TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30006469
Length (bp)1405
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30006469) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30006469) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30006469) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30006469) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006469

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30006469SMESG000067216.1 Contig3390GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30006469SMESG000067216.1 dd_Smed_v4_2669_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006469SMESG000067216.1 dd_Smed_v4_2669_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30006469SMESG000067216.1 dd_Smed_v4_2669_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 126.716 bits (317), Expect = 6.884e-31
Identity = 108/376 (28.72%), Postives = 188/376 (50.00%), Query Frame = 1
Query:  310 CPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISK----KEDFVLYKCEKKLINANETSNEAANR--VKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESN---LEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLS-SDNKLFIRCSVN 1404
            CPN NC+      +++ HL +C    + CP+   GC  ++     L  H    +  H +L+LE    L  ++  L +++E+ + + +QL E      I K+ KE   +Q  Q    K G F  N Q+      K  ++  +  + L   N+  N+   R  ++     +Q +    +N+   A  E   + T+K +  + I     ++Q+ K E     LE   Y G+ +W + ++  K  +A  G   S FS +F+T + GY+LC R Y  G G G+GSHLS++F VM G+FD+ L WP +  +T  + DQ SG  ++++  +++  PNSSS+++P  + NI  G P+F+    L +  N    D+ LF++ +V+
Sbjct:  195 CPN-NCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTD-KRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAE-----TIKKLEKEF--KQFAQLFG-KNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLE---EETNKHDTHINIH----KAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQ-SGKKNIME--TFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVD 550          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 126.716 bits (317), Expect = 6.884e-31
Identity = 108/376 (28.72%), Postives = 188/376 (50.00%), Query Frame = 1
Query:  310 CPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISK----KEDFVLYKCEKKLINANETSNEAANR--VKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESN---LEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLS-SDNKLFIRCSVN 1404
            CPN NC+      +++ HL +C    + CP+   GC  ++     L  H    +  H +L+LE    L  ++  L +++E+ + + +QL E      I K+ KE   +Q  Q    K G F  N Q+      K  ++  +  + L   N+  N+   R  ++     +Q +    +N+   A  E   + T+K +  + I     ++Q+ K E     LE   Y G+ +W + ++  K  +A  G   S FS +F+T + GY+LC R Y  G G G+GSHLS++F VM G+FD+ L WP +  +T  + DQ SG  ++++  +++  PNSSS+++P  + NI  G P+F+    L +  N    D+ LF++ +V+
Sbjct:  195 CPN-NCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTD-KRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAE-----TIKKLEKEF--KQFAQLFG-KNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLE---EETNKHDTHINIH----KAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQ-SGKKNIME--TFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVD 550          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 126.716 bits (317), Expect = 6.884e-31
Identity = 108/376 (28.72%), Postives = 188/376 (50.00%), Query Frame = 1
Query:  310 CPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISK----KEDFVLYKCEKKLINANETSNEAANR--VKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESN---LEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLS-SDNKLFIRCSVN 1404
            CPN NC+      +++ HL +C    + CP+   GC  ++     L  H    +  H +L+LE    L  ++  L +++E+ + + +QL E      I K+ KE   +Q  Q    K G F  N Q+      K  ++  +  + L   N+  N+   R  ++     +Q +    +N+   A  E   + T+K +  + I     ++Q+ K E     LE   Y G+ +W + ++  K  +A  G   S FS +F+T + GY+LC R Y  G G G+GSHLS++F VM G+FD+ L WP +  +T  + DQ SG  ++++  +++  PNSSS+++P  + NI  G P+F+    L +  N    D+ LF++ +V+
Sbjct:  195 CPN-NCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTD-KRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAE-----TIKKLEKEF--KQFAQLFG-KNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLE---EETNKHDTHINIH----KAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQ-SGKKNIME--TFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVD 550          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 126.331 bits (316), Expect = 1.059e-30
Identity = 106/387 (27.39%), Postives = 191/387 (49.35%), Query Frame = 1
Query:  310 CPNKNCSFKDELR-QIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLK-RTVEK---------------LQVEKKQ---LTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEA-ANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            CP+K CS +  LR ++  HL  C      C +   GC   + + +++  H     V H  LL E  ++L  +V  L+  +VEK               +++E+++      E +++ + +++     E+LK+ +D+++  F +N + +               ++ ++S E+  NRV     +E    DKS+ +V        S+ +       V D++ L    L+ +  LE  +Y G  +W + ++  +  +A +G   S +S  F+T  +GYK+C R+Y  G G GKG+HLS+FF +M G++D  LPWP K  +T  + DQ S   H+    +++  PNSSS++KPT + NI  G P F+  + +  N     D+ +FI+  V+
Sbjct:  204 CPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV-FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQA-EKLKE-LDKEIRPFRQNWEEA---------------DSMKSSVESLQNRV-----TELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIR-LADMDLRFQV-LETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 126.331 bits (316), Expect = 1.059e-30
Identity = 106/387 (27.39%), Postives = 191/387 (49.35%), Query Frame = 1
Query:  310 CPNKNCSFKDELR-QIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLK-RTVEK---------------LQVEKKQ---LTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEA-ANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            CP+K CS +  LR ++  HL  C      C +   GC   + + +++  H     V H  LL E  ++L  +V  L+  +VEK               +++E+++      E +++ + +++     E+LK+ +D+++  F +N + +               ++ ++S E+  NRV     +E    DKS+ +V        S+ +       V D++ L    L+ +  LE  +Y G  +W + ++  +  +A +G   S +S  F+T  +GYK+C R+Y  G G GKG+HLS+FF +M G++D  LPWP K  +T  + DQ S   H+    +++  PNSSS++KPT + NI  G P F+  + +  N     D+ +FI+  V+
Sbjct:  204 CPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV-FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQA-EKLKE-LDKEIRPFRQNWEEA---------------DSMKSSVESLQNRV-----TELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIR-LADMDLRFQV-LETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 65.4698 bits (158), Expect = 3.050e-11
Identity = 41/170 (24.12%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  910 QSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKP-----NSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            Q++IL       +    + +W ++   ++ ++AK G  ++ FS  F +H++GYK+       G G   G  +S++  ++ G+FD TL WP    I   + DQ    +  V + +Y   P     N     +P  ++N   G   F  +  L    N   D+K++++  V+
Sbjct:  247 QTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRV-NITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAIL---QNYVKDDKIYVQIDVD 412          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 60.077 bits (144), Expect = 1.169e-9
Identity = 51/203 (25.12%), Postives = 91/203 (44.83%), Query Frame = 1
Query:  868 DKSNKSLVIDVQNLQSQILKIESNLEKENYG-------EFLWILENWWEK------FHQAKLGI----------QSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFK-MSDQESGYDHVVQSCSYESKPNSSSY-RKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSV 1401
            D  N  LV+  Q+L     KI  N+++  Y        +++ I E+ +EK      F   K+G+            S +S  F++H YGYK+     P G G     + SVF  +M G++D+ L WP + D+TF  +SD +   + + ++      P    +  +P   +N   G   F+ + ++      ++D  +FI+  V
Sbjct:  108 DDRNLHLVLLCQSLNPIRTKI--NIQQSAYVDKYVGMLQYMSIAESAFEKYGSQHTFRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKK--ELLTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKV---TEFAADGDIFIQIKV 303          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 87.0409 bits (214), Expect = 5.255e-18
Identity = 54/172 (31.40%), Postives = 91/172 (52.91%), Query Frame = 1
