7 OS=Dictyostelium discoideum OX=44689 GN=atg7 PE=3 SV=1)

HSP 1 Score: 461.455 bits (1186), Expect = 4.463e-151
Identity = 276/703 (39.26%), Postives = 397/703 (56.47%), Query Frame = 2
Query:   86 NLIKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHV-------YNVGSANRFMIG--MESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPA--PRFPVN--PELKEEIELLDQATFKNEV-DQFF--KLFDQLQEQHHQMFFTIF--LEENGLRLNHFCHFDIENKDC-VLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGI-----------DLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNFDFVSC-LGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDLQNS 2095
            N ++F  F S V+ SFWH L+ +KL+E KLSE    + G++          +     N F+      S E    + P  Y   G L+  NT +DF    K++  N   SK+I  +I NG   K  S + +F LLTY D+K + F+Y F  PA  P  P+    E  E I +    +F N++  Q+F  K   Q         F +   +EE G   N + +  +EN    ++GFCDP   P  PGWPLR  L  +S     P  K+ ++VLCYR +       T +S +L++EL  +           D      K VGWEK  N  + PR   +AS+M+PLKLAE +VDLNLKLM+WR++P L+LEKI    CLL G GTLGC+VAR L++W V +IT +D+S VSYSNPVRQ+LF + D   K   K+  A  +LK+I+P  N   +  S+PMPGH + + E    S+      + NL+ +HDVI+LL D+RE+RW P++L   HGKL INAALGFD+YLV+RHG+  Q                +L   +       G +LGCYFC DV+ P+++ KDR++DQ CTVTRPG+SM+A+++AVEL++S + H  G +A  +   D +   S  LG  PHQ+RG+IS + ++  F     HCTACS  ++D+Y  +GF+F++ V +D   L ++ G+ DL+N+
Sbjct:    3 NTLQFKEFSSFVNISFWHELSNKKLDELKLSEESIPLNGHYTFSPSQQLDPFLCLEFNAFLRNNVTNSTENQYVLPPRSYLSHGTLYNYNTVDDFKQSPKIKLFND-ASKRIWNDINNGNIDKDTSLLNRFILLTYADIKNHQFYYMFGIPALLPSQPIQQFTEKPESINIESLKSFSNQILPQYFCLKQQQQESSTTTTTSFELIGSIEEKG---NQYLNECLENDLIPLVGFCDPCSLPLNPGWPLRNFLIYLSIKY--PMLKK-IKVLCYRGN-----GSTSNSILLSLELPSMGEQLIKKQQEEDAGEWSGKSVGWEKDSNGKIAPRFVSLASTMDPLKLAEQSVDLNLKLMRWRVMPSLELEKIKTTSCLLLGSGTLGCNVARSLMSWGVRNITFVDSSKVSYSNPVRQSLFTFADCSPKAKEKSIAAADALKKIFPAINANAHVFSIPMPGHSVPQSE--YQSIRNTIELLENLIKQHDVIYLLTDSRESRWLPTMLSRAHGKLCINAALGFDSYLVIRHGIKDQ-------------CQNELNPSISSKLGYQGSDLGCYFCNDVIAPTDTLKDRTLDQMCTVTRPGLSMMASSIAVELLISTIHHPYGGRAKGETETDVYVQGSTPLGIIPHQLRGFISHYQTLPLFSNPYKHCTACSDYIIDEYNSKGFDFIINVMNDSSCLTKICGIDDLKNT 678          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. TrEMBL
Match: A0A1P8STG9 (Ubiquitin-like modifier-activating enzyme ATG7 OS=Dugesia japonica OX=6161 GN=ATG7 PE=2 SV=2)

HSP 1 Score: 1256.51 bits (3250), Expect = 0.000e+0
Identity = 588/692 (84.97%), Postives = 654/692 (94.51%), Query Frame = 2
Query:   77 MSDNLIKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLEENGLRLNHFCHFDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDLPRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQPGVXXXXXXXXXXXXGDLKAEL--RKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNFDFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDLQNSIDFDCVTAFTDSDDDYS 2146
            M++NLIKFSPFQSLVDGSFWH+LAR+KL+EYKL+EGPYTIYGNFEH+YN+GSANRFMIGMES+EKS F+HPNI+K+KGKL +LNT EDFNN+NKVEFLN FGS+KILENIKNG YLKHP KICQF LLTY DLKK+NFFYWFAFPAPRFPVNPELK EIE LDQA F+NEVDQFF+LFD+LQ+QHH MFFT+FLE+NGL+LNHF HFDIENKDC+LGFCDPS+DPKYPGWPLR ILFAI  TLIPPNEKRT+RVLCYRNH  DS+RQTK+SS+LT+ELTGIDL T+DIKFVGWEKYRNQDLPRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKIS  KCLLFGVGTLGCHVARQLLAWNVN+ITL+DNS+VSYSNPVRQTL+KYEDSV KVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPL +WEN++S VEEDCLKIFNLVA+HDVIFLLLDTREARW P++ GYIH KLVINAALGFDTYLVMRHGVAPQPG+SPS++++K++ +GD+ +++  +KPNY+PGDELGCYFCTDVVGPSNST+DRS+DQQCTVTRPGVSMIAAALAVELMVS+LQHKDG KAAV+A+RDN+DFVSCLG TPHQIRGY+SCFNSV PFHRASIHCTACSQKVLD Y  EGFEFLLKVF+DPDYLEEVAGLK+LQ+SIDFDCVTA TDSDDD+S
Sbjct:    1 MTENLIKFSPFQSLVDGSFWHVLARKKLDEYKLNEGPYTIYGNFEHLYNIGSANRFMIGMESYEKSRFIHPNIFKIKGKLLVLNTCEDFNNRNKVEFLNSFGSQKILENIKNGRYLKHPHKICQFSLLTYADLKKFNFFYWFAFPAPRFPVNPELKGEIEFLDQAAFQNEVDQFFELFDKLQDQHHNMFFTVFLEQNGLKLNHFSHFDIENKDCILGFCDPSIDPKYPGWPLRNILFAICSTLIPPNEKRTIRVLCYRNHFSDSVRQTKTSSILTLELTGIDLQTADIKFVGWEKYRNQDLPRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISSTKCLLFGVGTLGCHVARQLLAWNVNNITLVDNSTVSYSNPVRQTLYKYEDSVKKVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLSQWENNISQVEEDCLKIFNLVADHDVIFLLLDTREARWLPTLFGYIHAKLVINAALGFDTYLVMRHGVAPQPGISPSNQYTKSSASGDVSSKIDKQKPNYIPGDELGCYFCTDVVGPSNSTRDRSMDQQCTVTRPGVSMIAAALAVELMVSILQHKDGNKAAVEANRDNYDFVSCLGATPHQIRGYMSCFNSVIPFHRASIHCTACSQKVLDCYKAEGFEFLLKVFNDPDYLEEVAGLKELQSSIDFDCVTALTDSDDDFS 692          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. TrEMBL
Match: H2KTG7 (Autophagy-related protein 7 OS=Clonorchis sinensis OX=79923 GN=CLF_102997 PE=4 SV=1)

