TCF15

Overview
NameTCF15 (AFD29618.1)
Smed IDSMED30006464
Length (bp)686
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TCF15 (SMED30006464) t-SNE clustered cells

Violin plots show distribution of expression levels for TCF15 (SMED30006464) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TCF15 (SMED30006464) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TCF15 (SMED30006464) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006464

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30006464SMESG000044395.1 SMED30006464smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30006464SMESG000044395.1 SmedASXL_003781SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Category 2 cellSMED30006464SMESG000044395.1 SMED30006464smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30006464SMESG000044395.1 SMED30006464smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Category 3 cellSMED30006464SMESG000044395.1 SMED30006464smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30006464SMESG000044395.1 SMED30006464smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30006464SMESG000044395.1 SMED30006464smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30006464SMESG000044395.1 dd_Smed_v4_4998_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006464SMESG000044395.1 dd_Smed_v4_4998_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006464SMESG000044395.1 dd_Smed_v4_4998_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006464SMESG000044395.1 dd_Smed_v4_4998_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006464SMESG000044395.1 dd_Smed_v4_4998_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006464SMESG000044395.1 dd_Smed_v4_4998_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006464SMESG000044395.1 dd_Smed_v4_4998_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30006464SMESG000044395.1 dd_Smed_v4_4998_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006464SMESG000044395.1 dd_Smed_v4_4998_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30006464SMESG000044395.1 AFD29618smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
progenitor cellSMED30006464SMESG000044395.1 AFD29618smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
stem cellSMED30006464SMESG000044395.1 AFD29618smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30006464SMESG000044395.1 AFD29618smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30006464SMESG000044395.1 SMED_02941_V2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30006464SMESG000044395.1 SMED_02941_V2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TCF15 vs. Ensembl Human
Match: TCF15 (transcription factor 15 [Source:HGNC Symbol;Acc:HGNC:11627])

HSP 1 Score: 78.1814 bits (191), Expect = 3.183e-17
Identity = 42/92 (45.65%), Postives = 55/92 (59.78%), Query Frame = -2
Query:  206 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSID-QPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCL 478
            VN AF ALR +IPTEP++RKLSKIET+RLA+SYI HL  +L+ G  + D QPC +             +   AV   +   +  R +CTFCL
Sbjct:   88 VNTAFTALRTLIPTEPVDRKLSKIETVRLASSYIAHLANVLLLGDSADDGQPCFRAAG----------SAKGAVPAAADGGRQPRSICTFCL 169          
BLAST of TCF15 vs. Ensembl Human
Match: SCX (scleraxis bHLH transcription factor [Source:HGNC Symbol;Acc:HGNC:32322])

HSP 1 Score: 77.411 bits (189), Expect = 7.190e-17
Identity = 46/107 (42.99%), Postives = 62/107 (57.94%), Query Frame = -2
Query:  185 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCLKGITEPNLDQSYFKTNPIA------VSDLSTDFKSARP--VCTFCLRDFKLLS 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI+HL  +L+ G +C   QPC  G        ++F                + D ++ +P  +CTFCL + + LS
Sbjct:   91 VNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLAGEACGDGQPCHSGP-------AFFHAARAGSPPPPPPPPPARDGENTQPKQICTFCLSNQRKLS 190          
BLAST of TCF15 vs. Ensembl Human
Match: TAL2 (TAL bHLH transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:11557])

HSP 1 Score: 50.0618 bits (118), Expect = 1.223e-7
Identity = 28/50 (56.00%), Postives = 34/50 (68.00%), Query Frame = -2
Query:  329 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSIDQ 478
            VN AF  LR++IPT P ++KLSK ETLRLA  YIN L  +L  G  S+ Q
Sbjct:   18 VNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVL--GEQSLQQ 65          
BLAST of TCF15 vs. Ensembl Human
Match: TWIST1 (twist family bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:12428])

HSP 1 Score: 50.0618 bits (118), Expect = 2.254e-7
Identity = 29/54 (53.70%), Postives = 38/54 (70.37%), Query Frame = -2
Query:  338 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLIT-------GSCS 478
            +NEAF ALR+IIPT P + KLSKI+TL+LAA YI+ L+ +L +        SCS
Sbjct:   57 LNEAFAALRKIIPTLPSD-KLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCS 109          
BLAST of TCF15 vs. Ensembl Human
Match: TWIST2 (twist family bHLH transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:20670])

HSP 1 Score: 50.0618 bits (118), Expect = 3.174e-7
Identity = 26/41 (63.41%), Postives = 34/41 (82.93%), Query Frame = -2
Query:  356 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 478
            +NEAF ALR+IIPT P + KLSKI+TL+LAA YI+ L+ +L
Sbjct:   82 LNEAFAALRKIIPTLPSD-KLSKIQTLKLAARYIDFLYQVL 121          
BLAST of TCF15 vs. Ensembl Celegans
Match: hlh-13 (Helix-loop-helix protein 13 [Source:UniProtKB/Swiss-Prot;Acc:Q20561])

HSP 1 Score: 45.8246 bits (107), Expect = 2.980e-6
Identity = 23/43 (53.49%), Postives = 30/43 (69.77%), Query Frame = -2
Query:  350 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLIT 478
            +N AF+ LR  IPT P  ++LSKI+TL LA +YIN L  +L T
Sbjct:   57 INVAFIELRNYIPTFPYEKRLSKIDTLNLAIAYINMLDDVLRT 99          
BLAST of TCF15 vs. Ensembl Fly
Match: CG33557 (gene:FBgn0053557 transcript:FBtr0091534)

HSP 1 Score: 67.781 bits (164), Expect = 5.019e-14
Identity = 35/54 (64.81%), Postives = 42/54 (77.78%), Query Frame = -2
Query:  320 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGS-CSIDQPCL 478
            VN A+ ALR +IPTEP+NRKLSKIE +RLA+SYI HL + L TG+ C   QPCL
Sbjct:   77 VNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTEC---QPCL 127          
BLAST of TCF15 vs. Ensembl Fly
Match: cato (gene:FBgn0024249 transcript:FBtr0087183)