Query:  901 QNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQ--ESGYDHVVQSCSYESKPNSSSYRKPTSDKN-IGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            Q  Q Q+LK   +    NY G  LW + +W  K  +A+        S  F+T +YGYKL   ++  G G G+ +H+SV+  V+ G++D  L WP    ITF + +Q  +SG   V +  S+   P   ++++P+++ + +G G P+FI  + L S   +  D  +F+R  V+
Sbjct:  302 QGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAE--SFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDT-VFLRVKVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 86.6557 bits (213), Expect = 7.538e-18
Identity = 54/172 (31.40%), Postives = 91/172 (52.91%), Query Frame = 1
Query:  901 QNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQ--ESGYDHVVQSCSYESKPNSSSYRKPTSDKN-IGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            Q  Q Q+LK   +    NY G  LW + +W  K  +A+        S  F+T +YGYKL   ++  G G G+ +H+SV+  V+ G++D  L WP    ITF + +Q  +SG   V +  S+   P   ++++P+++ + +G G P+FI  + L S   +  D  +F+R  V+
Sbjct:  311 QGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAE--SFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDT-VFLRVKVD 479          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 58.9214 bits (141), Expect = 4.132e-9
Identity = 42/146 (28.77%), Postives = 73/146 (50.00%), Query Frame = 1
Query:  793 SEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQN---LQSQILKIESNLEKEN-YGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHK-YGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQ 1215
            S+Q   D     V    CE   +  DK +++L   +QN   L++Q+   +     +N  G  +W ++++ +K  ++K     +    A F++K +GY L L IY  G G  KG ++    +V+SG++D  L WPC+L     + DQ
Sbjct:  197 SKQATLDYEVKNVKNIVCETEER-CDKLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQY--DTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQ 339          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074274)

HSP 1 Score: 58.9214 bits (141), Expect = 4.132e-9
Identity = 42/146 (28.77%), Postives = 73/146 (50.00%), Query Frame = 1
Query:  793 SEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQN---LQSQILKIESNLEKEN-YGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHK-YGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQ 1215
            S+Q   D     V    CE   +  DK +++L   +QN   L++Q+   +     +N  G  +W ++++ +K  ++K     +    A F++K +GY L L IY  G G  KG ++    +V+SG++D  L WPC+L     + DQ
Sbjct:  197 SKQATLDYEVKNVKNIVCETEER-CDKLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQY--DTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQ 339          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0334036)

HSP 1 Score: 58.9214 bits (141), Expect = 4.132e-9
Identity = 42/146 (28.77%), Postives = 73/146 (50.00%), Query Frame = 1
Query:  793 SEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQN---LQSQILKIESNLEKEN-YGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHK-YGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQ 1215
            S+Q   D     V    CE   +  DK +++L   +QN   L++Q+   +     +N  G  +W ++++ +K  ++K     +    A F++K +GY L L IY  G G  KG ++    +V+SG++D  L WPC+L     + DQ
Sbjct:  197 SKQATLDYEVKNVKNIVCETEER-CDKLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQY--DTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQ 339          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 116.701 bits (291), Expect = 3.220e-29
Identity = 58/149 (38.93%), Postives = 88/149 (59.06%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            G F+W + ++ +K   A  G   + FS AF+T KYGYK+CLRIY  G G G+G+HLS+FF VM G  D  L WP    +T  + DQ +  +H++   ++    +SSS+++P SD NI  G P F  + +L S  +   D+ +FI+  V+
Sbjct:  126 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIID--AFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 271          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 116.701 bits (291), Expect = 3.220e-29
Identity = 58/149 (38.93%), Postives = 88/149 (59.06%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            G F+W + ++ +K   A  G   + FS AF+T KYGYK+CLRIY  G G G+G+HLS+FF VM G  D  L WP    +T  + DQ +  +H++   ++    +SSS+++P SD NI  G P F  + +L S  +   D+ +FI+  V+
Sbjct:  126 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIID--AFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 271          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 120.553 bits (301), Expect = 7.289e-29
Identity = 101/375 (26.93%), Postives = 179/375 (47.73%), Query Frame = 1
Query:  310 CPNKNCSFKDELR-QIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKSNSEQPMK--------DKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            CPN +CSF   LR ++ +H   C      C +   GC    ++ +E+  H       H +++      L  +VE +K   E ++  K   +    L  +++  +EM RE+ +Q +++K+    +    S  E  +  + E + +       E    ++G   S + M         + +S   T A  E   + T   +   V DV+ L    LK++  LE  ++ G  +W + ++  +  +A +    S +S  F+T  +GYK+C R+Y  G G GKG+HLS+FF VM G++D  L WP K  +T  + DQ     H+    +++  P+SSS+R+PT + NI  G P F+  + +  N     D+ +FI+ +V+
Sbjct:  206 CPN-HCSFSSILRSELSSHQHDCPKAQVTCSFIRYGCSYKGLN-QEMREHESSFASEHLRMMAVRNTTLEAKVEDVKS--ELMERYKVLPSLSSRLAEVERQYEEM-REKNRQ-LEQKLVSM-QMLMSSHSEKLLEVEMELRELRPLRAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLE--QQLTRHDDLMSVHDVR-LAEMDLKLQV-LETASFNGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGD--AFKPDPSSSSFRRPTGEMNIASGCPLFV-AQTVLENGTYIKDDTIFIKVTVD 566          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 114.775 bits (286), Expect = 1.709e-28
Identity = 57/149 (38.26%), Postives = 86/149 (57.72%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            G F+W + ++ +K   A  G   + FS AF+T KYGYK+CLRIY  G G G+G+HLS+FF VM G  D  L WP    +T  + DQ S  +H++   ++     SSS+++P S+ NI  G P F  + +L    +   D+ +FI+  V+
Sbjct:  132 GVFIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQ-SNREHIID--AFRPDITSSSFQRPVSEMNIASGCPLFCPLAKLEGKNSYIRDDTIFIKAIVD 277          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 116.316 bits (290), Expect = 1.797e-27
Identity = 58/149 (38.93%), Postives = 88/149 (59.06%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            G F+W + ++ +K   A  G   + FS AF+T KYGYK+CLRIY  G G G+G+HLS+FF VM G  D  L WP    +T  + DQ +  +H++   ++    +SSS+++P SD NI  G P F  + +L S  +   D+ +FI+  V+
Sbjct:  426 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIID--AFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 571          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 124.79 bits (312), Expect = 3.089e-30
Identity = 98/372 (26.34%), Postives = 174/372 (46.77%), Query Frame = 1
Query:  310 CPNKNCSFKDELR-QIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFT-----DKSNKSLVIDVQNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            CP+  CS K  LR ++  HL  C      C +   GC   + + +++  H     V H  L+ E  + L  +V  L       Q E  +  + ++++       E+  E+ K+ +        +  ++ + +   L   +K++ N  +T +EA      KSN E      S  EV       ++        ++ ++ L +    L    L+ +  LE  +Y G  +W + ++  +  +A +G   S +S  F+T  +GYK+C R+Y  G G GKG+HLS+FF +M G++D  LPWP K  ++  + DQ     H+    +++  PNSSS++KPT + NI  G P F+  + +  N     D+ +FI+  V+
Sbjct:  199 CPHM-CSVKSLLRSELNAHLLECVNAPSTCSFKRYGCT-FKGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSML-------QNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGM---KSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQV-LETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVD 554          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 121.709 bits (304), Expect = 5.300e-30
Identity = 65/160 (40.62%), Postives = 96/160 (60.00%), Query Frame = 1
Query:  940 LEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSD---QESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLS-SDNKLFIRCSVN 1404
            LE+ +Y G FLW + +   K H A  G   S +S AF+T KYGYK+CLRIY  G G GKG+H+S+FF VM G++D  LPWP K  +TF + D   ++S +D      ++     S+S+++P +D N+  G P F  I +L S  +    +N L+IRC ++
Sbjct:  223 LEQTSYDGVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNNRDSVFD------AFRPDVTSASFQRPINDMNVASGCPLFCPIAKLNSPKHAYIRENTLYIRCIID 376          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 120.168 bits (300), Expect = 1.111e-28
Identity = 91/352 (25.85%), Postives = 162/352 (46.02%), Query Frame = 1