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 319/723 (44.12%), Postives = 443/723 (61.27%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSF--VHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLEE--NGLRLNHFCH---FDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDLPRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEE-----------------------DCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAP---QPGV--XXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKA----AVDASRDNFDFV-SCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDLQNSIDFDCVTAFTDSDD 2137
            + + PF++ VD  FWH+LA++KL+EY+LSEGP+ I   F +    G   R  + + +F  ++   +    Y+++GK+   N+ ++F N  K  F+N  G       +++ EYL+ P K+ +F LLTY DLK Y F++WFA+PA      P L E   LLD+   ++ +      +D  +++H   FF I +E+  NG  L H        +++    L FCDPS    YPGWPLR +LFA+S TL+   +K+ +RV+C+R       R    S +L +EL  +   +S  +FVGWEK  NQ  PR   +++SM+PLKL+E+A+DLNLKLMKWRL+PDL LE + + KCLL G GTLGC+V+RQLLAW V HIT +DN++VS SNPVRQ+LF +ED+ N  + KA  A  +L +I P    +G+ LS+PMPGHP+    N  ++ E                         C ++  L++ HDV+FLL DTRE+RW P++L  +HGKLVINAALGFDTYLVMRHG AP    PG+    +   +     GD    +     + G  LGCYFC DVVGP+NST++RS+DQQCTVTRPGVS+IA+ALAVEL+V++LQH  G  A    ++DA   N   V S  G  PHQIRG++  F +V P   A  HC+ CSQ VLD Y  +GF FLL+VFDD DYLE V GLK+L    + + V A +D+D+
Sbjct:    5 LMYLPFETFVDTGFWHLLAKKKLDEYRLSEGPFAISAEFSNTLAAGLTPRVSVDISAFPDTAVKRITGPTYRMQGKMTTFNSLDEFKNLEKQLFINKCGQAMFKVALEDNEYLRDPEKLMEFQLLTYCDLKHYKFYFWFAYPAVISDPQPVLLES-RLLDEEFSESALSNLLVAYDLWRKEHRSAFFAIKVEKSLNGSTLFHIASCAGMRLDDPHTYLAFCDPSTHRCYPGWPLRNMLFALSATLV--QDKQRLRVVCFRERFYQGQRSCSHSLMLQVELCAVK-GSSFTQFVGWEKCDNQLKPRFVNLSASMDPLKLSESAIDLNLKLMKWRLVPDLRLETVRETKCLLIGAGTLGCNVSRQLLAWGVRHITFVDNANVSLSNPVRQSLFVFEDTKNGGSPKASAAAHALLKISPGVITEGFQLSIPMPGHPVSARSNETATSEVLPNKLGLPVTDLKLPPRVIDSYIACSRLSELISSHDVVFLLTDTRESRWLPTLLANVHGKLVINAALGFDTYLVMRHGRAPPGVSPGIYKKQTHTTTSHTTEGDTSVNIPPKPSIDGGNLGCYFCNDVVGPTNSTQNRSLDQQCTVTRPGVSLIASALAVELLVNILQHPKGPGAPAATSIDALNGNLSPVHSSFGLVPHQIRGFLPYFGNVLPATSAFSHCSGCSQAVLDAYQMDGFRFLLRVFDDADYLELVCGLKELHQQTESNDVIALSDTDE 723          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. TrEMBL
Match: A0A3R7GUF0 (Ubiquitin-like modifier-activating enzyme ATG7 OS=Clonorchis sinensis OX=79923 GN=ATG7 PE=3 SV=1)

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 321/724 (44.34%), Postives = 443/724 (61.19%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSF--VHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLEE--NGLRLNHFCH---FDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDLPRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEE-----------------------DCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQPGVX------XXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKA----AVDASRDNFDFV-SCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDLQNSIDFDCVTAFTDSDD 2137
            + + PF++ VD  FWH+LA++KL+EYKLSEGP+ I   F +    G   R  + + +F  ++   +    Y+++GK+   N+ ++F N  K  F+N  G       +++ EYL+ P K+ +F LLTY DLK Y F++WFA+PA      P L E   LLD+   ++ +      +D  +++H   FF I +E+  NG  L H        +++    L FCDPS    YPGWPLR +LFA+S TL+   +K+ +RV+C+R       R    S +L +EL  +   +S  +FVGWEK  NQ  PR   +++SM+PLKL+E+A+DLNLKLMKWRL+PDL LE + + KCLL G GTLGC+V+RQLLAW V HIT +DN++VS SNPVRQ+LF +ED+ N  + KA  A  +L +I P    +G+ LS+PMPGHP+    N  ++ E                         C ++  L++ HDV+FLL DTRE+RW P++L  +HGKLVINAALGFDTYLVMRHG A  PGVS       +   +     GD    +     + G  LGCYFC DVVGP+NST++RS+DQQCTVTRPGVS+IA+ALAVEL+V++LQH  G  A    ++DA   N   V S  G  PHQIRG++  F +V P   A  HC+ CSQ VLD Y  +GF FLL+VFDD DYLE V GLK+L    + + V A +D+D+
Sbjct:    5 LMYLPFETFVDTGFWHLLAKKKLDEYKLSEGPFAISAEFSNTLAAGLTPRVSVDVSAFPDTAVKRITGPTYRMQGKMTTFNSLDEFKNLEKQLFINKCGQAMFKVALEDNEYLRDPEKLMEFQLLTYCDLKHYKFYFWFAYPAVISDPQPVLLES-RLLDEEFSESALSNLLVAYDLWRKEHRSAFFAIKVEKSLNGSTLFHIASCAGMRLDDPHTYLAFCDPSTHRCYPGWPLRNMLFALSATLV--QDKQRLRVVCFRERFYQGQRSCSHSLMLQVELCAVK-GSSFTQFVGWEKCDNQLKPRFVNLSASMDPLKLSESAIDLNLKLMKWRLVPDLRLETVRETKCLLIGAGTLGCNVSRQLLAWGVRHITFVDNANVSLSNPVRQSLFVFEDTKNGGSPKASAAAHALLKISPGVITEGFQLSIPMPGHPVSARSNETATSEVLPNKLGLPVTDLKLPPRVIDSYIACSRLSELISSHDVVFLLTDTRESRWLPTLLANVHGKLVINAALGFDTYLVMRHGRA-LPGVSPGIYKKQTHTTTSPTTEGDTSVNIPPKPSIDGGNLGCYFCNDVVGPTNSTQNRSLDQQCTVTRPGVSLIASALAVELLVNILQHPKGPGAPAATSIDALNGNLSPVHSSFGLVPHQIRGFLPYFGNVLPATSAFSHCSGCSQAVLDAYQMDGFRFLLRVFDDADYLELVCGLKELHQQTESNDVIALSDTDE 723          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. TrEMBL
Match: A0A1S8WXP9 (E1-like protein-activating enzyme Gsa7p/Apg7p (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_04962 PE=4 SV=1)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 316/719 (43.95%), Postives = 437/719 (60.78%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSF--VHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLEE--NGLRLNHFCH---FDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDLPRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEE-----------------------DCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAP---QPGV--XXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKA----AVDASRDNFDFV-SCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDLQNSIDFDCVTAFT 2125
            + + PF++ VD  FWH+LA++KL+EY+LSEGP+ I   F +    G   R  + + +F  ++   +    Y+++GK+   N+ ++F N  K  F+N  G       +++ EYL+ P K+  F LLTY DLK Y F++WFA+PA      P L     LLD+   ++ + +    +D  +++H   FF I  E+  NG    H        +++    L FCDPS    YPGWPLR +LFA+S TL+   +K+ +RV+C+R       R    S VL +EL  +  ++S  +FVGWEK  NQ  PR   +++SM+PL+L+E+A+DLNLKLMKWRL+PDL LE + + KCLL G GTLGC+V+RQLLAW V HIT +DN++VS SNPVRQ+LF +ED+ N  + KA  A  +L +I P    +G+ LS+PMPGHP+    N  ++ E                         C ++  L++ HDV+FLL DTRE+RW P++L  +HGKLVINAALGFDTYLVMRHG AP    PG+    +   +     GD    +     V G  LGCYFC DVVGP+NST++RS+DQQCTVTRPGVS+IA+ALAVEL+V++LQH  G +A    ++DA   N   V S  G  PHQIRG++  F +V P   A  HC+ CSQ VLD Y  +GF FLL+VFDD DYLE V GLK L    + + V A +
Sbjct:   63 LMYLPFETFVDTGFWHLLAKKKLDEYRLSEGPFGISAEFSNTLAAGLTPRVSVDISAFPDNAVKRITGPAYRIQGKMTTFNSLDEFKNFEKQPFINKCGQAMFKVALEDNEYLRDPEKLMDFQLLTYCDLKHYKFYFWFAYPAVISDPQPVLLGS-RLLDEEFSESALTKLLVAYDLWRQEHRSAFFAIKAEKSMNGSTDFHIVSCAGMRLDDPHIYLAFCDPSTHGCYPGWPLRNMLFALSATLV--QDKQRLRVVCFRERFYQGQRSCNHSLVLQVELCAVK-SSSFTQFVGWEKCDNQLKPRFVNLSASMDPLRLSESAIDLNLKLMKWRLVPDLRLETVRETKCLLIGAGTLGCNVSRQLLAWGVRHITFVDNANVSLSNPVRQSLFVFEDTKNGGSPKASAAAHALLKISPGVTTEGFQLSIPMPGHPVSNRSNGTATSEVLPNKLGLPITDLKLPPRVLDSYIACSRLSELISYHDVVFLLTDTRESRWLPTLLANVHGKLVINAALGFDTYLVMRHGRAPPGVSPGIYKKQTHTTTSPTTEGDTSVHIPPKPSVDGGNLGCYFCNDVVGPTNSTQNRSLDQQCTVTRPGVSLIASALAVELLVNVLQHPKGPEAPAATSIDALNGNPSPVHSSFGLVPHQIRGFLPYFGNVLPATSAFSHCSGCSQAVLDAYQMDGFRFLLRVFDDADYLELVCGLKQLHQQTESNDVIALS 777          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. TrEMBL
Match: A0A075A1I4 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_13374 PE=4 SV=1)