HSP 1 Score: 49.2914 bits (116), Expect = 4.435e-7
Identity = 24/49 (48.98%), Postives = 32/49 (65.31%), Query Frame = -2
Query:  332 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSID 478
            +N AF  LRE++P   I++KLSK ETL++A SYI  L  LL  G   +D
Sbjct:  119 LNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILALCDLLNNGDVEVD 167          
BLAST of TCF15 vs. Ensembl Zebrafish
Match: scxa (scleraxis bHLH transcription factor a [Source:ZFIN;Acc:ZDB-GENE-060503-414])

HSP 1 Score: 83.1889 bits (204), Expect = 2.652e-19
Identity = 47/101 (46.53%), Postives = 63/101 (62.38%), Query Frame = -2
Query:  185 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARP--VCTFCLRDFKLLS 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI+HL  +L+ G +C   QPC  G   P+    Y           S D ++++P  +CTFCL + + +S
Sbjct:   95 VNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLVGEACGDGQPCHSG--GPSTSNYYHHHG-----SPSRDSENSQPKQICTFCLSNQRKMS 188          
BLAST of TCF15 vs. Ensembl Zebrafish
Match: scxb (scleraxis bHLH transcription factor b [Source:ZFIN;Acc:ZDB-GENE-090806-1])

HSP 1 Score: 82.4185 bits (202), Expect = 5.676e-19
Identity = 44/98 (44.90%), Postives = 61/98 (62.24%), Query Frame = -2
Query:  188 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCLRDFKLL 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI+HL  +L+ G  C   QPCL+  +  +L   +   +  +     ++    R +CTFCL + + L
Sbjct:   93 VNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLVGEECGDGQPCLR--SSGSLFHHHHNVSKSSTPSPDSENSQPRQICTFCLSNQRRL 188          
BLAST of TCF15 vs. Ensembl Zebrafish
Match: si:ch211-246m6.4 (si:ch211-246m6.4 [Source:ZFIN;Acc:ZDB-GENE-050208-498])

HSP 1 Score: 81.2629 bits (199), Expect = 1.166e-18
Identity = 47/100 (47.00%), Postives = 62/100 (62.00%), Query Frame = -2
Query:  188 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGS-CSIDQPCLK--GITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCLRDFKLL 478
            VN AF +LR +IPTEP +RKLSKIETLRLA+SYI+HL  +L+ G  C   QPCLK   I + N +    K+ P+            RP+CTFCL + + +
Sbjct:   99 VNTAFTSLRTLIPTEPADRKLSKIETLRLASSYISHLANVLLLGEDCRDGQPCLKYHNILQSNAN---LKSPPV------------RPICTFCLSNQRKM 183          
BLAST of TCF15 vs. Ensembl Zebrafish
Match: tcf15 (transcription factor 15 [Source:ZFIN;Acc:ZDB-GENE-980605-20])

HSP 1 Score: 81.2629 bits (199), Expect = 1.174e-18
Identity = 43/92 (46.74%), Postives = 54/92 (58.70%), Query Frame = -2
Query:  206 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSID-QPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCL 478
            VN AF ALR +IPTEP++RKLSKIETLRLA+SYI+HL  +L+ G    D QPC+  +     D               +  K  R +CTFCL
Sbjct:   80 VNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLIGDGGEDAQPCVSAVYSAQGD---------------SGGKQPRTICTFCL 156          
BLAST of TCF15 vs. Ensembl Zebrafish
Match: CR626923.2 (scleraxis bHLH transcription factor b [Source:NCBI gene;Acc:567817])

HSP 1 Score: 80.1073 bits (196), Expect = 3.864e-18
Identity = 46/100 (46.00%), Postives = 62/100 (62.00%), Query Frame = -2
Query:  188 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARP--VCTFCLRDFKLL 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI+HL  +L+ G  C   QPCL+              +  + S  S D ++++P  +CTFCL + + L
Sbjct:   93 VNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLVGEECGDGQPCLR--------------SSGSFSTPSPDSENSQPRQICTFCLSNQRRL 178          
BLAST of TCF15 vs. Ensembl Xenopus
Match: mrps15 (mitochondrial ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-1016472])

HSP 1 Score: 84.3445 bits (207), Expect = 2.843e-19
Identity = 48/102 (47.06%), Postives = 62/102 (60.78%), Query Frame = -2
Query:  188 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCLKGITEPNLDQSYFKTNPIA--VSDLSTDFKSARP--VCTFCLRDFKLL 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI+HL  +L+ G +C   QPC  G         Y+  +P A   S    D +  +P  +CTFCL + + L
Sbjct:   79 VNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLLGDTCGDGQPCHTG-------GPYYPPHPAAATASPKHRDGEQGQPKQICTFCLSNQRKL 173          
BLAST of TCF15 vs. Ensembl Xenopus
Match: tcf15 (transcription factor 15 [Source:NCBI gene;Acc:549260])

HSP 1 Score: 79.7221 bits (195), Expect = 2.971e-18
Identity = 43/92 (46.74%), Postives = 53/92 (57.61%), Query Frame = -2
Query:  206 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCL 478
            VN AF ALR +IPTEP++RKLSKIETLRLA+SYI+HL  +L+ G  C   QPC   +                     +D K  R +CTFCL
Sbjct:   78 VNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLLGEGCQDGQPCFSTVYRAK----------------DSDGKVPRSICTFCL 153          
BLAST of TCF15 vs. Ensembl Xenopus
Match: hnrnpc (heterogeneous nuclear ribonucleoprotein C (C1/C2) [Source:Xenbase;Acc:XB-GENE-489141])

HSP 1 Score: 79.337 bits (194), Expect = 7.355e-18
Identity = 43/92 (46.74%), Postives = 53/92 (57.61%), Query Frame = -2
Query:  206 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCL 478
            VN AF ALR +IPTEP++RKLSKIETLRLA+SYI+HL  +L+ G  C   QPC   +                     +D K  R +CTFCL
Sbjct:   78 VNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLLGEGCQDGQPCFSTVYRAK----------------DSDGKVPRSICTFCL 153          
BLAST of TCF15 vs. Ensembl Xenopus
Match: adra1d (adrenoceptor alpha 1D [Source:Xenbase;Acc:XB-GENE-6050827])