Query:  394 CPYFEIGCK---------ESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFT-----DKSNKSLVIDVQNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            CP   I C           SE + +++  H     V H  L+ E  + L  +V  L       Q E  +  + ++++       E+  E+ K+ +        +  ++ + +   L   +K++ N  +T +EA      KSN E      S  EV       ++        ++ ++ L +    L    L+ +  LE  +Y G  +W + ++  +  +A +G   S +S  F+T  +GYK+C R+Y  G G GKG+HLS+FF +M G++D  LPWP K  ++  + DQ     H+    +++  PNSSS++KPT + NI  G P F+  + +  N     D+ +FI+  V+
Sbjct:  192 CPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSML-------QNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGM---KSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQV-LETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVD 529          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 107.842 bits (268), Expect = 1.550e-24
Identity = 57/151 (37.75%), Postives = 85/151 (56.29%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNIN--LSSDNKLFIRCSVN 1404
            G+ +W + ++  K  +A  G   S FS  F+T   GY+LC R Y  G G GKGS LS++F VM G+FD+ L WP K  +T  + DQ    +H+     + + PNSSS+++P S+ NI  G P+F    +L +  N     D+ LFI+  V+
Sbjct:  384 GKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITD--VFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 532          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 107.457 bits (267), Expect = 1.649e-24
Identity = 57/151 (37.75%), Postives = 85/151 (56.29%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNIN--LSSDNKLFIRCSVN 1404
            G+ +W + ++  K  +A  G   S FS  F+T   GY+LC R Y  G G GKGS LS++F VM G+FD+ L WP K  +T  + DQ    +H+     + + PNSSS+++P S+ NI  G P+F    +L +  N     D+ LFI+  V+
Sbjct:  333 GKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITD--VFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 481          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 124.79 bits (312), Expect = 2.324e-30
Identity = 105/387 (27.13%), Postives = 190/387 (49.10%), Query Frame = 1
Query:  310 CPNKNCSFKDELR-QIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLK-RTVEK---------------LQVEKKQ---LTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEA-ANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            CP+K CS +  LR ++  HL  C      C +   GC   + + +++  H     V H  LL E  ++L  +V  L+  +VEK               +++E+++      E +++ + +++     E+LK+ +D+++  F +N + +               ++ ++S E+  NRV     +E    DKS+ +         S+ +       V D++ L    L+ +  LE  +Y G  +W + ++  +  +A +G   S +S  F+T  +GYK+C R+Y  G G GKG+HLS+FF +M G++D  LPWP K  +T  + DQ S   H+    +++  PNSSS++KPT + NI  G P F+  + +  N     D+ +FI+  V+
Sbjct:  203 CPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV-FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQA-EKLKE-LDKEIRPFRQNWEEA---------------DSMKSSVESLQNRV-----TELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIR-LADMDLRFQV-LETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVD 560          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 121.709 bits (304), Expect = 2.441e-29
Identity = 58/156 (37.18%), Postives = 92/156 (58.97%), Query Frame = 1
Query:  940 LEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            LE  +Y G  +W + ++  +  +A +G   S +S  F+T  +GYK+C R+Y  G G GKG+HLS+FF +M G++D  LPWP K  +T  + DQ S   H+    +++  PNSSS++KPT + NI  G P F+  + +  N     D+ +FI+  V+
Sbjct:  383 LETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVD 535          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 121.709 bits (304), Expect = 2.441e-29
Identity = 58/156 (37.18%), Postives = 92/156 (58.97%), Query Frame = 1
Query:  940 LEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            LE  +Y G  +W + ++  +  +A +G   S +S  F+T  +GYK+C R+Y  G G GKG+HLS+FF +M G++D  LPWP K  +T  + DQ S   H+    +++  PNSSS++KPT + NI  G P F+  + +  N     D+ +FI+  V+
Sbjct:  383 LETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVD 535          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 115.931 bits (289), Expect = 3.610e-29
Identity = 55/150 (36.67%), Postives = 92/150 (61.33%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLS-SDNKLFIRCSVN 1404
            G+ +W + ++  K  +A  G   S FS  F+T + GY+LC R Y  G G GKG+HLS++F VM G+FD+ L WP +  +T  + DQ    +H+V+  ++++ PNSSS+++P  + NI  G P+F+    L ++ N    D+ LF++ +V+
Sbjct:   96 GKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVE--TFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 243          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 115.931 bits (289), Expect = 3.610e-29
Identity = 55/150 (36.67%), Postives = 92/150 (61.33%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLS-SDNKLFIRCSVN 1404
            G+ +W + ++  K  +A  G   S FS  F+T + GY+LC R Y  G G GKG+HLS++F VM G+FD+ L WP +  +T  + DQ    +H+V+  ++++ PNSSS+++P  + NI  G P+F+    L ++ N    D+ LF++ +V+
Sbjct:   96 GKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVE--TFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 243          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.832e-30
Identity = 102/374 (27.27%), Postives = 183/374 (48.93%), Query Frame = 1
Query:  310 CPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQE----IVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKS--NSEQPMKDKSSN-EVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLS-SDNKLFIRCSVN 1404
            CPN+ C       ++  HL +C    + CP+   GC     + +   G++L+     + +H  L+LE    L   +  L +++E+ + + +QL E V+     K  KE+  +Q  Q M  + G F  N Q            E ++    +  N+  +R+  +S  ++   +K + +  E +  +       T K +  + I    L     + +  LE   Y G+ +W + ++  K  +A  G   S FS  F+T + GY+LC R Y  G G GKG+HLS++F VM G+FD+ L WP +  +T  + DQ    +H+V+  ++++ PNSSS+++P  + NI  G P+F+    L ++ N    D+ LF++ +V+
Sbjct:  195 CPNR-CVQTIPRARVNEHLTVCPEAEQDCPFKHYGC-----TVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVK-----KFEKEL--KQFTQ-MFGRNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFK-QLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVE--TFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 551          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 3.306e-30
Identity = 108/376 (28.72%), Postives = 188/376 (50.00%), Query Frame = 1
Query:  310 CPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISK----KEDFVLYKCEKKLINANETSNEAANR--VKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESN---LEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLS-SDNKLFIRCSVN 1404
            CPN NC+      +++ HL +C    + CP+   GC  ++     L  H    +  H +L+LE    L  ++  L +++E+ + + +QL E      I K+ KE   +Q  Q    K G F  N Q+      K  ++  +  + L   N+  N+   R  ++     +Q +    +N+   A  E   + T+K +  + I     ++Q+ K E     LE   Y G+ +W + ++  K  +A  G   S FS +F+T + GY+LC R Y  G G G+GSHLS++F VM G+FD+ L WP +  +T  + DQ SG  ++++  +++  PNSSS+++P  + NI  G P+F+    L +  N    D+ LF++ +V+
Sbjct:  195 CPN-NCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTD-KRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAE-----TIKKLEKEF--KQFAQLFG-KNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLE---EETNKHDTHINIH----KAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQ-SGKKNIME--TFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVD 550          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 5.087e-30
Identity = 106/387 (27.39%), Postives = 191/387 (49.35%), Query Frame = 1
Query:  310 CPNKNCSFKDELR-QIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLK-RTVEK---------------LQVEKKQ---LTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEA-ANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            CP+K CS +  LR ++  HL  C      C +   GC   + + +++  H     V H  LL E  ++L  +V  L+  +VEK               +++E+++      E +++ + +++     E+LK+ +D+++  F +N + +               ++ ++S E+  NRV     +E    DKS+ +V        S+ +       V D++ L    L+ +  LE  +Y G  +W + ++  +  +A +G   S +S  F+T  +GYK+C R+Y  G G GKG+HLS+FF +M G++D  LPWP K  +T  + DQ S   H+    +++  PNSSS++KPT + NI  G P F+  + +  N     D+ +FI+  V+
Sbjct:  204 CPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV-FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQA-EKLKE-LDKEIRPFRQNWEEA---------------DSMKSSVESLQNRV-----TELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIR-LADMDLRFQV-LETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 1.625e-29