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 314/711 (44.16%), Postives = 433/711 (60.90%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSF--VHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLEE--NGLRLNHFCH---FDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDLPRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEE-----------------------DCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAP---QPGV--XXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKA----AVDASRDNFDFV-SCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDLQNSID 2101
            + + PF++ VD  FWH+LA++KL+EY+LSEGP+ I   F +    G   R  + + +F  ++   +    Y+++GK+   N+ ++F N  K  F+N  G       +++ EYL+ P K+  F LLTY DLK Y F++WFA+PA      P L     LLD+   ++ + +    +D  +++H   FF I  E+  NG    H        +++    L FCDPS    YPGWPLR +LFA+S TL+   +K+ +RV+C+R       R    S VL +EL  +  ++S  +FVGWEK  NQ  PR   +++SM+PL+L+E+A+DLNLKLMKWRL+PDL LE + + KCLL G GTLGC+V+RQLLAW V HIT +DN++VS SNPVRQ+LF +ED+ N  + KA  A  +L +I P    +G+ LS+PMPGHP+    N  ++ E                         C ++  L++ HDV+FLL DTRE+RW P++L  +HGKLVINAALGFDTYLVMRHG AP    PG+    +   +     GD    +     V G  LGCYFC DVVGP+NST++RS+DQQCTVTRPGVS+IA+ALAVEL+V++LQH  G +A    ++DA   N   V S  G  PHQIRG++  F +V P   A  HC+ CSQ VLD Y  +GF FLL+VFDD DYLE V GLK L    +
Sbjct:   63 LMYLPFETFVDTGFWHLLAKKKLDEYRLSEGPFGISAEFSNTLAAGLTPRVSVDISAFPDNAVKRITGPAYRIQGKMTTFNSLDEFKNFEKQPFINKCGQAMFKVALEDNEYLRDPEKLMDFQLLTYCDLKHYKFYFWFAYPAVISDPQPVLLGS-RLLDEEFSESALTKLLVAYDLWRQEHRSAFFAIKAEKSMNGSTDFHIVSCAGMRLDDPHIYLAFCDPSTHGCYPGWPLRNMLFALSATLV--QDKQRLRVVCFRERFYQGQRSCNHSLVLQVELCAVK-SSSFTQFVGWEKCDNQLKPRFVNLSASMDPLRLSESAIDLNLKLMKWRLVPDLRLETVRETKCLLIGAGTLGCNVSRQLLAWGVRHITFVDNANVSLSNPVRQSLFVFEDTKNGGSPKASAAAHALLKISPGVTTEGFQLSIPMPGHPVSNRSNETATSEVLPNKLGLPITDLKLPPRVLDSYIACSRLSELISYHDVVFLLTDTRESRWLPTLLANVHGKLVINAALGFDTYLVMRHGRAPPGVSPGIYKKQTHTTTSPTTEGDTSVHIPPKPSVDGGNLGCYFCNDVVGPTNSTQNRSLDQQCTVTRPGVSLIASALAVELLVNVLQHPKGPEAPAATSIDALNGNPSPVHSSFGLVPHQIRGFLPYFGNVLPATSAFSHCSGCSQAVLDAYQMDGFRFLLRVFDDADYLELVCGLKQLHQQTE 769          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Cavefish
Match: atg7 (autophagy related 7 [Source:NCBI gene;Acc:103035842])

HSP 1 Score: 507.679 bits (1306), Expect = 4.072e-170
Identity = 278/687 (40.47%), Postives = 406/687 (59.10%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFL----EENG--LRLNHFCHFDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVN-KVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGD---------ELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S ++  FWH L ++KL +Y+L E P  I G + +    G   R  +   +F+       +     G L+  NT E F + +K   L+   + +I   IK+G   + P+ + +F LLT+ DLKKY+F+YWF FPA  FP   +L ++  LL+Q     ++  F   +D L           FL    EEN     L  +  F  + K   +G  DP    ++PGWPLR  L  ++    P  +   + VLC+R+  +   R  + S V  + L G+ LT +  K VGWEK     + PR   ++  M+P +LAE++VDLNLKLM+WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V HIT +DN+ +SYSNPVRQ L+++ED ++   +KA  A   L++I+P  N +G+ +S+PMPGHP+   E +++    D  ++  L++ HDV+FLL+DTRE+RW P+V+     KL++NAALGFDT++VMRHG+  P+   + +S  S A+P+    +       VPG           LGCYFC DVV P +ST+DR++DQQCTV+RPG++MIA ALAVE+M+S+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS  VLD Y  EGF+FL KVF+    +LE++ GL  L  
Sbjct:   10 LQFAPFSSALEAGFWHQLTQKKLNDYRLDESPKNIKGYYYNGDPSGLPTRLTLEFSAFDTDGPTPAHCCPAVGTLYNTNTLEAFKSTDKKALLDN-AANEIWNAIKSGAAEEDPTVLTKFILLTFADLKKYHFYYWFCFPALCFPEGIQLVKDPVLLEQKFSAKQISSFQVAYDALCSSSGATAVPYFLLKYSEENVEVALLKDWSSFFTDLKKVTVGVYDPCTLSQHPGWPLRNFLVLLASKWGP--QLDVVEVLCFRDRTLQGARSVQHSIVFQVRLPGLSLTAACPKSVGWEKNPKGAMGPRIVNLSECMDPKRLAESSVDLNLKLMRWRLVPSLDLDKVVSTKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLSGGKSKALAAVDRLRKIFPGVNAEGFNMSIPMPGHPVNFSEVTMAQARRDVEQLEALISAHDVVFLLMDTRESRWLPTVVAASQRKLIVNAALGFDTFVVMRHGLKKPKASDTAASSPSSASPSLSDSSSSSTTPAVPGTSLFSNIPGHRLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAMIAGALAVEMMISILQHPEGGYAVASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPASLAFDKCTACSPVVLDHYEREGFQFLSKVFNSSHSFLEDLTGLTLLHQ 693          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Cavefish
Match: atg7 (autophagy related 7 [Source:NCBI gene;Acc:103035842])