HSP 1 Score: 78.9518 bits (193), Expect = 1.739e-17
Identity = 44/98 (44.90%), Postives = 60/98 (61.22%), Query Frame = -2
Query:  188 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGS-CSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCLRDFKLL 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI+HL  +L+ G  C   QPCL+           ++++  +         + RP+CTFCL + + L
Sbjct:  118 VNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLANILLLGEDCMDGQPCLQ-----------YRSSMASA--------APRPICTFCLSNQRKL 196          
BLAST of TCF15 vs. Ensembl Xenopus
Match: gsk3b (glycogen synthase kinase 3 beta [Source:Xenbase;Acc:XB-GENE-487098])

HSP 1 Score: 51.2174 bits (121), Expect = 2.115e-7
Identity = 36/76 (47.37%), Postives = 45/76 (59.21%), Query Frame = -2
Query:  344 SITNFNFNFLLSKMGIXXXXXXXXXXXXXXSVNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGS 571
            S T      L  K+G  K +  ++ER RT S+N AF  LRE IP  P + KLSKI+TLRLA SYI +L  +L   S
Sbjct:   65 SQTPGRMETLGGKLGRRKGAPPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIGYLMDVLAKDS 140          
BLAST of TCF15 vs. Ensembl Mouse
Match: Tcf15 (transcription factor 15 [Source:MGI Symbol;Acc:MGI:104664])

HSP 1 Score: 79.7221 bits (195), Expect = 6.248e-18
Identity = 44/92 (47.83%), Postives = 55/92 (59.78%), Query Frame = -2
Query:  206 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSID-QPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCL 478
            VN AF ALR +IPTEP++RKLSKIETLRLA+SYI HL  +L+ G  + D QPC +                 AV   + D +  R +CTFCL
Sbjct:   86 VNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVLLLGDAADDGQPCFRAAG----------GGKSAVP--AADGRQPRSICTFCL 165          
BLAST of TCF15 vs. Ensembl Mouse
Match: Scx (scleraxis [Source:MGI Symbol;Acc:MGI:102934])

HSP 1 Score: 75.8702 bits (185), Expect = 1.984e-16
Identity = 46/103 (44.66%), Postives = 59/103 (57.28%), Query Frame = -2
Query:  185 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCLKGIT--EPNLDQSYFKTNPIAVSDLSTDFKSARP--VCTFCLRDFKLLS 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI+HL  +L+ G +C   QPC  G          S     P          ++ +P  +CTFCL + + LS
Sbjct:   94 VNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLVGEACGDGQPCHSGPAFFHSGRAGSPLPPPPPPPPLARDGGENTQPKQICTFCLSNQRKLS 196          
BLAST of TCF15 vs. Ensembl Mouse
Match: Tal2 (T cell acute lymphocytic leukemia 2 [Source:MGI Symbol;Acc:MGI:99540])

HSP 1 Score: 50.0618 bits (118), Expect = 1.007e-7
Identity = 28/50 (56.00%), Postives = 34/50 (68.00%), Query Frame = -2
Query:  329 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSIDQ 478
            VN AF  LR++IPT P ++KLSK ETLRLA  YIN L  +L  G  S+ Q
Sbjct:   18 VNNAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVL--GEQSLHQ 65          
BLAST of TCF15 vs. Ensembl Mouse
Match: Twist2 (twist basic helix-loop-helix transcription factor 2 [Source:MGI Symbol;Acc:MGI:104685])

HSP 1 Score: 50.0618 bits (118), Expect = 2.179e-7
Identity = 26/41 (63.41%), Postives = 34/41 (82.93%), Query Frame = -2
Query:  356 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 478
            +NEAF ALR+IIPT P + KLSKI+TL+LAA YI+ L+ +L
Sbjct:   82 LNEAFAALRKIIPTLPSD-KLSKIQTLKLAARYIDFLYQVL 121          
BLAST of TCF15 vs. Ensembl Mouse
Match: Twist2 (twist basic helix-loop-helix transcription factor 2 [Source:MGI Symbol;Acc:MGI:104685])

HSP 1 Score: 50.0618 bits (118), Expect = 2.179e-7
Identity = 26/41 (63.41%), Postives = 34/41 (82.93%), Query Frame = -2
Query:  356 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 478
            +NEAF ALR+IIPT P + KLSKI+TL+LAA YI+ L+ +L
Sbjct:   82 LNEAFAALRKIIPTLPSD-KLSKIQTLKLAARYIDFLYQVL 121          
BLAST of TCF15 vs. UniProt/SwissProt
Match: sp|P79782|TCF15_CHICK (Transcription factor 15 OS=Gallus gallus OX=9031 GN=TCF15 PE=2 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 6.755e-18
Identity = 46/92 (50.00%), Postives = 54/92 (58.70%), Query Frame = -2
Query:  206 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCL 478
            VN AF ALR +IPTEP++RKLSKIETLRLA+SYI HL  +L+ G  C   QPC   I               A  DL  D +  R +CTFCL
Sbjct:   77 VNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVLLLGEGCEDGQPCFSAIYG-------------AKGDL--DGRQPRSICTFCL 153          
BLAST of TCF15 vs. UniProt/SwissProt
Match: sp|Q60756|TCF15_MOUSE (Transcription factor 15 OS=Mus musculus OX=10090 GN=Tcf15 PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 4.370e-17
Identity = 44/92 (47.83%), Postives = 55/92 (59.78%), Query Frame = -2
Query:  206 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSID-QPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCL 478
            VN AF ALR +IPTEP++RKLSKIETLRLA+SYI HL  +L+ G  + D QPC +                 AV   + D +  R +CTFCL
Sbjct:   86 VNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVLLLGDAADDGQPCFRAAG----------GGKSAVP--AADGRQPRSICTFCL 165          
BLAST of TCF15 vs. UniProt/SwissProt
Match: sp|Q60539|TCF15_MESAU (Transcription factor 15 OS=Mesocricetus auratus OX=10036 GN=TCF15 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.556e-17
Identity = 44/92 (47.83%), Postives = 55/92 (59.78%), Query Frame = -2
Query:  206 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSID-QPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCL 478
            VN AF ALR +IPTEP++RKLSKIETLRLA+SYI HL  +L+ G  + D QPC +                 AV   + D +  R +CTFCL
Sbjct:   86 VNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVLMLGDAADDGQPCFRAAG----------GGKSAVP--AADGRQPRSICTFCL 165          
BLAST of TCF15 vs. UniProt/SwissProt
Match: sp|Q12870|TCF15_HUMAN (Transcription factor 15 OS=Homo sapiens OX=9606 GN=TCF15 PE=2 SV=3)