Identity = 105/387 (27.13%), Postives = 190/387 (49.10%), Query Frame = 1
Query:  310 CPNKNCSFKDELR-QIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLK-RTVEK---------------LQVEKKQ---LTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEA-ANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            CP+K CS +  LR ++  HL  C      C +   GC   + + +++  H     V H  LL E  ++L  +V  L+  +VEK               +++E+++      E +++ + +++     E+LK+ +D+++  F +N + +               ++ ++S E+  NRV     +E    DKS+ +         S+ +       V D++ L    L+ +  LE  +Y G  +W + ++  +  +A +G   S +S  F+T  +GYK+C R+Y  G G GKG+HLS+FF +M G++D  LPWP K  +T  + DQ S   H+    +++  PNSSS++KPT + NI  G P F+  + +  N     D+ +FI+  V+
Sbjct:  203 CPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV-FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQA-EKLKE-LDKEIRPFRQNWEEA---------------DSMKSSVESLQNRV-----TELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIR-LADMDLRFQV-LETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVD 560          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39428|TRAF1_MOUSE (TNF receptor-associated factor 1 OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 3.889e-28
Identity = 57/150 (38.00%), Postives = 92/150 (61.33%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINL-SSDNKLFIRCSVN 1404
            G FLW + N  ++ H++  G   S FS AF+T KYGYKLCLR+Y  G G GK +HLS+F  +M G++D  LPWP +  +TF + DQ +  +H +   ++    +S+S+++P S+ N+  G P F  + +L S  +    D+ +F++C V+
Sbjct:  260 GTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ-NNREHAID--AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVD 406          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A3M7SUK3 (TNF receptor-associated factor 2 isoform X2 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_003303 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.574e-35
Identity = 133/463 (28.73%), Postives = 216/463 (46.65%), Query Frame = 1
Query:  100 CLICKSIVINAH-SGPCGCLYCFECIVTYLSKGIRFCPGNT-EECQVKTLNINEDIVVDRXXXXXXXXXXXXCPNKNCSFKDELRQIENHLRI---CNMKCEKCPYFEIGCKESEISTEELSGHILQEIVN---------HSKLLLESIDNLRN--EVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFV-LYKCEKKL------INANETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIES---NLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNIN-LSSDNKLFIRCSVN 1404
            C  C  I++NAH +  CGC YC  C+   L       PG+  + C +K  +  E    DR     +S L++ C   +CS+  +LR+  +H +I      KC  C       +E E+  +  +G+  ++++           + LL +      N  + E LK   E ++ E K+L E       +++ K  V  + +  +     G ++ +++S  ++ V L     K+      +N+  +     NR+  K   E        N V       +       +K+L +     Q  +L +E    NLEK NY G  LW + N  E+  +AK G Q SF+S  F+T + GYK+C R+Y  G G G+ SHLS+FF ++ G+ D  L WP K  +TF + DQ +         ++   PNSSS+R+PTSD NI  G+P F  + +L S+ +    DN LFI+  V+
Sbjct:   29 CPQCSKIIVNAHQADDCGCQYCLNCLAQIL------VPGHVCKNCGIKFQS--EQKFPDRRLQNEISNLIINCSFTDCSWSGKLREYTHHYKIHFEMENKCSNCLLKFENRQELEMHLDLKTGNCAKQLIECDFKKVCPFKTPLLRQDYQEHLNAYQHEHLKLVYEYIEKELKRLRE------FEEVGKHFVDNRTRHGVG---SGGDDVSEMSDAQNSVSLGSLNSKMDMMFNNLNSLISDLTKTNRLHDKLKQE--------NVVLRQGLTDYKILVQDLHKTLAL----AQVSLLTLEERLVNLEKTNYDGTLLWKINNVQERMQEAKSGRQISFYSPPFYTSRSGYKMCGRVYLNGDGNGRNSHLSLFFVILRGENDALLRWPFKQKVTFILIDQSTTESRENLIDAFRPDPNSSSFRRPTSDMNIASGLPLFCPLGKLLSSDHEYIKDNTLFIKIIVD 462          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2B4RHQ9 (TNF receptor-associated factor 3 OS=Stylophora pistillata OX=50429 GN=TRAF3 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.327e-35
Identity = 103/383 (26.89%), Postives = 190/383 (49.61%), Query Frame = 1
Query:  346 RQIENHLRICNMKCEK----CPYFEIGCKESEI-STEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVRE---QLKQA-----------MDEKVGGFNEN------TQISKKEDFVLYKCEKKLINA-NETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENY----GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            R++++H       CE     CP+ ++GC   E+ S  E   H+ Q  V H+ LL + I  +  EVE L +    L   + QL    + V+ D + +  +R    +++QA           ++ ++   N +       ++++  D  + +  ++L N  N+T++     V+     E+  +D  + +      +  S+  D+  +S+   +      +  +E  + ++ +    G+ LW + ++  K + A  G Q SF+S  FFT +YGYK+C RIY  G G G+G+H+S+FF VM  Q+D  L WP +  +TF + DQ++  +HV+   ++   PNSSS+++P  + NI  G P F  + EL SN     D+ +F++  V+
Sbjct:  184 RKLQDHQNPVFGDCESVEGPCPFSQLGCPMKEVLSQREKKKHMEQANVFHTSLLFQEILRMSKEVEGLLQRNPNLLSRQPQLLSNFDGVIQDILTQMQMRGDEIRVQQAKIREHSERITSLERRMASVNASETGPSAQRLNESADLPINENSRRLTNVENKTADHEVLLVENNRTMEEVKRDVGTMKRQLDTTQESSRRHDRRIESIEHTLALRNVTLADLEEYVRQQEFSSYDGQLLWKISDYARKRNDAVTGQQVSFYSPCFFTSRYGYKMCARIYLNGDGMGRGTHISIFFVVMRSQYDALLRWPFRQKVTFMLLDQDN-VEHVID--AFRPDPNSSSFQRPRRETNIASGCPMFCSLAEL-SNHAYVRDDAMFLKIIVD 562          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: E2RR95 (TNF receptor-associated factor OS=Canis lupus familiaris OX=9615 GN=TRAF5 PE=3 SV=3)

HSP 1 Score: 145.206 bits (365), Expect = 1.962e-34
Identity = 135/493 (27.38%), Postives = 233/493 (47.26%), Query Frame = 1
Query:   40 WETMKKMAFVSCQPVNHELTCLICKSIVINAHSGPCGCLYCFECIVTYLS-KGIRFCPGNTEE-----------CQVKTLNI----------NEDIVVDRXXXXXXX---XXXXXCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGC--KESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISK----KEDFVLYKCEKKLINANETSNEAANR--VKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESN---LEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLS-SDNKLFIRCSVN 1404
            +E   +  FV  +P+     C +C S++ N H   CG  +C  CI++      +  CP + E            C+ + LN+          N  I++ R  N   +   +  V CPNK CS      +++ HL +C    + CP+   GC  K+   S +E   H    + +H  L+LE    L  ++  L +++E+ + + +QL E V+     K  KE   +Q  Q    K G F  N Q+      K  ++  +  + L  AN+  N+   R  V+     +Q +    +N+      EG    T+K +  + I     ++Q+ K E     LE   Y G+ +W + ++  K  +A  G   S FS  F+T + GY+LC R Y  G G GKG+HLS++F VM G+FD+ L WP +  +T  + DQ    +H+++  ++++ P+SSS+++P  + NI  G P+F+    L +  N    D+ +F++ +V+
Sbjct:   27 FEPHTEYRFV--EPLEERYKCALCHSVLHNPHQTGCGHRFCQHCILSLRELNAVPLCPVDKEVIKSQEVFKDNCCKREVLNLYVYCKNAPGCNAKIILGRYQNHEENLCPEYPVPCPNK-CSQIIPRTEVDEHLTVCPEAEQDCPFKHYGCTVKDKRGSLQE---HEHSALRDHMLLVLEKNLQLEEQISDLYKSLEQKESKIQQLAETVK-----KFEKEF--KQFAQLFG-KNGSFLSNIQVLANHIDKSAWLEAQVRQLLQMANQQQNKFDLRPLVEAIDTVKQKITLLETNDQRLVVLEGE---TNKHDAHINIH----KAQLNKNEERFKLLEGACYNGKLIWKVTDYKMKKREALDGHTVSIFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIME--TFKADPSSSSFKRPDGEMNIASGCPRFVAHSTLENAKNTYIKDDTVFLKVAVD 496          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A485MBY1 (TNF receptor-associated factor OS=Lynx pardinus OX=191816 GN=LYPA_23C013043 PE=3 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 6.023e-34
Identity = 130/475 (27.37%), Postives = 226/475 (47.58%), Query Frame = 1
Query:  100 CLICKSIVINAHSGPCGCLYCFECIVTYLS-KGIRFCPGNTEE-----------CQVKTLNI----------NEDIVVDRXXXXXXX---XXXXXCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQE----IVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQ----ISKKEDFVLYKCEKKLINANETSNEAANR--VKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESN---LEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLS-SDNKLFIRCSVN 1404
            C  C S++ N H   CG  +C  CI++      +  CP + E            C+ + LN+          N  I++ R  N   +   +  V CPNK C       +++ HL +C    + CP+   GC     + ++  G++L+     + +H  L+LE    L  ++  L +++E+ + + +QL E V+     K  KE   +Q  Q +  K G F  N Q    +  K  ++  +  + L  AN+  N+   R  V+     +Q +    +N+      EG    T+K +  + I     ++Q+ K E     LE   Y G+ +W + ++  K  +A  G   S FS  F+T + GY+LC R Y  G G GKG+HLS++F VM G+FD+ L WP +  +T  + DQ    +H+++  ++++ PNSSS+++P  + NI  G P+F+    L S  N    D+ +F++ +V+
Sbjct:   45 CAFCHSVLHNPHQTGCGHRFCQHCILSLRELNAVPLCPVDKEVIKSQEVFKDNCCKREVLNLYVYCKNAPSCNAKIILGRYQNHEENLCPEYPVSCPNK-CLQMIPRSEVDEHLAVCPEAEQDCPFKHYGC-----TVKDKRGNLLEHEHSALRDHMLLVLEKNFQLEEQISDLYKSLEQKESKIQQLAETVK-----KFEKEF--KQFAQLLG-KNGSFLSNIQALASLIDKSAWLEAQVRQLLQVANQQQNKFDLRPLVEAIDTVKQKITLLETNDQRLVVLEGE---TNKHDAHINIH----KAQLNKNEERFKLLEGACYNGKLIWKVTDYKTKKREALDGHTVSIFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIME--TFKADPNSSSFKRPDGEMNIASGCPRFVAHSTLESAKNTYIKDDTVFLKVAVD 496          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: H3AKZ3 (TNF receptor-associated factor OS=Latimeria chalumnae OX=7897 GN=TRAF3 PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 7.851e-34