HSP 1 Score: 507.679 bits (1306), Expect = 6.109e-170
Identity = 278/687 (40.47%), Postives = 406/687 (59.10%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFL----EENG--LRLNHFCHFDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVN-KVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGV-APQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGD---------ELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S ++  FWH L ++KL +Y+L E P  I G + +    G   R  +   +F+       +     G L+  NT E F + +K   L+   + +I   IK+G   + P+ + +F LLT+ DLKKY+F+YWF FPA  FP   +L ++  LL+Q     ++  F   +D L           FL    EEN     L  +  F  + K   +G  DP    ++PGWPLR  L  ++    P  +   + VLC+R+  +   R  + S V  + L G+ LT +  K VGWEK     + PR   ++  M+P +LAE++VDLNLKLM+WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V HIT +DN+ +SYSNPVRQ L+++ED ++   +KA  A   L++I+P  N +G+ +S+PMPGHP+   E +++    D  ++  L++ HDV+FLL+DTRE+RW P+V+     KL++NAALGFDT++VMRHG+  P+   + +S  S A+P+    +       VPG           LGCYFC DVV P +ST+DR++DQQCTV+RPG++MIA ALAVE+M+S+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS  VLD Y  EGF+FL KVF+    +LE++ GL  L  
Sbjct:   10 LQFAPFSSALEAGFWHQLTQKKLNDYRLDESPKNIKGYYYNGDPSGLPTRLTLEFSAFDTDGPTPAHCCPAVGTLYNTNTLEAFKSTDKKALLDN-AANEIWNAIKSGAAEEDPTVLTKFILLTFADLKKYHFYYWFCFPALCFPEGIQLVKDPVLLEQKFSAKQISSFQVAYDALCSSSGATAVPYFLLKYSEENVEVALLKDWSSFFTDLKKVTVGVYDPCTLSQHPGWPLRNFLVLLASKWGP--QLDVVEVLCFRDRTLQGARSVQHSIVFQVRLPGLSLTAACPKSVGWEKNPKGAMGPRIVNLSECMDPKRLAESSVDLNLKLMRWRLVPSLDLDKVVSTKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLSGGKSKALAAVDRLRKIFPGVNAEGFNMSIPMPGHPVNFSEVTMAQARRDVEQLEALISAHDVVFLLMDTRESRWLPTVVAASQRKLIVNAALGFDTFVVMRHGLKKPKASDTAASSPSSASPSLSDSSSSSTTPAVPGTSLFSNIPGHRLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAMIAGALAVEMMISILQHPEGGYAVASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPASLAFDKCTACSPVVLDHYEREGFQFLSKVFNSSHSFLEDLTGLTLLHQ 693          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Cavefish
Match: atg7 (autophagy related 7 [Source:NCBI gene;Acc:103035842])

HSP 1 Score: 465.307 bits (1196), Expect = 3.306e-154
Identity = 259/678 (38.20%), Postives = 383/678 (56.49%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFL----EENG--LRLNHFCHFDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLT-TSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNK-VNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            ++F+PF S ++  FWH L ++KL +Y+L E P  I G + +    G   R  +   +F+       +     G L+  NT E F + +K   L+   + +I   IK+G   + P+ + +F LLT+ DLKKY+F+YWF FPA  FP   +L ++  LL+Q     ++  F   +D L           FL    EEN     L  +  F  + K   +G  DP    ++PGWPLR  L  ++    P  +   + VLC+R+  +   R  + S V  + L    L+  +  K VGWEK     + PR   ++  M+P +LAE++VDLNLKLM+WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V HIT +DN+ +SYSNPVRQ L+++ED ++   +KA  A   L++I+P  N +G+ +S+PMPGHP+   E +++    D  ++  L++ HDV+FLL+DTRE+RW P+V+     KL++NAALGFDT++VMRHG+  +P  S ++    +  +            +PG  LGCYFC DVV P +ST+DR++DQQCTV+RPG++MIA ALAVE+M+S+LQH +G  A   +S D   +  + LG  PHQ                           VLD Y  EGF+FL KVF+    +LE++ GL  L  
Sbjct:   10 LQFAPFSSALEAGFWHQLTQKKLNDYRLDESPKNIKGYYYNGDPSGLPTRLTLEFSAFDTDGPTPAHCCPAVGTLYNTNTLEAFKSTDKKALLDN-AANEIWNAIKSGAAEEDPTVLTKFILLTFADLKKYHFYYWFCFPALCFPEGIQLVKDPVLLEQKFSAKQISSFQVAYDALCSSSGATAVPYFLLKYSEENVEVALLKDWSSFFTDLKKVTVGVYDPCTLSQHPGWPLRNFLVLLASKWGP--QLDVVEVLCFRDRTLQGARSVQHSIVFQVRLPAFVLSFIACPKSVGWEKNPKGAMGPRIVNLSECMDPKRLAESSVDLNLKLMRWRLVPSLDLDKVVSTKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLSGGKSKALAAVDRLRKIFPGVNAEGFNMSIPMPGHPVNFSEVTMAQARRDVEQLEALISAHDVVFLLMDTRESRWLPTVVAASQRKLIVNAALGFDTFVVMRHGLK-KPKASDTAASRTSLFSN-----------IPGHRLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAMIAGALAVEMMISILQHPEGGYAVASSSDDRMNEPPTSLGLVPHQ---------------------------VLDHYEREGFQFLSKVFNSSHSFLEDLTGLTLLHQ 645          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Sea Lamprey
Match: atg7 (ATG7 autophagy related 7 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-030131-1633])

HSP 1 Score: 410.994 bits (1055), Expect = 1.183e-134
Identity = 256/637 (40.19%), Postives = 358/637 (56.20%), Query Frame = 2
Query:   92 IKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSS----FVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMF-----FTIFLEENG-LRLNHFCHFDIEN-----KDCVLGFCDPSLDPKYPGWPLR--IILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTT------SDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQ---PG-VXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQI 1912
            ++F PF S +D  FWH L+++K+ EYKL E    + G F +    G   R M+   SF+       F H  + K +  L   NT   F   +K   L+   ++KI E + +G  L+ P+ + QF LLT+ DLKKY+F+YWFAFPA  FP      + I LL+ +           L ++     H  F       IFL   G + L+H       N     +  ++   DP    ++PGWPLR  +IL A +C       K ++ +    N+        K   ++ + L  +          S  K VGWEK +   L PR   ++ SM+P +LAE++VDLNLKLM+WRL+P LDLE +S A+CLL G GTLGC+VAR LL W V HIT +DN+ VSYSNPVRQTL+++ED +     KA+ A + L+ I+P    +G +LS+PMPGH +       ++V E       LV+EHD++FLL+DTRE+RW P+VL     KLVINAALGFDT++VMRHG+      PG    S   + AA    L ++      +PG  LGCYFC DVV P +ST+DR++DQQCTV+RPG++M+A ALAVELMVS+LQH +   A+     D   +  + LG  PHQ+
Sbjct:    4 LQFCPFSSALDSGFWHTLSQKKVNEYKLDEAAKELKGFFYNGDPPGLPARMMLEFNSFDPYGILFYFKHILLRKTR-SLHNTNTLGAFKTCDKKALLDQ-AAQKIWEAVTSGAALQDPTLLNQFVLLTFADLKKYHFYYWFAFPALCFP------DGIALLEPS---------LPLGERCSTAQHSRFGCFSRTLIFLLGKGKVYLSHMATSQESNMLSTSQMAMVAVYDPCTLQQHPGWPLRNLLILLAHNC------HKYSLSISFAHNNF------PKLHPLVVLSLPWVQRIVRKGGEYSGPKCVGWEKNQKGVLAPRMVNLSDSMDPKRLAESSVDLNLKLMRWRLVPSLDLEAVSTARCLLLGAGTLGCNVARTLLGWGVRHITFVDNARVSYSNPVRQTLYEFEDCLGGGKPKAQAAAERLRRIFPGVVSEGLSLSIPMPGHAVGLVAGGDTAVLE------RLVSEHDIVFLLMDTRESRWLPTVLAASKHKLVINAALGFDTFVVMRHGLKAAREDPGDTLGSLGAAAAAATSSLFSD------IPGHRLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAMMAGALAVELMVSVLQHPERGYASASVGDDRMNEPPTPLGLIPHQV 599          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Yeast
Match: ATG7 (Autophagy-related protein and dual specificity member of the E1 family; mediates the attachment of Atg12p to Atg5p and Atg8p to phosphatidylethanolamine which are required steps in autophagosome formation; E1 enzymes are also known as ubiquitin-activating enzymes; involved in methionine restriction extension of chronological lifespan in an autophagy-dependent manner [Source:SGD;Acc:S000001214])