HSP 1 Score: 78.1814 bits (191), Expect = 1.528e-16
Identity = 42/92 (45.65%), Postives = 55/92 (59.78%), Query Frame = -2
Query:  206 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSID-QPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCL 478
            VN AF ALR +IPTEP++RKLSKIET+RLA+SYI HL  +L+ G  + D QPC +             +   AV   +   +  R +CTFCL
Sbjct:   88 VNTAFTALRTLIPTEPVDRKLSKIETVRLASSYIAHLANVLLLGDSADDGQPCFRAAG----------SAKGAVPAAADGGRQPRSICTFCL 169          
BLAST of TCF15 vs. UniProt/SwissProt
Match: sp|P59101|SCX_CHICK (Basic helix-loop-helix transcription factor scleraxis OS=Gallus gallus OX=9031 GN=SCX PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.590e-16
Identity = 48/101 (47.52%), Postives = 64/101 (63.37%), Query Frame = -2
Query:  185 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARP--VCTFCLRDFKLLS 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI+HL  +L+ G +C   QPC    T P    ++F       S    D ++++P  +CTFCL + + LS
Sbjct:   83 VNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLVGEACGDGQPCH---TSP----AFFHHGGGGGSPPPRDSENSQPKQICTFCLSNQRKLS 176          
BLAST of TCF15 vs. TrEMBL
Match: H9CXU7 (TCF15 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 3.596e-65
Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = -2
Query:  185 MGIXXXXXXXXXXXXXXSVNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCLRDFKLLS 532
            MGISKRSAKERERSRTASVNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCLRDFKLLS
Sbjct:    1 MGISKRSAKERERSRTASVNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCLRDFKLLS 116          
BLAST of TCF15 vs. TrEMBL
Match: A0A3S5BHC2 (BHLH domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS17715 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.447e-24
Identity = 51/106 (48.11%), Postives = 68/106 (64.15%), Query Frame = -2
Query:  194 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSIDQPCLKGITEPNLD-----QSYFKTNPIAVSDLSTDF------KSARPVCTFCLRDFK 478
            VN+AFL LR +IPTEP+NRKLSKIETLRLAASYI+HLH +L+TGS  ++QPCL+    P+       Q+      +  + +S          + RPVCTFC+ + K
Sbjct:   83 VNDAFLLLRSLIPTEPVNRKLSKIETLRLAASYISHLHAILVTGSSGLEQPCLRHTMSPSCSTGQCLQAQMTLETVPATAVSAGLGGRQTVATHRPVCTFCMTEVK 188          
BLAST of TCF15 vs. TrEMBL
Match: A0A4E0RTF3 (Protein boule OS=Fasciola hepatica OX=6192 GN=D915_005126 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 6.685e-23
Identity = 55/102 (53.92%), Postives = 69/102 (67.65%), Query Frame = -2
Query:  194 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSIDQPCLKGIT-EPNLDQ------SYFKTNPIAVSDLSTDFKSARPVCTFCLRDFK 478
            VN+AFL LR +IPTEP+NRKLSKIETLRLA+SYI+HLH +L+TGS   DQPCL+     P + Q      S   T  +  + L  D +S RPVCTFC+ + K
Sbjct:   95 VNDAFLMLRRLIPTEPMNRKLSKIETLRLASSYISHLHAVLVTGSNPADQPCLRHQQLAPAMCQHDRCPTSAITTQNVIRTPLGGD-RSHRPVCTFCVTEMK 195          
BLAST of TCF15 vs. TrEMBL
Match: A0A2H1CBE8 (Helix-loop-helix DNA-binding domain protein OS=Fasciola hepatica OX=6192 GN=D915_08122 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 8.384e-23
Identity = 55/102 (53.92%), Postives = 69/102 (67.65%), Query Frame = -2
Query:  194 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSIDQPCLKGIT-EPNLDQ------SYFKTNPIAVSDLSTDFKSARPVCTFCLRDFK 478
            VN+AFL LR +IPTEP+NRKLSKIETLRLA+SYI+HLH +L+TGS   DQPCL+     P + Q      S   T  +  + L  D +S RPVCTFC+ + K
Sbjct:   87 VNDAFLMLRRLIPTEPMNRKLSKIETLRLASSYISHLHAVLVTGSNPADQPCLRHQQLAPAMCQHDRCPTSAITTQNVIRTPLGGD-RSHRPVCTFCVTEMK 187          
BLAST of TCF15 vs. TrEMBL
Match: A0A504YFW7 (Protein boule OS=Fasciola gigantica OX=46835 GN=FGIG_10882 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.109e-22
Identity = 55/102 (53.92%), Postives = 69/102 (67.65%), Query Frame = -2
Query:  194 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSIDQPCLKGIT-EPNLDQ------SYFKTNPIAVSDLSTDFKSARPVCTFCLRDFK 478
            VN+AFL LR +IPTEP+NRKLSKIETLRLA+SYI+HLH +L+TGS   DQPCL+     P + Q      S   T  +  + L  D +S RPVCTFC+ + K
Sbjct:   94 VNDAFLMLRRLIPTEPMNRKLSKIETLRLASSYISHLHAVLVTGSNPADQPCLRHQQLAPVVCQHDRCPTSAITTQKVIRTPLGGD-RSHRPVCTFCVTEMK 194          
BLAST of TCF15 vs. Ensembl Cavefish
Match: scxa (scleraxis bHLH transcription factor a [Source:ZFIN;Acc:ZDB-GENE-060503-414])