Identity = 110/374 (29.41%), Postives = 188/374 (50.27%), Query Frame = 1
Query:  310 CPNKNCSFKDELR-QIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEK----LQVEKKQLTE-EVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINAN-ETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKF-TDKSNKSLVIDVQNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            CP+K C+ K  LR ++ NHL  CN     C +   GC   + + +++  H    +V H  L+ +S   L  +V  L+  V++    LQ+   QL E E+EL           RE ++  M+ ++    + T+ S+ E F  ++ E + +  N E +N     V+   +    +++ S N   G +     +    + +++L +    L    L+ +  LE  +Y G  +W + ++  +  +A LG   S +S  F+T  +GYK+C R+Y  G G GKG+HLS+FF VM G++D  LPWP K  +T  + DQ S   H+    +++  PNSSS+++PT + NI  G P F+    L S   +  D+ +FI+  V+
Sbjct:  203 CPHK-CNIKPVLRSELHNHLSECNNAPSTCNFKRFGCT-FKGTNQQIKAHETNSVVQHVNLMKDSQSVLEAQVTRLQNEVQEKSKSLQIVGNQLCEHELEL--------SKCREYMRN-MESRLFRLEKVTE-SQAEKFKEFEKELRQLRINLEETNNTKGTVEALQSRVTQLENASKNLAHGTRSTAMLEAELSRHDQTLSVHSIRLADMDLRFQV-LETASYSGTLIWKIRDYKRRKQEAVLGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLLDQGSTRRHLGD--AFKPDPNSSSFKRPTGEMNIASGCPLFVAQTVLESGPYI-KDDTIFIKVIVD 560          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 119.783 bits (299), Expect = 9.645e-29
Identity = 105/377 (27.85%), Postives = 176/377 (46.68%), Query Frame = 1
Query:  310 CPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGC----KESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVR-EQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAAN-RVKGKSNSEQPMKDKSSNEVTGA---QCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLS--SDNKLFIRCSVN 1404
            CPNK C    +  ++++H   C  +   C Y + GC    K  ++   E +     E  +H  LLLES   L  +V+ L++     Q E K+       +++  + +E+ + +    AM   V    E     K+E     K  + ++ A+ T  E  + R    S  EQ    +S  E  GA    C+  ++  D       I VQ LQ    + +  LE  +Y G+ +W + ++  K         ++  S  F+T   GYKL  R+Y  G G  +G+HLS++  +M G FD+ LPWP + ++T  + DQ    +HV  S S+     S+++R+PTS+ N  +G P+FI   +L +  N +   D+ LFI+  V+
Sbjct:  197 CPNK-CIHLVKRHKLKDHADECPEQETDCIYKKYGCTVRNKRGQVKVHEQT-----EFNHHVLLLLESNSKLIKQVDQLQQDFAAQQGELKERN-----LLVSNLKREVSKCDTTVSAMQRSVEEQRELVSSVKRE----LKDLRDVLEADLTKEELVSLRASLDSLREQVAMTQSLREHLGALGQTCQSHTRLLD-------IHVQQLQCSEQRFQ-QLESTSYDGKLIWKVHDYHRKKEAG-----TALNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHV--SLSFTPDLASNNFRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKVD 543          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 1.804e-28
Identity = 54/149 (36.24%), Postives = 86/149 (57.72%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            G  +W + ++  +  +A      S +S  F+T  +GYK+C R+Y  G G GKG+HLS+FF VM G++D  LPWP K  +T  + DQ     H+    +++  PNSSS+R+PT + NI  G P F+  + +  N     D+ +FI+ +V+
Sbjct:    4 GTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHL--GDAFKPDPNSSSFRRPTGEMNIASGCPLFVA-QTVLENGTYIKDDTIFIKVTVD 149          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 117.087 bits (292), Expect = 8.498e-28
Identity = 58/150 (38.67%), Postives = 92/150 (61.33%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNIN-LSSDNKLFIRCSVN 1404
            G FLW + +  +K  +A  G +SS +S AF+T +YG+K+C+R+Y  G G GKG+H+S+FF +M G +D  L WP K  +TF + DQ    +HVV   ++     S+S+++P S+ N+  G P F  + +L S  +    D+ LFI+C V+
Sbjct:  392 GTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQ-REHVVD--AFRPDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVVD 538          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 116.701 bits (291), Expect = 8.773e-28
Identity = 58/150 (38.67%), Postives = 92/150 (61.33%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNIN-LSSDNKLFIRCSVN 1404
            G FLW + +  +K  +A  G +SS +S AF+T +YG+K+C+R+Y  G G GKG+H+S+FF +M G +D  L WP K  +TF + DQ    +HVV   ++     S+S+++P S+ N+  G P F  + +L S  +    D+ LFI+C V+
Sbjct:  369 GTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQ-REHVVD--AFRPDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVVD 515          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 115.931 bits (289), Expect = 1.011e-27
Identity = 58/149 (38.93%), Postives = 88/149 (59.06%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            G F+W + ++ +K   A  G   + FS AF+T KYGYK+CLRIY  G G G+G+HLS+FF VM G  D  L WP    +T  + DQ +  +H++   ++    +SSS+++P SD NI  G P F  + +L S  +   D+ +FI+  V+
Sbjct:  310 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIID--AFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 455          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 3.284e-31
Identity = 103/380 (27.11%), Postives = 174/380 (45.79%), Query Frame = 1
Query:  310 CPNKNCSFKDELRQ-IENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKR-------TVEKLQVEKKQLTEEVELVMIDKIVKE-----MVREQLKQAMDEKVGGFNENTQ-ISKKEDFVLYKCEKKLINANETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            CPNK C  +   R+ + +HL IC  K  +C + + GCK  + + + L  H       H  L+     NL  +V  L+        + + L    ++L  E EL+ + +   +      V +++     E++    E+ Q  +++ D    + +  L     T +E   RV     S   +   S+     A     S+     +  L      L    L+ +  LE  +Y G+ +W + ++  +   A  G   S +S  F+T  +GY++C R Y  G G G+G+HLS+FF VM G++D  LPWP +  +T  + DQ +    +  S +++  P SSS+R+PTSD NI  G P F+    L S   L  D+ +FI+  V+
Sbjct:  105 CPNK-CEEQSIAREELVSHLGICPYKQAECFFSQFGCK-YKGTLQGLKEHESGATQQHLSLVTARSANLELKVSMLQSQLAERANSADLLGTRVREL--EKELISVGQTASKNESVLCVVQRMLAVQTERLLRLQESMQGTTRRADHDALRGD--LDGTAATLHELGTRVAAIEESGGSVTHSSTPTRLAALDSALSRH----DTQLFAHDTRLAEMDLRFQV-LETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQL--SDTFKPDPASSSFRRPTSDMNIASGCPLFVSHVALESASYL-QDDTIFIKVVVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 1.339e-26
Identity = 54/156 (34.62%), Postives = 86/156 (55.13%), Query Frame = 1
Query:  940 LEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            LE   Y G+ +W + ++  +  +A  G   S +S  F+T  +GYK+C R Y  G G G+G+HLS+FF VM G++D  L WP +  +T  + DQ +   H+  S ++   P S S+R+P  D N+  G P F+    L  +  L  D+ +F+R  V+
Sbjct:  261 LETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHL--SDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYL-VDDTVFVRVVVD 413          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 78.1814 bits (191), Expect = 9.725e-16
Identity = 57/196 (29.08%), Postives = 91/196 (46.43%), Query Frame = 1
Query:  898 VQNLQSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQSSFFSDA-------------FFTHKYGYKLCLRI-------YPVGIG------EGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQ-ESGYDHVVQSCSYESKPNSSSYRKPTSDKNI-GIGIPKFIEIKELFSNINLSSDNKLFIRCSV 1401
            V++L++++ + ES L     G F W +E +         G+ S F SD              F+T   GY+LCLR+        P G         G+  HL++F H++ G +D+ LPWP K  I   + DQ E    HV +    ++ P  S++++P+  +N  G G   F++I  L     L  D+ L +RC V
Sbjct:  376 VRSLEARVAESESRL---CAGIFTWRVERFSRLL---PGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTE--MMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTLHHRSYL-RDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 2.429e-8
Identity = 45/192 (23.44%), Postives = 83/192 (43.23%), Query Frame = 1
Query:  622 MVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKSN-SEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQ--SSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKL 1188
            +V +  K+  ++ + G  +N  I       L   E +L   +    E A RV+     SE   +  + +    A+ +      + S++     +  L  ++ ++E+       G FLW +++   +  +A  G +      S AFFT +YGY+L LR+         G H+S +  +  G +D TL WP +L
Sbjct:  217 IVYDAFKKTFEQLIKGHADN--IKHPPSARLVAAEAQLATMDRRVEEVAKRVERDVRVSEASTRQGNIDRDETARLQNKMARVEHSDQETERSILGLTRRLAELENTAYN---GMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLC------RSGEHVSAYAMLGPGPYDATLAWPYQL 397          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 138.272 bits (347), Expect = 1.329e-35
Identity = 102/373 (27.35%), Postives = 176/373 (47.18%), Query Frame = 1