HSP 1 Score: 384.415 bits (986), Expect = 2.881e-124
Identity = 248/685 (36.20%), Postives = 365/685 (53.28%), Query Frame = 2
Query:   74 LMSDNLIKFSP-FQSLVDGSFWHILARRKLEEYKLSEG--PYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLEENGLRLNHFCHFDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTS----DIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHK-DGKKAAVDASRDNFDFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDLQNSID 2101
            + S+ ++ ++P F+S +D SF+  L+R KL+  KL     P T+  +  ++          +   SFEK +    N   L+G ++  N  ++F N +K  FL+    ++ LE  ++G  +K  +K   F ++++ DLKKY F+YW   P  + P +  L    E     + K    +  K FD     ++  +  I   ++ +     C   I  K  VL   D S     P         A++   +   +     ++ ++  I   IRQ + S  L      ID  +S    D+K  GWE+     L PR   ++S ++PLK+A+ +VDLNLKLMKWR++PDL+L+ I   K LL G GTLGC+V+R L+AW V  IT +DN +VSYSNPVRQ L+ +ED      KAE A  SLK I+P  +  G  LS+PM GH L   E    +  +D  ++  L+ EHD+IFLL+D+RE+RW PS+L  I  K VINAALGFD+YLVMRHG   +                               +LGCYFC DVV P++S  DR++DQ CTVTRPGV+M+A++LAVELM SLLQ K  G +  V            LG  PHQIRG++  F+ +     A  HC ACS KV++ + + G+EF+ K  + P YLEE++GL  ++  ++
Sbjct:    1 MSSERVLSYAPAFKSFLDTSFFQELSRLKLDVLKLDSTCQPLTVNLDLHNIPKSADQVPLFLTNRSFEKHNNKRTNEVPLQGSIFNFNVLDEFKNLDKQLFLH----QRALECWEDG--IKDINKCVSFVIISFADLKKYRFYYWLGVPCFQRPSSTVLHVRPE----PSLKGLFSKCQKWFDV----NYSKWVCILDADDEIVNYDKC---IIRKTKVLAIRDTSTMENVPS--------ALTKNFLSVLQYDVPDLIDFKLLI---IRQNEGSFALNATFASIDPQSSSSNPDMKVSGWERNVQGKLAPRVVDLSSLLDPLKIADQSVDLNLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAWGVRKITFVDNGTVSYSNPVRQALYNFEDCGKP--KAELAAASLKRIFPLMDATGVKLSIPMIGHKLVNEE----AQHKDFDRLRALIKEHDIIFLLVDSRESRWLPSLLSNIENKTVINAALGFDSYLVMRHGNRDEQS---------------------------SKQLGCYFCHDVVAPTDSLTDRTLDQMCTVTRPGVAMMASSLAVELMTSLLQTKYSGSETTV------------LGDIPHQIRGFLHNFSILKLETPAYEHCPACSPKVIEAFTDLGWEFVKKALEHPLYLEEISGLSVIKQEVE 612          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Nematostella
Match: EDO49806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFZ1])

HSP 1 Score: 440.269 bits (1131), Expect = 6.366e-145
Identity = 269/680 (39.56%), Postives = 391/680 (57.50%), Query Frame = 2
Query:   89 LIKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEE----IELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLE-ENGLRLNHFCHFDIENKDC---VLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVN-KAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPG-VSMIAAALAVELMV---SLLQHKDGKKAAVDASRDNFDFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDL 2086
            +++F+PF S VD  FWH L  +KL+EY L++ P  + G + +    G   R  I   +F+K++ V    +K  G+L   NT + F + +K   ++  G +K+ ENIK+ + L+ PS + QF LLT+ +LKKY+F+YWFAFPA        LK      +E+  Q+     +D  +   D   + +  M  T+++  ++ + +      D  N D    ++GF DP+  P  PGWPLR  L  ++       +   ++VLC+R+      R+   S VL + L  I+      K++GWEK + Q L PR   ++++M+P KLAE++VDLNLKLM+WRL+P+LDL+ +S  +CLL G GTLGC+VAR L+ W V  IT +DNS++SYSNPVRQTLF+++D       KA  A ++LK I+P  N  G  L++PMPGH + +   +++SV+ D  ++  L+  HDVIFLL+DTRE+RW P+V+     KLV+ AALGFDTYLVMRH      G+   S  S +    DL A       +PG  LGCYFC DVV P NST+DR++DQQ ++     +S I  AL     V   SL Q     K    A+R     V C      QIRG++S + +V P   A   CTACS KV++ Y+  GF FL K  + P YLE+V G+  L
Sbjct:   13 ILQFAPFSSAVDAIFWHKLKDKKLDEYYLNDEPKPLQGYYVNCDLPGLPCRMSIDYCAFDKNA-VPLRAFKTHGQLVNTNTIDAFRSLDKKILMDSVG-EKMWENIKSKKALEDPSLLGQFILLTFANLKKYHFYYWFAFPAICVDGKSHLKSPPLPLVEVFTQSQASYTIDGGYGNDDDYVDGNVMMMITVYVYVDSAMVMMMIVDGDENNDDLFQLMVGFADPTTLPSNPGWPLRNFLLFLAFHW--GTKIDDLKVLCFRDRFRGGRREIDHSIVLDVTLPVINENGKCPKYIGWEKNKKQKLGPRSVDLSATMDPEKLAESSVDLNLKLMRWRLLPELDLDVVSSTRCLLLGAGTLGCNVARCLMGWGVRTITFVDNSTISYSNPVRQTLFEFDDCKEGGRPKAAAAAEALKRIFPGVNSSGEMLTIPMPGHTMGQSPEAIASVQRDVTRLEQLIESHDVIFLLMDTRESRWLPTVMAAARHKLVMTAALGFDTYLVMRH------GLRVLSFPSCSPSKPDLTA-------LPGTSLGCYFCNDVVAPGNSTRDRTLDQQLSLRVANLLSSILNALYSIFTVKNPSLAQWSSITKVTCKATR--VSIVIC------QIRGFLSRYQTVLPACLAFDKCTACSSKVVEAYIHGGFSFLQKACNVPRYLEDVTGITAL 667          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Medaka
Match: atg7 (autophagy related 7 [Source:NCBI gene;Acc:101175641])