HSP 1 Score: 82.8037 bits (203), Expect = 3.011e-19
Identity = 45/98 (45.92%), Postives = 59/98 (60.20%), Query Frame = -2
Query:  188 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCLRDFKLL 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI+HL  +L+ G  C   QPC  G        SY+  +     D  T+    + +CTFCL + + +
Sbjct:   94 VNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLVGEGCGDGQPCHSG----GPSASYYHHHGSPGRD--TENSQPKQICTFCLSNQRKM 185          
BLAST of TCF15 vs. Ensembl Cavefish
Match: scxb (basic helix-loop-helix transcription factor scleraxis-like [Source:NCBI gene;Acc:103029811])

HSP 1 Score: 81.2629 bits (199), Expect = 1.141e-18
Identity = 47/100 (47.00%), Postives = 66/100 (66.00%), Query Frame = -2
Query:  188 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARP--VCTFCLRDFKLL 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI+HL  +L+ G +C+  QPC +    P    ++  + P   S  S D ++++P  +CTFCL + + L
Sbjct:   94 VNVAFTALRTLIPTEPADRKLSKIETLRLASSYISHLENVLLVGEACADGQPCHRS---PAALHNHLHS-PHKPSAPSPDSENSQPRQICTFCLSNQRRL 189          
BLAST of TCF15 vs. Ensembl Cavefish
Match: si:ch211-246m6.4 (transcription factor 15-like [Source:NCBI gene;Acc:103034626])

HSP 1 Score: 79.7221 bits (195), Expect = 3.411e-18
Identity = 45/94 (47.87%), Postives = 57/94 (60.64%), Query Frame = -2
Query:  206 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCL--KGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCL 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI HL  +L+ G +C   QPCL  +G+ +    ++                 S RP+CTFCL
Sbjct:   93 VNTAFSALRTLIPTEPADRKLSKIETLRLASSYIAHLANVLLLGETCRDGQPCLQYRGVLQGGATRA-----------------SLRPICTFCL 169          
BLAST of TCF15 vs. Ensembl Cavefish
Match: si:ch211-246m6.4 (transcription factor 15-like [Source:NCBI gene;Acc:103034626])

HSP 1 Score: 79.337 bits (194), Expect = 6.481e-18
Identity = 45/94 (47.87%), Postives = 57/94 (60.64%), Query Frame = -2
Query:  206 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCL--KGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCL 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI HL  +L+ G +C   QPCL  +G+ +    ++                 S RP+CTFCL
Sbjct:   93 VNTAFSALRTLIPTEPADRKLSKIETLRLASSYIAHLANVLLLGETCRDGQPCLQYRGVLQGGATRA-----------------SLRPICTFCL 169          
BLAST of TCF15 vs. Ensembl Cavefish
Match: tcf15 (transcription factor 15 [Source:NCBI gene;Acc:103040145])

HSP 1 Score: 77.0258 bits (188), Expect = 3.328e-17
Identity = 43/92 (46.74%), Postives = 52/92 (56.52%), Query Frame = -2
Query:  206 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSID-QPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCL 478
            VN AF ALR +IPTEP++RKLSKIETLRLA+SYI+HL  +L+TG      QPCL      +                    K  R +CTFCL
Sbjct:   77 VNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLTGDAGEHAQPCLSAHCRGD-----------------GGGKQPRTICTFCL 151          
BLAST of TCF15 vs. Ensembl Sea Lamprey
Match: scxa (scleraxis bHLH transcription factor a [Source:ZFIN;Acc:ZDB-GENE-060503-414])

HSP 1 Score: 58.5362 bits (140), Expect = 2.631e-11
Identity = 28/42 (66.67%), Postives = 33/42 (78.57%), Query Frame = -2
Query:  353 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLI 478
            VN AF ALR +IPTEP +RKLSK+ETL LA+SYI HL   L+
Sbjct:   52 VNSAFTALRTLIPTEPADRKLSKLETLLLASSYIAHLGNTLL 93          
BLAST of TCF15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011442.1 (pep scaffold:Pmarinus_7.0:GL478554:30221:30385:-1 gene:ENSPMAG00000010415.1 transcript:ENSPMAT00000011442.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 6.660e-8
Identity = 24/41 (58.54%), Postives = 33/41 (80.49%), Query Frame = -2
Query:  356 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 478
            +NEAF +LR+IIPT P + KLSKI+TL+LA  YI+ L+ +L
Sbjct:    9 LNEAFSSLRQIIPTLP-SDKLSKIQTLKLATRYIDFLYQVL 48          
BLAST of TCF15 vs. Ensembl Sea Lamprey
Match: TWIST1 (twist family bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:12428])

HSP 1 Score: 47.3654 bits (111), Expect = 1.185e-7
Identity = 24/41 (58.54%), Postives = 34/41 (82.93%), Query Frame = -2
Query:  356 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 478
            +NEAF +LR+IIPT P + KLSKI+TL+LA+ YI+ L+ +L
Sbjct:   24 LNEAFASLRKIIPTLPSD-KLSKIQTLKLASRYIDFLYQVL 63          
BLAST of TCF15 vs. Ensembl Sea Lamprey
Match: TWIST1 (twist family bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:12428])

HSP 1 Score: 48.1358 bits (113), Expect = 2.238e-7
Identity = 24/42 (57.14%), Postives = 33/42 (78.57%), Query Frame = -2
Query:  353 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLI 478
            +NEAF +LR+IIPT P + KLSKI+TL+LA  YI+ L+ +L 
Sbjct:  111 LNEAFASLRQIIPTLPSD-KLSKIQTLKLATRYIDFLYQVLA 151          
BLAST of TCF15 vs. Ensembl Sea Lamprey
Match: TWIST1 (twist family bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:12428])