Query:  334 KDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDN---LRNEVESLKRTVEKLQV-EKKQLTEEVELVMIDK-----------IVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            +DEL  + +   IC      C + + GC   + + E L  H   +   H  LLL +  N    R+E+ +    +EK +  +++Q+ E+ E + +             +++  V EQ ++  + K     E  Q+ + E  +  +  +  +  NE S  AA                SS   +        +  D++   L +    L    LK++  LE  +Y G ++W ++ +  ++ +   G   S +S  F+  +YGYK C R+YP G G GKGSHLS+FF +M G+FD  LPWP +  +TFK+ DQ+  +D      ++   P SSS+++PTS+ NI  G P FI    L +   +  D+ +FI+ +V+
Sbjct:  178 RDEL--LHHQTNICEQAELPCSFAKHGC-HFKGTREALETHFRDQASVHVNLLLTATQNEEKARSEMAAKLSQMEKERAKQQEQMYEQREALAVANQNLRTYQGKLNVIERSVAEQRRELAELK-----ERIQLQEVEAAIREQDRRLGMIENEASRGAA---------------PSSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQM-LEATSYDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRVHD---IGDTFRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQTRAYV-RDDTMFIKIAVD 522          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 118.627 bits (296), Expect = 8.172e-29
Identity = 90/374 (24.06%), Postives = 175/374 (46.79%), Query Frame = 1
Query:  310 CPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVG--GFNENTQISKKED----FVLYKCEKKLINANETSNEAANRVKGKSNSE---QPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            CPN+    + E +++  H R C      C +  +GC   ++    L  H  + ++ H  LL  +    +  +  L+  +E+   E      E+E         +    Q+K+  +++    G  E T  ++K D    ++ +  E  +            +VK K+N E     MK     + +       ++   +   S+ I    L  + L+I+        G FLW ++ + E++ +AK G  +S +S  F+TH++GYKLC R++P G G  + ++LS+F  +M G++D+ LPWP +  IT  + DQ++G +    S +++  P S S+++PT + N+  G P+F   + +       ++N +F++  V+
Sbjct:  163 CPNECGVKRIERKKLSAHTRECPNALTDCRFSPLGCT-YKVKKIALREHQNKHVIKHMILLGRTTGEPQPNLLELENQLERFDGENTSFKTELER-------HKYEFAQMKERFNDQNARLGIVEKTVANQKGDIAEIWMRFDQENLVGEVRMRDKLKKFKVKTKANKECLLSLMKRLEVQDDSQTNPNKLNRRLSQLESSITIHKTKLFQEDLRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGMN---ISETFDPDPCSISFQRPTRNINVASGCPRFCS-QTVLRTRGYMNENCVFVKVVVD 524          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 105.531 bits (262), Expect = 1.730e-24
Identity = 52/147 (35.37%), Postives = 87/147 (59.18%), Query Frame = 1
Query:  964 FLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
             LW + N   K  +A  G  +SF+S  FFT  +GYK+C RIY  G G G+  H+S+FF +M G+FD  L WP +  +T  + DQ++  +HV+   ++   P+SSS+++P ++ NI  G P F   ++L  +  +  D+ +F++  V+
Sbjct:  335 LLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDN-VEHVID--AFRPDPSSSSFQRPRAEMNIASGCPLFCSHEQLTQHAYI-RDDTMFLKIIVD 477          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO37750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SER6])

HSP 1 Score: 100.908 bits (250), Expect = 4.688e-23
Identity = 52/177 (29.38%), Postives = 99/177 (55.93%), Query Frame = 1
Query:  886 LVIDVQNLQSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQES---GYDHVVQSCSYESKPNSSSYRKPTSDK-NIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            L I  Q   + + +I  + +  +  + LW ++++WE F + K    +   S  F+T  YGYK  + ++P G G G+G+HLS++  ++ G++D+ LPWP +  IT  + DQ +      H+ Q  S+   PN  S+++P+ +  ++G G P+F+  + L S I    D+ LF++ +++
Sbjct:  289 LAIQQQKEINSLKEIVRHCKPYHDSKLLWRIDDFWEAFDEGKRKPGTELHSPVFYTSNYGYKFKVVLFPYGNGSGEGTHLSLYIRLLPGEYDSLLPWPFEGQITLTLLDQSTDKRAKRHISQ--SFSPDPNWKSFQRPSKNSTSLGFGYPQFVSHRGLES-IGYVRDDVLFLKVTID 462          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 98.5969 bits (244), Expect = 3.073e-22
Identity = 126/488 (25.82%), Postives = 205/488 (42.01%), Query Frame = 1
Query:   79 PVNHELTCLICKSIVINAHSGPCGCLYCFECIVTYLS-KGIRFCPGNTEECQVKTLNINEDIVVDRXXXXXXXXXXXXCPNKNCSFKDELRQIENHLRI------------CNMKCEK---------CPYFEIGCKESEISTEELSGHILQEIVNH-SKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISK-KEDFVLYKCEK-KLINA-NETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQ---SQILKIESNLEKE-NYGEFLWILENWWEKFHQA---------KLGIQSS----------FFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQ-ESGYDHVVQSCSYESKPNSS-SYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFI 1389
            P N EL C IC  +V       CG  YC  CI  + + K +  CP + E  Q+K   I  D   DR       K    C N  C +K ELRQ + HL+I            CN+K  +         C +  + CK   +S  +      +E V H     L  +    +E+    +  E  + E  +   +  L     I  E +R+  +Q  D        + ++ K +++     C+  K +NA  E  +EA    KG+  +       +SN +   +     +  D   K L I  + ++    QI K+ +  + +   G F+W + N+ +K+ +A         K G   S            S  F+T +YGYK+ L+ YP G G+GKG+HLS+   +M G++D  L WP +  IT  + +Q E      V+    ++ P+    + +P  ++N+G G   FI   EL S  +   D+ +FI
Sbjct:   23 PPNDELICAICHMVVNEPVLTSCGHSYCKYCIEKWCNGKEVVTCPVDNE--QLKPSQIFPDKKTDRIVLSLEVK----CTNNPCRWKGELRQKQKHLKICSHKAVKCILEGCNVKVPRILMEKHTNTCGWRLLHCKPCNLSYPKKD----EETVQHKDDCPLAFLPCRFSEIGCTFKGRESARDEHCESAVQTHL----HIACETIRDNKEQISDL-------HKELDKVRQELQTKSCDHMKEVNAIREKHDEAIRDNKGQIEALSKEHGIASNTIHENK-----EQLDTLKKELGIASETIRKNRDQIAKLSTACKTQYTDGTFVWRICNYKDKYKKAVAFATNQEVKGGNSDSDDDISMAGDIMVSLPFYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQSEQWRSETVEIYPDDATPDKKHKFERPIENENVGCGYSCFISHMELNSG-DYIKDDVIFI 483          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 116.316 bits (290), Expect = 1.482e-27
Identity = 58/149 (38.93%), Postives = 87/149 (58.39%), Query Frame = 1
Query:  958 GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            G F+W + ++ +K   A  G   + FS AF+T KYGYK+CLRIY  G G G+G+HLS+FF VM G  D  L WP    +T  + DQ +  +H++   ++    +SSS+++P SD NI  G P F  + +L S  +   D  +FI+  V+
Sbjct:  420 GIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIID--AFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIVD 565          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 115.161 bits (287), Expect = 1.580e-27
Identity = 57/156 (36.54%), Postives = 90/156 (57.69%), Query Frame = 1
Query:  940 LEKENY-GEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            LE  +Y G  +W + ++  +   A  G   S +S  F+T  +GYK+C R+Y  G G GKG+HLS+FF VM G++D  LPWP K  +T  + DQ     H+    +++  P+SSS+R+P ++ NI  G P F+    L S   +  D+ +FI+ +V+
Sbjct:  291 LETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGD--AFKPDPSSSSFRRPVAEMNIASGCPLFVSQSVLESGTYI-KDDTIFIKVTVD 443          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 114.775 bits (286), Expect = 2.546e-27
Identity = 112/455 (24.62%), Postives = 194/455 (42.64%), Query Frame = 1
Query:  145 CGCLYCFECIVTYLSKGIRFCPGNTEECQVKTLNINEDIVVDRXXXXXXXXXXXXCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVL--------------YKCEKKLINANETSNEAANRVKGKSNSEQ---PMKDKSSNE-----VTGAQCEGFSKFTDKSNKSLVIDVQNLQSQ-ILKIESNLEK---ENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQE----SGYDHVVQSCSYESKPNSSSYRKPTSDKN------IGIGIPKFIEIKELFSNINLSSDNKLFIRCSV 1401
            CG  +C  C+  +LS+G+  CP   ++  +    I  D  +++       + +     + C +  +++Q++ H   C      CP     C   +++  +L  H+  +              ++ E    + T E  +  +    +E  +   +K    M+R  L Q    +     +  +   KE FV                +C  +    N    + AN VK    S     P KD            G   E     T KS+ +++ ++ + Q Q IL++   +E+    + G  +W L ++  K  +AKL     FFS  F+TH+YGYKL +  +  G G G+GSHLSV+  V+ G++DN L WP    +TF + DQ     S   H+ +  ++   PN  +++KP S +N      +G G PKFI  +E+    N   DN +FI+ S+
Sbjct:   34 CGHRFCDTCLQEFLSEGVFKCP--EDQLPLDYAKIYPDPELEQQILSLPIRCIHS--EEGCRWTGQMKQLQGHFSTCAFNVIPCPN---RC-SVKLTRRDLPDHLQHDCPKR---------KVKCEFCGSEFTGEAFENHQGVCPQE-SVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKE-FVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLED----TTKSHLTMMCNLVSRQRQEILELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITE--TFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEI-KKRNYIRDNCIFIKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 114.39 bits (285), Expect = 4.255e-27
Identity = 112/455 (24.62%), Postives = 194/455 (42.64%), Query Frame = 1
Query:  145 CGCLYCFECIVTYLSKGIRFCPGNTEECQVKTLNINEDIVVDRXXXXXXXXXXXXCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVL--------------YKCEKKLINANETSNEAANRVKGKSNSEQ---PMKDKSSNE-----VTGAQCEGFSKFTDKSNKSLVIDVQNLQSQ-ILKIESNLEK---ENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQE----SGYDHVVQSCSYESKPNSSSYRKPTSDKN------IGIGIPKFIEIKELFSNINLSSDNKLFIRCSV 1401