HSP 1 Score: 505.753 bits (1301), Expect = 3.795e-169
Identity = 285/692 (41.18%), Postives = 414/692 (59.83%), Query Frame = 2
Query:   80 SDNLIKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQL---QEQHHQMFFTIFLEENGLR---LNHFCHFDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSV-NKVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQP---GVXXXXXXXXXXXXGDLKAELRKPNY--------VPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            +D  ++F+PF S ++  FWH L ++KL +YKL E P  I G + +   VG   R  +   +F+  +          G L+  NT + F N +K   L    +K++   I +G  LK  S + +F LLT+ DLKKY+F+YWF FPA  FP   ++ ++  LL+      +V    + +D L   +      +F I   ++ ++   L  +  F    K   +GF DP    ++PGWPLR +L  ++      ++   + VLC+R+  +   R  + S V  I+L G+   +   K VGWEK     + PR   ++  M+P +LAE++VDLNLKLM+WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V HIT +DN+ +SYSNPVRQ L+++ED +    +KA  A + L +I+P  N KGY +S+PMPGHP+   + ++S  + D  ++  L++EHDV+FLL+DTRE+RW P+V+     KLV+NAALGFDT++VMRHG+   P   GV  S   S A+ +    A    P+         +PGD+LGCYFC DVV P +ST+DR++DQQCTV+RPG++MIA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS  VLD Y +EGF+FL KVF+    +LE++ GL  L  
Sbjct:   13 ADLKLQFAPFSSALEAGFWHQLTQKKLNDYKLDESPKCIKGYYYNGDPVGLPTRLTLEFSAFDVDAVTPARCCPAVGTLYNTNTLDAFKNIDKRALLEK-EAKEMWNAICSGAALKEQSLLSRFILLTFADLKKYHFYYWFCFPALCFPEGIKIIQQPSLLEAVFSPKQVIALQEAYDDLCVTKGNTAVPYFLIKYTDHTVQMAPLEDWESFFTMTKKVTVGFYDPCTLSQHPGWPLRNLLALLANQW--GSKLDVVEVLCFRDRTLQGSRSIQHSVVFQIKLPGLSSNSGCPKSVGWEKNAKGAMGPRMVNLSECMDPKRLAESSVDLNLKLMRWRLVPSLDLDKVVSTKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKSKATAAAERLSKIFPGVNAKGYNMSIPMPGHPVNFSQATLSLAQMDVEQLEKLISEHDVVFLLMDTRESRWLPTVIAASKRKLVVNAALGFDTFVVMRHGLKKPPASRGVDSSPSCSSASSSPSTPAG-SAPSVPGSSLFSNIPGDKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAMIAGALAVELMVSMLQHSEGGYAVASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPASLAFDKCTACSPIVLDNYEKEGFDFLSKVFNSSHSFLEDLTGLTLLHQ 700          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Medaka
Match: atg7 (autophagy related 7 [Source:NCBI gene;Acc:101175641])

HSP 1 Score: 493.426 bits (1269), Expect = 5.673e-165
Identity = 280/686 (40.82%), Postives = 398/686 (58.02%), Query Frame = 2
Query:   80 SDNLIKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLEENGLRLNHFCHFDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSV-NKVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQP---GVXXXXXXXXXXXXGDLKAELRKPNY--------VPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            +D  ++F+PF S ++  FWH L ++KL +YKL E P  I G + +   VG   R  +   +F+  +          G L+  NT + F N +K   L    +K++   I +G  LK  S + +F LLT+ DLKKY+F+YWF FPA  FP      E I+++ Q +    V                                        K   +GF DP    ++PGWPLR +L  ++      ++   + VLC+R+  +   R  + S V  I+L G+   +   K VGWEK     + PR   ++  M+P +LAE++VDLNLKLM+WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V HIT +DN+ +SYSNPVRQ L+++ED +    +KA  A + L +I+P  N KGY +S+PMPGHP+   + ++S  + D  ++  L++EHDV+FLL+DTRE+RW P+V+     KLV+NAALGFDT++VMRHG+   P   GV  S   S A+ +    A    P+         +PGD+LGCYFC DVV P +ST+DR++DQQCTV+RPG++MIA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQIRG++S F++V P   A   CTACS  VLD Y +EGF+FL KVF+    +LE++ GL  L  
Sbjct:   13 ADLKLQFAPFSSALEAGFWHQLTQKKLNDYKLDESPKCIKGYYYNGDPVGLPTRLTLEFSAFDVDAVTPARCCPAVGTLYNTNTLDAFKNIDKRALLEK-EAKEMWNAICSGAALKEQSLLSRFILLTFADLKKYHFYYWFCFPALCFP------EGIKIIQQPSLLEAV-------------------------------------FSPKQVTVGFYDPCTLSQHPGWPLRNLLALLANQW--GSKLDVVEVLCFRDRTLQGSRSIQHSVVFQIKLPGLSSNSGCPKSVGWEKNAKGAMGPRMVNLSECMDPKRLAESSVDLNLKLMRWRLVPSLDLDKVVSTKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKSKATAAAERLSKIFPGVNAKGYNMSIPMPGHPVNFSQATLSLAQMDVEQLEKLISEHDVVFLLMDTRESRWLPTVIAASKRKLVVNAALGFDTFVVMRHGLKKPPASRGVDSSPSCSSASSSPSTPAG-SAPSVPGSSLFSNIPGDKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAMIAGALAVELMVSMLQHSEGGYAVASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPASLAFDKCTACSPIVLDNYEKEGFDFLSKVFNSSHSFLEDLTGLTLLHQ 651          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Medaka
Match: atg7 (autophagy related 7 [Source:NCBI gene;Acc:101175641])

HSP 1 Score: 465.692 bits (1197), Expect = 5.338e-154
Identity = 273/692 (39.45%), Postives = 398/692 (57.51%), Query Frame = 2
Query:   80 SDNLIKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQL---QEQHHQMFFTIFLEENGLR---LNHFCHFDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDL-PRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSV-NKVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQP---GVXXXXXXXXXXXXGDLKAELRKPNY--------VPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNF-DFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDP-DYLEEVAGLKDLQN 2092
            +D  ++F+PF S ++  FWH L ++KL +YKL E P  I G + +   VG   R  +   +F+  +          G L+  NT + F N +K   L    +K++   I +G  LK  S + +F LLT+ DLKKY+F+YWF FPA  FP   ++ ++  LL+      +V    + +D L   +      +F I   ++ ++   L  +  F    K   +GF DP    ++PGWPLR +L  ++      ++   + VLC+R+  +   R  + S V  I+L G+   +S  K VGWEK     + PR   ++  M+P +LAE++VDLNLKLM+WRL+P LDL+K+   KCLL G GTLGC+VAR L+ W V HIT +DN+ +SYSNPVRQ L+++ED +    +KA  A + L +I+P  N KGY +S+PMPGHP+   + ++S  + D  ++  L++EHDV+FLL+DTRE+RW P+V+     KLV+NAALGFDT++VMRHG+   P   GV  S   S A+ +    A    P+         +PGD+LGCYFC DVV P +ST+DR++DQQCTV+RPG++MIA ALAVELMVS+LQH +G  A   +S D   +  + LG  PHQ                           VLD Y +EGF+FL KVF+    +LE++ GL  L  
Sbjct:    9 ADLKLQFAPFSSALEAGFWHQLTQKKLNDYKLDESPKCIKGYYYNGDPVGLPTRLTLEFSAFDVDAVTPARCCPAVGTLYNTNTLDAFKNIDKRALLEK-EAKEMWNAICSGAALKEQSLLSRFILLTFADLKKYHFYYWFCFPALCFPEGIKIIQQPSLLEAVFSPKQVIALQEAYDDLCVTKGNTAVPYFLIKYTDHTVQMAPLEDWESFFTMTKKVTVGFYDPCTLSQHPGWPLRNLLALLANQW--GSKLDVVEVLCFRDRTLQGSRSIQHSVVFQIKLPGL---SSCPKSVGWEKNAKGAMGPRMVNLSECMDPKRLAESSVDLNLKLMRWRLVPSLDLDKVVSTKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKSKATAAAERLSKIFPGVNAKGYNMSIPMPGHPVNFSQATLSLAQMDVEQLEKLISEHDVVFLLMDTRESRWLPTVIAASKRKLVVNAALGFDTFVVMRHGLKKPPASRGVDSSPSCSSASSSPSTPAG-SAPSVPGSSLFSNIPGDKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAMIAGALAVELMVSMLQHSEGGYAVASSSDDRMNEPPTSLGLVPHQ---------------------------VLDNYEKEGFDFLSKVFNSSHSFLEDLTGLTLLHQ 666          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Planmine SMEST
Match: SMESG000005933.1 (SMESG000005933.1)