HSP 1 Score: 48.1358 bits (113), Expect = 2.990e-7
Identity = 24/41 (58.54%), Postives = 33/41 (80.49%), Query Frame = -2
Query:  356 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 478
            +NEAF +LR+IIPT P + KLSKI+TL+LA  YI+ L+ +L
Sbjct:  129 LNEAFASLRQIIPTLPSD-KLSKIQTLKLATRYIDFLYQVL 168          
BLAST of TCF15 vs. Ensembl Nematostella
Match: EDO42924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZZ0])

HSP 1 Score: 67.0106 bits (162), Expect = 3.989e-15
Identity = 33/45 (73.33%), Postives = 39/45 (86.67%), Query Frame = -2
Query:  344 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGS 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI HL T+LI+G+
Sbjct:   17 VNAAFNALRLLIPTEPSDRKLSKIETLRLASSYIAHLSTILISGT 61          
BLAST of TCF15 vs. Ensembl Nematostella
Match: NVAS-C1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6C2])

HSP 1 Score: 53.5286 bits (127), Expect = 5.267e-10
Identity = 24/41 (58.54%), Postives = 31/41 (75.61%), Query Frame = -2
Query:  356 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 478
            V++ F ALR+ IPT P+N+KLSK+ETLR A  YI HL  +L
Sbjct:   21 VSDGFAALRKHIPTTPVNKKLSKVETLRTAIEYIKHLQRIL 61          
BLAST of TCF15 vs. Ensembl Nematostella
Match: NVAS-C2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1A5])

HSP 1 Score: 51.6026 bits (122), Expect = 2.938e-9
Identity = 22/41 (53.66%), Postives = 30/41 (73.17%), Query Frame = -2
Query:  356 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 478
            VNE +  LRE +P EP ++++SK+ETLR A  YI HL +LL
Sbjct:   25 VNEGYARLREHLPEEPSDKRMSKVETLRAAIRYIKHLESLL 65          
BLAST of TCF15 vs. Ensembl Nematostella
Match: EDO43849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI0])

HSP 1 Score: 46.595 bits (109), Expect = 1.479e-7
Identity = 21/41 (51.22%), Postives = 29/41 (70.73%), Query Frame = -2
Query:  356 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 478
            +NEAF  LR+ IPT P  ++LSK++TLRLA  YI  L  ++
Sbjct:   18 INEAFEGLRKHIPTLPYEKRLSKVDTLRLAIGYIGFLTEMI 58          
BLAST of TCF15 vs. Ensembl Nematostella
Match: EDO38292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDD5])

HSP 1 Score: 48.521 bits (114), Expect = 2.211e-7
Identity = 22/41 (53.66%), Postives = 30/41 (73.17%), Query Frame = -2
Query:  356 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 478
            VN+ F +LR+ IP  P  +KLSK+ETLR A +YI HL +L+
Sbjct:   86 VNDGFSSLRQHIPYFPEKKKLSKVETLRCAVAYIKHLQSLI 126          
BLAST of TCF15 vs. Ensembl Medaka
Match: tcf15 (transcription factor 15 [Source:NCBI gene;Acc:101172734])

HSP 1 Score: 85.5001 bits (210), Expect = 2.013e-20
Identity = 44/92 (47.83%), Postives = 56/92 (60.87%), Query Frame = -2
Query:  206 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-SCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCL 478
            VN AF ALR +IPTEP++RKLSKIETLRLA+SYI+HL  +L+TG  C+  QPCL G  +                   +  +  R +CTFCL
Sbjct:   78 VNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLTGDGCADGQPCLGGHAQGE-----------------SGGRQPRTICTFCL 152          
BLAST of TCF15 vs. Ensembl Medaka
Match: scxb (scleraxis bHLH transcription factor [Source:NCBI gene;Acc:101167982])

HSP 1 Score: 78.5666 bits (192), Expect = 1.731e-17
Identity = 47/98 (47.96%), Postives = 61/98 (62.24%), Query Frame = -2
Query:  188 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSID-QPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCLRDFKLL 478
            VN AF ALR +IPTEP +RKLSKIETLRLA+SYI+HL  +L+ G    D QPC      P+    +  ++P   SD ST  K    +CTFCL + + +
Sbjct:  112 VNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLLGEGLHDGQPCHA----PSPPFFHVSSSPTRGSDQSTQPKH---ICTFCLSNQRRM 202          
BLAST of TCF15 vs. Ensembl Medaka
Match: ENSORLT00000017495.2 (pep primary_assembly:ASM223467v1:4:24388791:24389132:-1 gene:ENSORLG00000013953.2 transcript:ENSORLT00000017495.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 8.897e-8
Identity = 31/66 (46.97%), Postives = 37/66 (56.06%), Query Frame = -2
Query:  296 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL-----ITGSCSIDQPCLKGITEPNL 478
            VN AF  LR +IPT P +RKLSK E LRLA  YI  L  LL       G  + ++  L+G   PNL
Sbjct:   18 VNGAFAELRRLIPTHPPDRKLSKNEILRLALRYIRFLDQLLSEQDPQDGDPAEEEHRLQGELSPNL 83          
BLAST of TCF15 vs. Ensembl Medaka
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:101160350])

HSP 1 Score: 49.2914 bits (116), Expect = 7.397e-7
Identity = 35/97 (36.08%), Postives = 49/97 (50.52%), Query Frame = -2
Query:  227 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITG-------SCSIDQP-----CLKGITEPNLDQSYFKTNPIAVSDLS-TDFKSAR 478
            +N+AF  LR  IPT P  ++LSK++TLRLA  YIN L  L+ +        S +  QP     C +G   P+     +   P+A   LS +D K  R
Sbjct:  134 INDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELVQSDLPIRNSNSDAHAQPKKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWSDEKQLR 230          
BLAST of TCF15 vs. Ensembl Medaka
Match: ENSORLT00000005014.2 (twist family bHLH transcription factor 1 [Source:NCBI gene;Acc:101173479])