            CG  +C  C+  +LS+G+  CP   ++  +    I  D  +++       + +     + C +  +++Q++ H   C      CP     C   +++  +L  H+  +              ++ E    + T E  +  +    +E  +   +K    M+R  L Q    +     +  +   KE FV                +C  +    N    + AN VK    S     P KD            G   E     T KS+ +++ ++ + Q Q IL++   +E+    + G  +W L ++  K  +AKL     FFS  F+TH+YGYKL +  +  G G G+GSHLSV+  V+ G++DN L WP    +TF + DQ     S   H+ +  ++   PN  +++KP S +N      +G G PKFI  +E+    N   DN +FI+ S+
Sbjct:   34 CGHRFCDTCLQEFLSEGVFKCP--EDQLPLDYAKIYPDPELEQQILSLPIRCIHS--EEGCRWTGQMKQLQGHFSTCAFNVIPCPN---RC-SVKLTRRDLPDHLQHDCPKR---------KVKCEFCGSEFTGEAFENHQGVCPQE-SVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKE-FVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLED----TTKSHLTMMCNLVSRQRQEILELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITE--TFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEI-KKRNYIRDNCIFIKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 113.62 bits (283), Expect = 5.308e-27
Identity = 79/250 (31.60%), Postives = 123/250 (49.20%), Query Frame = 1
Query:  718 KCEKKLINANETSNEAANRVKGKSNSEQ---PMKDKSSNE-----VTGAQCEGFSKFTDKSNKSLVIDVQNLQSQ-ILKIESNLEK---ENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQE----SGYDHVVQSCSYESKPNSSSYRKPTSDKN------IGIGIPKFIEIKELFSNINLSSDNKLFIRCSV 1401
            +C  +    N    + AN VK    S     P KD            G   E     T KS+ +++ ++ + Q Q IL++   +E+    + G  +W L ++  K  +AKL     FFS  F+TH+YGYKL +  +  G G G+GSHLSV+  V+ G++DN L WP    +TF + DQ     S   H+ +  ++   PN  +++KP S +N      +G G PKFI  +E+    N   DN +FI+ S+
Sbjct:  213 QCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLED----TTKSHLTMMCNLVSRQRQEILELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITE--TFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEI-KKRNYIRDNCIFIKASI 455          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000067216.1 (SMESG000067216.1)

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 459/459 (100.00%), Postives = 459/459 (100.00%), Query Frame = 1
Query:   28 MESLWETMKKMAFVSCQPVNHELTCLICKSIVINAHSGPCGCLYCFECIVTYLSKGIRFCPGNTEECQVKTLNINEDIVVDRXXXXXXXXXXXXCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            MESLWETMKKMAFVSCQPVNHELTCLICKSIVINAHSGPCGCLYCFECIVTYLSKGIRFCPGNTEECQVKTLNINEDIVVDRSSNVSVSKLVVKCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN
Sbjct:    1 MESLWETMKKMAFVSCQPVNHELTCLICKSIVINAHSGPCGCLYCFECIVTYLSKGIRFCPGNTEECQVKTLNINEDIVVDRSSNVSVSKLVVKCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 459          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025566.1 (SMESG000025566.1)

HSP 1 Score: 295.434 bits (755), Expect = 2.322e-95
Identity = 159/461 (34.49%), Postives = 270/461 (58.57%), Query Frame = 1
Query:   28 MESLWETMKKMAFVSCQPVNHELTCLICKSIVINAHSGPCGCLYCFECIVTYLSKGIRFCPGNTEECQVKTLNINEDIVVDRXXXXXXXXXXXXCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKS--NSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            +E++W+ +    + S   + H++ CL+CK ++INA + PCGC +CF CI  +L    + CPGNTE C+++ L++N +I VD   N+ +S++ VKC  K+C F DEL ++E+H R C  +   CPY  IGC +  IS ++++ H+  EI+ H+KLL++   N  NE+E LK     L+ E K L  E+  + +D    E  RE++ +     +    EN  + +  + ++   E+  +   +   + A++V+     N E P   K+  E+           ++K +KS+     N+  ++L++E+N  + NYGEF W L+ + +K   AK GI +  +S++F THK  YK+CL + P G G+GKG+HL+V FH+M G+FD  L WP +  +T  + +Q +   HV ++ +  + PNS +  +PT D+N G+G P+F+  +EL SN +L  +N++FI+CSV+
Sbjct:    6 LENVWQIIINNKYESLAEIQHDMQCLLCKKLLINARNAPCGCRFCFSCISGFLDNENKICPGNTEFCKLEKLDMNINICVDNPINIKISQIKVKCAEKSCEFVDELIKMEDHSRTCKYRSAACPYSNIGCDKCNISLDKVADHLQSEILTHTKLLMDFFGNFNNEMEMLKTNNYGLRAENKLLRNEINELKLD---GERRREEIAELQRNIICLNGENVAMREIMNKLISDWERNRVEIGDLQRKCADQVEEIKLLNLEMPTSRKNLTEI-----------SNKIDKSM----DNVDRKLLEMEANQNQLNYGEFAWKLDKFTDKMAHAKNGINTDIYSESFLTHKNSYKMCLSVNPDGFGDGKGTHLTVGFHLMKGEFDEILEWPFRYSVTLALINQRTRLPHVCKTTNCANNPNSKALIQPT-DRNGGMGFPQFVSHEELASNPDLMRNNQIFIKCSVD 447          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000026628.1 (SMESG000026628.1)

HSP 1 Score: 278.1 bits (710), Expect = 1.186e-88
Identity = 151/435 (34.71%), Postives = 261/435 (60.00%), Query Frame = 1
Query:  100 CLICKSIVINAHSGPCGCLYCFECIVTYLSKGIRFCPGNTEECQVKTLNINEDIVVDRXXXXXXXXXXXXCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            C+IC +I IN  S  CGC YC++CI  YL+   + CPG   +C+ + LNI  DI++D+S    +S+++VK P +   F D++++I+N +         CP+  IGC+  +   EE+  H+  + ++HSKLL++SI +L++E++S+K  +   + E K+L +E+E++  D   KE +   L   M++++         +++ +++  +  +   +++ET       V  KS          S   + +Q    SK  DK        +     Q+ KIE  LE  N+GEF+WI++++ +K ++A+  I + F+SD+FFTHK GYK+CLR+ P+GI  GKGSHL+++F +M G FDN L WP K D+TF + DQ +GY H+ ++  ++  P++ ++ KPT++K IG G  KFIEI+EL  N ++  ++++FI+C+V+
Sbjct:   30 CVICNNIPINLCSSLCGCKYCWDCIENYLNGKDKCCPGLLVDCENQILNIENDILLDQSLTSRISRVIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDL--LMNDRMK--------TEQIEYLFQQLHQSDSDSDET---QYTHVDDKSEVSSVRTMSISRSASHSQ-RSISKINDK--------LSRFDRQLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVH 442          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025794.1 (SMESG000025794.1)

HSP 1 Score: 278.1 bits (710), Expect = 1.186e-88
Identity = 161/467 (34.48%), Postives = 267/467 (57.17%), Query Frame = 1
Query:   28 MESLWETMKKMAFVSCQPVNHELTCLICKSIVINAHSGPCGCLYCFECIVTYLSKGIRFCPGNTEECQVKTLNINEDIVVDRXXXXXXXXXXXXCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEK-KLINANETSNEAANR-VKGKSNSEQPMKDKSSNEVTG--AQCEGFSK--FTDKSNKSLVID--VQNLQSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            +E++W+ M+   + S   + +++ C +CK +++NA   PCGC +CF CI  +L    + CPG+TEEC+ + L++NE+I VD   N+ +SKL VKC   +C + DELR++E+H R C  +   CPY  IGC +  IS ++++ H+  EI  H+KLL++ + N  NE+E LK     L                   V E++R ++ +    K+ G     +I+  +     + E+ +L+N +  +    +R V  + +  Q + + +  E+     Q E   K   T+ SNK   ID    N+  ++L++ +N  +   GEF+W L+ + +K   AK GI +  +S++F THK G+K+CLR+ P G G GKG+HLSVFFH+M G+FD  L WP +  +TF + +Q +   HV ++    + PN  +  +PT D+N G+G PKF+  +EL SN +L  +N++FI+CSV+
Sbjct:    6 LENVWQIMRDYNYESVTEIQNDMLCFLCKKLLVNARCAPCGCRFCFTCISDFLDHKEKICPGDTEECKQEMLHLNENICVDYPMNIKISKLQVKCKEMSCVYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSA-----------------VNELLRNEINEL---KLDGERRRVEIADLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQKELIDKIGQMENKQKVDLTEMSNK---IDKLSGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKNGINTRIYSESFLTHKNGFKMCLRVDPDGNGGGKGTHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKTVKCANYPNDKALIQPT-DRNAGLGFPKFVSHEELSSNPDLMRNNQIFIKCSVD 448          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000026111.1 (SMESG000026111.1)

HSP 1 Score: 277.715 bits (709), Expect = 2.100e-88
Identity = 161/466 (34.55%), Postives = 271/466 (58.15%), Query Frame = 1
Query:   28 MESLWETMKKMAFVSCQPVNHELTCLICKSIVINAHSGPCGCLYCFECIVTYLSKGIRFCPGNTEECQVKTLNINEDIVVDRXXXXXXXXXXXXCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGF----NENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLE---KENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVN 1404
            +E++W+ MK     +   + +E++CL+CK +++NAHS PCGC +C  CI  YL     +CPG+T++C+++ ++++E+I+VDR  NV +SKL+VKCP   C F+ ELR++E+H+R+CN +  +CPY  IGC +S+IS+++++ H+  EI+ H+KLL++ + N  NE+ +LK    +L+ E K L  E+  + ++   ++    +L++  DEK        +EN  I K  D       K ++ A     E AN    +    + MK  + + +      G  KFTD+ + SL ++V+  +  +    S++E   +   GEF+W +EN  +K   AK GI  SF+S AF +H  GYK+ L +YP G   G G+HLSV+F +M G+FD+ L WP +  +TF + +Q +   H      YE   +  ++ KP S      G  +FI  ++L +N  LS  N++FI+ ++N
Sbjct:    5 LENVWKFMKTYNLETVVEIENEMSCLLCKKVLVNAHSAPCGCRFCLTCISQYLCDRKIYCPGDTDDCKLELISMSENIIVDRPVNVRISKLIVKCPEILCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKSKISSDKIADHLQSEILMHTKLLMDFVGNFHNEMNTLKTNNNELREENKLLRIEINELKLNCERRQGEIAELRRESDEKTVDIICLKDENVLIRKTVD-------KLILGAENNKAELANLRGNREEDSKSMKSFNQDRM------GRKKFTDEFD-SLKLNVEQNKFAVSDKASSMETAVQTINGEFVWKIENISDKIVGAKNGINQSFYSKAFISHSNGYKMILSLYPDGFDIGMGTHLSVYFCLMKGEFDDILEWPFRHSVTFALINQRTRLAHFSGDLDYELDIDGDAFCKPVSKCGSEFGFHQFISHRDLSANPELSLKNQIFIKFNIN 456          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF56.884e-3128.72TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF56.884e-3128.72TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF56.884e-3128.72TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF31.059e-3027.39TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.059e-3027.39TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-13.050e-1124.12TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-21.169e-925.12TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf45.255e-1831.40gene:FBgn0026319 transcript:FBtr0334401[more]