HSP 1 Score: 1404.04 bits (3633), Expect = 0.000e+0
Identity = 687/690 (99.57%), Postives = 687/690 (99.57%), Query Frame = 2
Query:   77 MSDNLIKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLEENGLRLNHFCHFDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDLPRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVNKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQPGVXXXXXXXXXXXXGDLKAELRKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNFDFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDLQNSIDFDCVTAFTDSDDDYS 2146
            MSDNLIKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLEENGLRLNHFCHFDIENKDCVLGFCD SLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDLPRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNK NKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQPGVSPSSKFSKAAPAGDLKAEL KPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNFDFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDLQNSIDFDCVTAFTDSDDDYS
Sbjct:    1 MSDNLIKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNVGSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNMFGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFPVNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLEENGLRLNHFCHFDIENKDCVLGFCDTSLDPKYPGWPLRIILFAISCTLIPPNEKRTMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQDLPRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKANKAEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFNLVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVAPQPGVSPSSKFSKAAPAGDLKAELSKPNYVPGDELGCYFCTDVVGPSNSTKDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNFDFVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEFLLKVFDDPDYLEEVAGLKDLQNSIDFDCVTAFTDSDDDYS 690          
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Planmine SMEST
Match: SMESG000047759.1 (SMESG000047759.1)

HSP 1 Score: 56.9954 bits (136), Expect = 4.050e-8
Identity = 30/82 (36.59%), Postives = 51/82 (62.20%), Query Frame = 2
Query: 1088 LEKISKAKCLLFGVGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVNKAEQAEKSLKEIYPHANVKG 1333
            ++ I+K+  L+ G G +GC + + L+ WN   IT+ID  ++  SN  RQ LF+ E+ V K +KA  A++S+ +  P+ N+K 
Sbjct:    1 MDNIAKSNVLVVGAGGIGCELLKNLVMWNFKEITVIDLDTIDVSNLNRQFLFRKEN-VGK-SKALTAKESVLKFNPNVNIKA 80          
The following BLAST results are available for this feature:
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATG77.875e-16840.53autophagy related 7 [Source:HGNC Symbol;Acc:HGNC:1... [more]
ATG75.434e-15238.47autophagy related 7 [Source:HGNC Symbol;Acc:HGNC:1... [more]
ATG74.979e-14237.94autophagy related 7 [Source:HGNC Symbol;Acc:HGNC:1... [more]
ATG76.746e-2435.85autophagy related 7 [Source:HGNC Symbol;Acc:HGNC:1... [more]
ATG74.934e-1552.11autophagy related 7 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atg-74.518e-13135.57AuTophaGy (Yeast Atg homolog) [Source:UniProtKB/T... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atg71.554e-14939.35gene:FBgn0034366 transcript:FBtr0086712[more]
Atg72.052e-12148.03gene:FBgn0034366 transcript:FBtr0086711[more]
Uba43.140e-633.33gene:FBgn0032054 transcript:FBtr0079683[more]
Uba43.140e-633.33gene:FBgn0032054 transcript:FBtr0333414[more]
Uba43.140e-633.33gene:FBgn0032054 transcript:FBtr0333413[more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
atg71.619e-14538.14ATG7 autophagy related 7 homolog (S. cerevisiae) [... [more]
atg77.081e-5647.80ATG7 autophagy related 7 homolog (S. cerevisiae) [... [more]
atg74.520e-3357.14ATG7 autophagy related 7 homolog (S. cerevisiae) [... [more]
atg79.816e-3128.57ATG7 autophagy related 7 homolog (S. cerevisiae) [... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atg71.923e-16640.53autophagy related 7 [Source:MGI Symbol;Acc:MGI:192... [more]
Atg71.923e-16640.53autophagy related 7 [Source:MGI Symbol;Acc:MGI:192... [more]
Atg71.923e-16640.53autophagy related 7 [Source:MGI Symbol;Acc:MGI:192... [more]
Atg71.284e-16540.53autophagy related 7 [Source:MGI Symbol;Acc:MGI:192... [more]
Atg71.085e-15038.47autophagy related 7 [Source:MGI Symbol;Acc:MGI:192... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95352|ATG7_HUMAN3.782e-16740.53Ubiquitin-like modifier-activating enzyme ATG7 OS=... [more]
sp|Q5ZKY2|ATG7_CHICK7.159e-16741.83Ubiquitin-like modifier-activating enzyme ATG7 OS=... [more]
sp|Q9D906|ATG7_MOUSE1.345e-16540.53Ubiquitin-like modifier-activating enzyme ATG7 OS=... [more]
sp|Q641Y5|ATG7_RAT3.401e-16440.38Ubiquitin-like modifier-activating enzyme ATG7 OS=... [more]
sp|Q86CR9|ATG7_DICDI4.463e-15139.26Ubiquitin-like modifier-activating enzyme atg7 OS=... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1P8STG90.000e+084.97Ubiquitin-like modifier-activating enzyme ATG7 OS=... [more]
H2KTG70.000e+044.12Autophagy-related protein 7 OS=Clonorchis sinensis... [more]
A0A3R7GUF00.000e+044.34Ubiquitin-like modifier-activating enzyme ATG7 OS=... [more]
A0A1S8WXP90.000e+043.95E1-like protein-activating enzyme Gsa7p/Apg7p (Fra... [more]
A0A075A1I40.000e+044.16Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atg74.072e-17040.47autophagy related 7 [Source:NCBI gene;Acc:10303584... [more]
atg76.109e-17040.47autophagy related 7 [Source:NCBI gene;Acc:10303584... [more]
atg73.306e-15438.20autophagy related 7 [Source:NCBI gene;Acc:10303584... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atg71.183e-13440.19ATG7 autophagy related 7 homolog (S. cerevisiae) [... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ATG72.881e-12436.20Autophagy-related protein and dual specificity mem... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO498066.366e-14539.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atg73.795e-16941.18autophagy related 7 [Source:NCBI gene;Acc:10117564... [more]
atg75.673e-16540.82autophagy related 7 [Source:NCBI gene;Acc:10117564... [more]
atg75.338e-15439.45autophagy related 7 [Source:NCBI gene;Acc:10117564... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme ATG7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000005933.10.000e+099.57SMESG000005933.1[more]
SMESG000047759.14.050e-836.59SMESG000047759.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006497 ID=SMED30006497|Name=Ubiquitin-like modifier-activating enzyme ATG7|organism=Schmidtea mediterranea sexual|type=transcript|length=2343bp
GAAAAACATTTTCAAAAGTTTTTTTATCAATTCATATTTTGTCAATTTTT
TTGTAATAATTTTTTAAAAAAAATTGATGAGTGATAACTTAATTAAATTT
TCACCTTTTCAATCATTAGTTGATGGATCATTTTGGCACATATTAGCACG
AAGAAAACTTGAAGAATACAAACTTAGTGAAGGACCTTATACTATCTATG
GTAATTTCGAACATGTTTATAATGTTGGATCTGCCAACAGATTTATGATT
GGAATGGAATCATTTGAAAAGTCTAGTTTTGTGCATCCAAACATTTATAA
ATTGAAAGGAAAACTTTGGATGTTGAATACTTCTGAAGACTTTAATAATA
AAAATAAAGTAGAATTTTTAAATATGTTTGGATCAAAGAAAATATTAGAG
AATATTAAAAACGGTGAATATCTGAAACACCCTAGTAAAATATGCCAATT
TTATCTACTTACTTATGGAGATCTAAAAAAATACAATTTTTTCTACTGGT
TTGCATTTCCTGCTCCTCGATTTCCAGTTAACCCAGAACTGAAAGAAGAA
ATTGAACTTTTGGATCAAGCAACTTTTAAAAATGAGGTTGATCAGTTTTT
CAAATTATTTGATCAACTACAGGAGCAACATCACCAAATGTTTTTCACCA
TATTTTTAGAGGAAAATGGTTTACGATTAAATCATTTCTGTCACTTTGAT
ATTGAAAATAAGGACTGTGTACTTGGCTTCTGTGATCCATCTCTCGATCC
TAAATATCCTGGTTGGCCGTTACGAATTATTCTATTTGCGATTTCCTGTA
CTTTAATCCCCCCTAATGAAAAACGTACGATGAGAGTATTATGTTACCGA
AATCATATTGTGGATTCTATACGGCAGACTAAATCCAGTTCAGTTTTAAC
AATCGAATTAACTGGTATAGATTTAACAACTTCAGACATCAAATTTGTTG
GCTGGGAGAAATATCGAAATCAAGATTTACCTAGATGTGCCAAGATGGCA
TCCAGCATGAACCCTTTGAAATTAGCAGAAAATGCAGTAGATCTTAATCT
GAAATTGATGAAATGGAGACTGATTCCTGATTTAGACTTAGAAAAAATAT
CTAAAGCTAAATGTTTGTTATTTGGCGTCGGCACTCTTGGATGTCATGTC
GCACGACAACTTTTGGCTTGGAACGTGAATCACATTACTCTGATAGATAA
TTCATCGGTTTCCTATTCCAATCCCGTTCGCCAAACCTTATTTAAGTATG
AAGATAGTGTTAATAAAGTTAACAAAGCCGAACAAGCTGAAAAGTCTTTA
AAAGAAATTTATCCTCATGCTAATGTCAAGGGTTATACTCTCTCTGTACC
TATGCCAGGACATCCGTTGTGTAAATGGGAAAATAGTGTTTCCTCAGTGG
AAGAAGATTGTTTGAAAATCTTTAATCTGGTAGCTGAACACGATGTAATT
TTCCTGTTACTTGATACCAGAGAGGCTCGTTGGTTCCCAAGTGTACTTGG
ATATATACATGGAAAATTGGTGATAAATGCAGCTTTGGGATTCGATACGT
ATTTGGTAATGAGGCATGGTGTAGCCCCCCAGCCTGGAGTTTCCCCCAGT
AGCAAATTTTCCAAAGCAGCTCCGGCTGGAGATTTAAAGGCGGAATTGCG
TAAACCAAATTATGTCCCTGGTGATGAACTTGGCTGTTATTTCTGCACAG
ACGTTGTTGGACCATCAAATTCTACTAAAGATAGATCTATAGACCAACAA
TGTACTGTAACTAGACCTGGGGTCAGTATGATAGCTGCTGCACTTGCAGT
AGAGCTGATGGTTTCGCTTTTACAACATAAAGATGGAAAAAAAGCCGCAG
TTGATGCTTCTCGCGATAATTTTGATTTTGTATCTTGCCTGGGAACAACG
CCACATCAAATTCGAGGATACATATCATGCTTTAATAGTGTCACACCATT
TCACCGGGCTTCTATACATTGTACAGCTTGTTCACAAAAGGTTTTGGATC
AATACTTAGAAGAAGGATTTGAATTTCTATTAAAAGTTTTTGATGATCCA
GACTATTTAGAAGAAGTTGCTGGACTTAAAGATTTACAAAACTCTATCGA
CTTTGATTGTGTAACCGCTTTCACAGACAGTGATGATGACTACAGCAAAT
AAATTTGCCTAATCATAAAGTAAATAATAACAATGTGGTGATTAAAATTT
TGTCGAGTTTTCTTTTTACCTAATTTTTGACTTATATTTCCTAATTTTTC
TTCAAATAATTGTGAAAAATATATTTTAGTGTCTAAATTATACTTTGTAA
GTTATGAATTACGTGCAACAAAGGCAAATATTATGGACAGTTG
back to top