HSP 1 Score: 48.521 bits (114), Expect = 8.159e-7
Identity = 25/41 (60.98%), Postives = 34/41 (82.93%), Query Frame = -2
Query:  356 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 478
            +NEAF +LR+IIPT P + KLSKI+TL+LAA YI+ L+ +L
Sbjct:  106 LNEAFTSLRKIIPTLPSD-KLSKIQTLKLAARYIDFLYQVL 145          
BLAST of TCF15 vs. Planmine SMEST
Match: SMESG000044395.1 (SMESG000044395.1)

HSP 1 Score: 205.297 bits (521), Expect = 4.049e-68
Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = -2
Query:  188 MGIXXXXXXXXXXXXXXSVNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCLRDFKLL 532
            MGISKRSAKERERSRTASVNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCLRDFKLL
Sbjct:    1 MGISKRSAKERERSRTASVNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKSARPVCTFCLRDFKLL 115          
BLAST of TCF15 vs. Planmine SMEST
Match: SMESG000079648.1 (SMESG000079648.1)

HSP 1 Score: 50.0618 bits (118), Expect = 2.866e-7
Identity = 25/45 (55.56%), Postives = 31/45 (68.89%), Query Frame = -2
Query:  344 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGS 478
            +NEAF  LR  IPT P  ++LSK++TLRLA  YIN L  L+ T S
Sbjct:  118 INEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTES 162          
BLAST of TCF15 vs. Planmine SMEST
Match: SMESG000000956.1 (SMESG000000956.1)

HSP 1 Score: 48.521 bits (114), Expect = 1.026e-6
Identity = 24/49 (48.98%), Postives = 33/49 (67.35%), Query Frame = -2
Query:  332 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLLITGSCSID 478
            +NEAF  LR  IPT P  ++LSK++TLRLA SYI  L  L+ +   S++
Sbjct:  118 INEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLE 166          
BLAST of TCF15 vs. Planmine SMEST
Match: SMESG000045286.1 (SMESG000045286.1)

HSP 1 Score: 45.8246 bits (107), Expect = 9.191e-6
Identity = 22/41 (53.66%), Postives = 29/41 (70.73%), Query Frame = -2
Query:  356 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 478
            +N AF  LR  +PT P  R+LSKI+TLRLA +YI+ L  L+
Sbjct:   66 INTAFAELRSRVPTFPYERRLSKIDTLRLAIAYISLLQDLV 106          
BLAST of TCF15 vs. Planmine SMEST
Match: SMESG000044960.1 (SMESG000044960.1)