Traf47.538e-1831.40gene:FBgn0026319 transcript:FBtr0077429[more]
Traf-like4.132e-928.77gene:FBgn0030748 transcript:FBtr0308606[more]
Traf-like4.132e-928.77gene:FBgn0030748 transcript:FBtr0074274[more]
Traf-like4.132e-928.77gene:FBgn0030748 transcript:FBtr0334036[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX901915.13.220e-2938.93pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.13.220e-2938.93pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
traf37.289e-2926.93TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
unm_sa8081.709e-2838.26un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
traf2a1.797e-2738.93Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh23.089e-3026.34slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
hspb65.300e-3040.63heat shock protein family B (small) member 6 [Sour... [more]
ssh21.111e-2825.85slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
slc12a11.550e-2437.75solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a11.649e-2437.75solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf32.324e-3027.13TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf32.441e-2937.18TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf32.441e-2937.18TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf53.610e-2936.67TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf53.610e-2936.67TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70191|TRAF5_MOUSE2.832e-3027.27TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|O00463|TRAF5_HUMAN3.306e-3028.72TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
sp|Q13114|TRAF3_HUMAN5.087e-3027.39TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q60803|TRAF3_MOUSE1.625e-2927.13TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|P39428|TRAF1_MOUSE3.889e-2838.00TNF receptor-associated factor 1 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M7SUK31.574e-3528.73TNF receptor-associated factor 2 isoform X2 OS=Bra... [more]
A0A2B4RHQ93.327e-3526.89TNF receptor-associated factor 3 OS=Stylophora pis... [more]
E2RR951.962e-3427.38TNF receptor-associated factor OS=Canis lupus fami... [more]
A0A485MBY16.023e-3427.37TNF receptor-associated factor OS=Lynx pardinus OX... [more]
H3AKZ37.851e-3429.41TNF receptor-associated factor OS=Latimeria chalum... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf59.645e-2927.85TNF receptor-associated factor 5 [Source:NCBI gene... [more]
ENSAMXT00000035169.11.804e-2836.24pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf18.498e-2838.67TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf18.773e-2838.67TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf2a1.011e-2738.93TNF receptor-associated factor 2-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.13.284e-3127.11pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.11.339e-2634.62pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf69.725e-1629.08TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.12.429e-823.44pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494641.329e-3527.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352378.172e-2924.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388731.730e-2435.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377504.688e-2329.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483943.073e-2225.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020861.21.482e-2738.93TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf31.580e-2736.54TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf4a2.546e-2724.62TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a4.255e-2724.62TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a5.308e-2731.60TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067216.10.000e+0100.00SMESG000067216.1[more]
SMESG000025566.12.322e-9534.49SMESG000025566.1[more]
SMESG000026628.11.186e-8834.71SMESG000026628.1[more]
SMESG000025794.11.186e-8834.48SMESG000025794.1[more]
SMESG000026111.12.100e-8834.55SMESG000026111.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006469 ID=SMED30006469|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1405bp
AATCTATATAAATCTTATATGATACCTATGGAGAGTCTATGGGAAACGAT
GAAGAAAATGGCTTTTGTAAGTTGTCAACCAGTTAACCACGAATTGACTT
GCCTAATTTGTAAAAGTATAGTGATAAATGCCCATAGCGGACCTTGCGGC
TGTCTGTATTGTTTTGAATGCATTGTAACTTACTTGTCTAAAGGGATTCG
ATTTTGTCCTGGAAACACCGAAGAATGCCAAGTGAAAACCTTAAACATTA
ATGAAGATATTGTTGTAGACCGCTCGTCAAATGTCTCAGTTTCAAAACTG
GTGGTGAAATGTCCGAATAAAAATTGCTCCTTCAAAGACGAGTTAAGACA
AATCGAGAACCACTTGCGAATCTGCAACATGAAATGTGAAAAATGCCCTT
ACTTCGAGATCGGATGCAAGGAATCTGAAATCTCAACAGAAGAATTGAGT
GGTCATATTCTACAGGAAATTGTGAACCATTCGAAACTATTACTGGAATC
TATTGATAATTTGAGAAACGAAGTCGAGTCGTTAAAACGAACGGTTGAAA
AATTGCAAGTTGAAAAGAAACAATTGACCGAGGAAGTTGAGTTGGTTATG
ATTGACAAAATTGTGAAAGAAATGGTGAGAGAACAGTTGAAGCAAGCCAT
GGATGAGAAGGTCGGAGGATTTAATGAGAATACACAAATTTCCAAAAAAG
AGGATTTCGTACTATATAAATGTGAAAAGAAATTGATAAACGCCAATGAG
ACAAGTAATGAAGCAGCCAATCGGGTGAAAGGAAAATCAAATTCAGAACA
ACCAATGAAAGATAAATCGTCCAATGAGGTCACAGGGGCCCAATGTGAAG
GATTTTCCAAATTCACAGATAAATCCAACAAATCTCTTGTAATTGATGTA
CAAAATTTGCAATCGCAAATCCTTAAAATTGAATCGAATTTAGAAAAAGA
GAATTATGGAGAATTTTTGTGGATTTTGGAAAATTGGTGGGAAAAGTTTC
ACCAAGCAAAATTGGGTATTCAATCGAGTTTTTTTAGTGATGCATTTTTT
ACACATAAATATGGATACAAACTTTGCTTGAGGATCTATCCAGTTGGCAT
CGGGGAGGGAAAGGGTTCCCACTTGTCCGTGTTCTTTCACGTTATGTCCG
GCCAATTCGATAACACATTACCGTGGCCTTGTAAACTGGATATCACATTC
AAAATGTCCGATCAGGAATCCGGATACGATCATGTGGTTCAATCATGCAG
CTATGAAAGTAAACCAAATTCATCCTCATACAGAAAACCGACCAGTGACA
AAAATATTGGCATAGGCATTCCCAAATTTATTGAAATTAAAGAATTATTT
TCAAACATTAATTTGAGTAGTGATAACAAATTATTTATAAGATGTTCCGT
AAACA
back to top

protein sequence of SMED30006469-orf-1

>SMED30006469-orf-1 ID=SMED30006469-orf-1|Name=SMED30006469-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=468bp
NLYKSYMIPMESLWETMKKMAFVSCQPVNHELTCLICKSIVINAHSGPCG
CLYCFECIVTYLSKGIRFCPGNTEECQVKTLNINEDIVVDRSSNVSVSKL
VVKCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELS
GHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVM
IDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANE
TSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDV
QNLQSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFF
THKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITF
KMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELF
SNINLSSDNKLFIRCSVN
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0007250activation of NF-kappaB-inducing kinase activity
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0046328regulation of JNK cascade
GO:0051865protein autoubiquitination
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000240body wall musculature
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR008974TRAF-like
IPR001293Znf_TRAF
IPR002083MATH/TRAF_dom
IPR013083Znf_RING/FYVE/PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 154..195
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 245..269
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 17..460
NoneNo IPR availableCDDcd16449RING-HCcoord: 27..63
e-value: 8.528E-6
score: 40.5285
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 21..77
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 326..442
e-value: 5.7E-8
score: 42.5
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 312..460
score: 18.192
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 273..461
e-value: 5.0E-46
score: 158.7
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 92..148
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 313..460
IPR001293Zinc finger, TRAF-typePFAMPF02176zf-TRAFcoord: 91..145
e-value: 4.5E-6
score: 27.3
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 9..128
e-value: 7.9E-13
score: 50.4
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 17..460