protein sequence of SMED30006497-orf-1

>SMED30006497-orf-1 ID=SMED30006497-orf-1|Name=SMED30006497-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=692bp
MSDNLIKFSPFQSLVDGSFWHILARRKLEEYKLSEGPYTIYGNFEHVYNV
GSANRFMIGMESFEKSSFVHPNIYKLKGKLWMLNTSEDFNNKNKVEFLNM
FGSKKILENIKNGEYLKHPSKICQFYLLTYGDLKKYNFFYWFAFPAPRFP
VNPELKEEIELLDQATFKNEVDQFFKLFDQLQEQHHQMFFTIFLEENGLR
LNHFCHFDIENKDCVLGFCDPSLDPKYPGWPLRIILFAISCTLIPPNEKR
TMRVLCYRNHIVDSIRQTKSSSVLTIELTGIDLTTSDIKFVGWEKYRNQD
LPRCAKMASSMNPLKLAENAVDLNLKLMKWRLIPDLDLEKISKAKCLLFG
VGTLGCHVARQLLAWNVNHITLIDNSSVSYSNPVRQTLFKYEDSVNKVNK
AEQAEKSLKEIYPHANVKGYTLSVPMPGHPLCKWENSVSSVEEDCLKIFN
LVAEHDVIFLLLDTREARWFPSVLGYIHGKLVINAALGFDTYLVMRHGVA
PQPGVSPSSKFSKAAPAGDLKAELRKPNYVPGDELGCYFCTDVVGPSNST
KDRSIDQQCTVTRPGVSMIAAALAVELMVSLLQHKDGKKAAVDASRDNFD
FVSCLGTTPHQIRGYISCFNSVTPFHRASIHCTACSQKVLDQYLEEGFEF
LLKVFDDPDYLEEVAGLKDLQNSIDFDCVTAFTDSDDDYSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000407pre-autophagosomal structure
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0015031protein transport
GO:0006914autophagy
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR006285Atg7
IPR042523Atg7_N_2
IPR042522Atg7_N_1
IPR035985Ubiquitin-activating_enz
IPR032197Atg7_N
IPR016040NAD(P)-bd_dom
IPR000594ThiF_NAD_FAD-bd
Vocabulary: molecular function
TermDefinition
GO:0008641small protein activating enzyme activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032197Ubiquitin-like modifier-activating enzyme Atg7, N-terminalPFAMPF16420ATG7_Ncoord: 6..311
e-value: 1.3E-63
score: 215.5
IPR006285Ubiquitin-like modifier-activating enzyme Atg7TIGRFAMTIGR01381TIGR01381coord: 8..688
e-value: 5.8E-184
score: 611.1
IPR006285Ubiquitin-like modifier-activating enzyme Atg7PANTHERPTHR10953:SF3UBIQUITIN-LIKE MODIFIER-ACTIVATING ENZYME ATG7coord: 5..687
IPR042523Ubiquitin-like modifier-activating enzyme Atg7, N-terminal, subdomain 2GENE3DG3DSA:3.40.140.100coord: 6..283
e-value: 1.5E-74
score: 253.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 310..691
e-value: 7.4E-145
score: 483.8
NoneNo IPR availablePANTHERPTHR10953UBIQUITIN-ACTIVATING ENZYME E1coord: 5..687
IPR000594THIF-type NAD/FAD binding foldPFAMPF00899ThiFcoord: 334..603
e-value: 7.9E-40
score: 136.7
IPR042522Ubiquitin-like modifier-activating enzyme Atg7, N-terminal, subdomain 1GENE3DG3DSA:3.40.140.70coord: 11..307
e-value: 1.5E-74
score: 253.1
IPR035985Ubiquitin-activating enzymeSUPERFAMILYSSF69572Activating enzymes of the ubiquitin-like proteinscoord: 331..664