HSP 1 Score: 45.0542 bits (105), Expect = 9.557e-6
Identity = 20/41 (48.78%), Postives = 29/41 (70.73%), Query Frame = -2
Query:  356 VNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 478
            +N+AF  LR  IPT P  ++LSK++TLR+A  YIN L  ++
Sbjct:   62 INDAFEKLRVHIPTMPYEKRLSKVDTLRMAIGYINFLGGIM 102          
The following BLAST results are available for this feature:
BLAST of TCF15 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCF153.183e-1745.65transcription factor 15 [Source:HGNC Symbol;Acc:HG... [more]
SCX7.190e-1742.99scleraxis bHLH transcription factor [Source:HGNC S... [more]
TAL21.223e-756.00TAL bHLH transcription factor 2 [Source:HGNC Symbo... [more]
TWIST12.254e-753.70twist family bHLH transcription factor 1 [Source:H... [more]
TWIST23.174e-763.41twist family bHLH transcription factor 2 [Source:H... [more]
back to top
BLAST of TCF15 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hlh-132.980e-653.49Helix-loop-helix protein 13 [Source:UniProtKB/Swi... [more]
back to top
BLAST of TCF15 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG335575.019e-1464.81gene:FBgn0053557 transcript:FBtr0091534[more]
cato4.435e-748.98gene:FBgn0024249 transcript:FBtr0087183[more]
back to top
BLAST of TCF15 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scxa2.652e-1946.53scleraxis bHLH transcription factor a [Source:ZFIN... [more]
scxb5.676e-1944.90scleraxis bHLH transcription factor b [Source:ZFIN... [more]
si:ch211-246m6.41.166e-1847.00si:ch211-246m6.4 [Source:ZFIN;Acc:ZDB-GENE-050208-... [more]
tcf151.174e-1846.74transcription factor 15 [Source:ZFIN;Acc:ZDB-GENE-... [more]
CR626923.23.864e-1846.00scleraxis bHLH transcription factor b [Source:NCBI... [more]
back to top
BLAST of TCF15 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrps152.843e-1947.06mitochondrial ribosomal protein S15 [Source:Xenbas... [more]
tcf152.971e-1846.74transcription factor 15 [Source:NCBI gene;Acc:5492... [more]
hnrnpc7.355e-1846.74heterogeneous nuclear ribonucleoprotein C (C1/C2) ... [more]
adra1d1.739e-1744.90adrenoceptor alpha 1D [Source:Xenbase;Acc:XB-GENE-... [more]
gsk3b2.115e-747.37glycogen synthase kinase 3 beta [Source:Xenbase;Ac... [more]
back to top
BLAST of TCF15 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tcf156.248e-1847.83transcription factor 15 [Source:MGI Symbol;Acc:MGI... [more]
Scx1.984e-1644.66scleraxis [Source:MGI Symbol;Acc:MGI:102934][more]
Tal21.007e-756.00T cell acute lymphocytic leukemia 2 [Source:MGI Sy... [more]
Twist22.179e-763.41twist basic helix-loop-helix transcription factor ... [more]
Twist22.179e-763.41twist basic helix-loop-helix transcription factor ... [more]
back to top
BLAST of TCF15 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P79782|TCF15_CHICK6.755e-1850.00Transcription factor 15 OS=Gallus gallus OX=9031 G... [more]
sp|Q60756|TCF15_MOUSE4.370e-1747.83Transcription factor 15 OS=Mus musculus OX=10090 G... [more]
sp|Q60539|TCF15_MESAU4.556e-1747.83Transcription factor 15 OS=Mesocricetus auratus OX... [more]
sp|Q12870|TCF15_HUMAN1.528e-1645.65Transcription factor 15 OS=Homo sapiens OX=9606 GN... [more]
sp|P59101|SCX_CHICK1.590e-1647.52Basic helix-loop-helix transcription factor sclera... [more]
back to top
BLAST of TCF15 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXU73.596e-65100.00TCF15 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A3S5BHC23.447e-2448.11BHLH domain-containing protein OS=Protopolystoma x... [more]
A0A4E0RTF36.685e-2353.92Protein boule OS=Fasciola hepatica OX=6192 GN=D915... [more]
A0A2H1CBE88.384e-2353.92Helix-loop-helix DNA-binding domain protein OS=Fas... [more]
A0A504YFW71.109e-2253.92Protein boule OS=Fasciola gigantica OX=46835 GN=FG... [more]
back to top
BLAST of TCF15 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scxa3.011e-1945.92scleraxis bHLH transcription factor a [Source:ZFIN... [more]
scxb1.141e-1847.00basic helix-loop-helix transcription factor sclera... [more]
si:ch211-246m6.43.411e-1847.87transcription factor 15-like [Source:NCBI gene;Acc... [more]
si:ch211-246m6.46.481e-1847.87transcription factor 15-like [Source:NCBI gene;Acc... [more]
tcf153.328e-1746.74transcription factor 15 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of TCF15 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scxa2.631e-1166.67scleraxis bHLH transcription factor a [Source:ZFIN... [more]
ENSPMAT00000011442.16.660e-858.54pep scaffold:Pmarinus_7.0:GL478554:30221:30385:-1 ... [more]
TWIST11.185e-758.54twist family bHLH transcription factor 1 [Source:H... [more]
TWIST12.238e-757.14twist family bHLH transcription factor 1 [Source:H... [more]
TWIST12.990e-758.54twist family bHLH transcription factor 1 [Source:H... [more]
back to top
BLAST of TCF15 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TCF15 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO429243.989e-1573.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVAS-C15.267e-1058.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVAS-C22.938e-953.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438491.479e-751.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382922.211e-753.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TCF15 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tcf152.013e-2047.83transcription factor 15 [Source:NCBI gene;Acc:1011... [more]
scxb1.731e-1747.96scleraxis bHLH transcription factor [Source:NCBI g... [more]
ENSORLT00000017495.28.897e-846.97pep primary_assembly:ASM223467v1:4:24388791:243891... [more]
ptf1a7.397e-736.08pancreas associated transcription factor 1a [Sourc... [more]
ENSORLT00000005014.28.159e-760.98twist family bHLH transcription factor 1 [Source:N... [more]
back to top
BLAST of TCF15 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044395.14.049e-68100.00SMESG000044395.1[more]
SMESG000079648.12.866e-755.56SMESG000079648.1[more]
SMESG000000956.11.026e-648.98SMESG000000956.1[more]
SMESG000045286.19.191e-653.66SMESG000045286.1[more]
SMESG000044960.19.557e-648.78SMESG000044960.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006464
GenBankAFD29618.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006464 ID=SMED30006464|Name=TCF15|organism=Schmidtea mediterranea sexual|type=transcript|length=686bp
AATGAAATAATCAACAATACAAATCGGCAAGGTAATATAAGATTTTTATA
AAAAGATTTACAATAAGATGTTTATATACAAAAGGCAACGAAATGCCACG
CGATAATCAATAAAAAATCTCTTTAAATTACACAATTCCTATCAAAATAA
TATTAATAATAACAATAACAACTCAGCACTACTAACTCAATAATTTGAAA
TCACGCAAACAAAATGTGCAAACTGGTCGAGCACTCTTGAAATCTGTCGA
TAAATCAGAAACGGCGATTGGATTTGTTTTGAAATAACTTTGATCTAAAT
TCGGTTCGGTAATTCCTTTTAGACATGGCTGATCAATGGAACAAGATCCG
GTAATGAGAAGCGTATGAAGGTGATTGATATAGCTAGCAGCCAATCTCAA
TGTTTCAATTTTTGATAATTTTCTGTTGATCGGTTCCGTTGGAATTATTT
CTCTTAGAGCCAAAAACGCTTCATTGACACTAGCAGTTCTAGACCTTTCG
CGTTCTTTTGCCGATCGTTTACTAATTCCCATCTTTGAAAGTAAAAAATT
AAAATTAAAATTTGTAATCGATTTCCACGATGATTTTCTATTTAAAAGCA
CCCAAAACTTTTTCAACCAATTAAATCCTACGATAATTTTTATCTCATTT
TCTATTGGTTGATGTGAGAAAAATTTTACTGTTCAA
back to top

protein sequence of SMED30006464-orf-1

>SMED30006464-orf-1 ID=SMED30006464-orf-1|Name=SMED30006464-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=117bp
MGISKRSAKERERSRTASVNEAFLALREIIPTEPINRKLSKIETLRLAAS
YINHLHTLLITGSCSIDQPCLKGITEPNLDQSYFKTNPIAVSDLSTDFKS
ARPVCTFCLRDFKLLS*
back to top
Aliases
The feature 'TCF15' has the following synonyms
Synonym
TCF15
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0000120progenitor cell
PLANA:0000121stem cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036638HLH_DNA-bd_sf
IPR011598bHLH_dom
IPR013809ENTH
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSMARTSM00353finuluscoord: 9..61
e-value: 9.6E-16
score: 68.3
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPFAMPF00010HLHcoord: 5..56
e-value: 2.6E-16
score: 59.3
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPROSITEPS50888BHLHcoord: 3..55
score: 16.171
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainCDDcd00083HLHcoord: 5..59
e-value: 3.2402E-16
score: 65.3131
IPR036638Helix-loop-helix DNA-binding domain superfamilyGENE3DG3DSA:4.10.280.10coord: 3..63
e-value: 5.0E-21
score: 76.0
IPR036638Helix-loop-helix DNA-binding domain superfamilySUPERFAMILYSSF47459HLH, helix-loop-helix DNA-binding domaincoord: 5..63
NoneNo IPR availablePANTHERPTHR23349:SF4TRANSCRIPTION FACTOR 15coord: 6..112
NoneNo IPR availablePANTHERPTHR23349BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTOR, TWISTcoord: 6..112