Serine/threonine-protein kinase PLK4

Overview
NameSerine/threonine-protein kinase PLK4
Smed IDSMED30006459
Length (bp)2927
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase PLK4 (SMED30006459) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase PLK4 (SMED30006459) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase PLK4 (SMED30006459) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase PLK4 (SMED30006459) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006459

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30006459SMESG000076532.1 SmedASXL_016514SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30006459SMESG000076532.1 dd_Smed_v4_12637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006459SMESG000076532.1 dd_Smed_v4_12637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30006459SMESG000076532.1 dd_Smed_v6_12637_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30006459SMESG000076532.1 dd_Smed_v4_12637_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Human
Match: PLK4 (polo like kinase 4 [Source:HGNC Symbol;Acc:HGNC:11397])

HSP 1 Score: 327.405 bits (838), Expect = 7.032e-97
Identity = 159/278 (57.19%), Postives = 207/278 (74.46%), Query Frame = 3
Query:  129 IEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIREN-GPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVN---KVSDLFQDFSITDSG 947
            IEDF+V  +LG+G FA VYRA+S  T  EVAIK+IDKK M+  GM  RV+ EV++H +LKHPSILELY +FED+NYVYLVLEMCHNGE++R ++    P SE++AR ++ QI+ G+ YLHS+ ILHRDLTL+NLLLT++M IKIADFGLATQL+   E H+T+CGTPNYISPE+ +RS  GLE+DVWS+GCM YT+L+G+ PFDT  ++ TLN+V    + +PS +S  ++DLI  LL+ NP  RL+L  + +H FM  N   K  DL       DSG
Sbjct:    9 IEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQIITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISPEIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPSFLSIEAKDLIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSKDLGTVEDSIDSG 286          

HSP 2 Score: 171.785 bits (434), Expect = 3.608e-43
Identity = 127/398 (31.91%), Postives = 201/398 (50.50%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPT--------AILNSLSMPSKSPV---------------------VASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELL 2495
            PL + R++PIRQKT+ AV++ILD+  VC+E +K  +       Q  + EV+ I S G++I +YYP     F P  D+P S    + +  +  +++PEKY +KYQ A RFV LVRS++PK+T +T  AKC+LMEN P  DFE+ F + +            KIH   E+  Q+    G +  L   S ++     I  ++D++ +    CL  ++ + S  + K   + F+PI IGRK      SS +    P  V   N PT         +++S + P+++P+                     ++SNS +           S F+ ++GWATQL  G + VQFNDG QL++    ++I      S+ S N GQ  T  + + + LPD +  K++ L
Sbjct:  515 PLVAHRLKPIRQKTKKAVVSILDSEEVCVELVKEYAS------QEYVKEVLQISSDGNTITIYYPNGGRGF-PLADRPPS--PTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCILMENSPGADFEVWFYDGV------------KIH-KTEDFIQVIEKTGKSYTLKSESEVNSLKEEIKMYMDHANEGHRICLA-LESIISEEERKTRSAPFFPIIIGRK--PGSTSSPKALSPPPSVD-SNYPTRERASFNRMVMHSAASPTQAPILNPSMVTNEGLGLTTTASGTDISSNSLKDCLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSI------SYTSPN-GQ--TTRYGENEKLPDYIKQKLQCL 877          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Human
Match: PLK4 (polo like kinase 4 [Source:HGNC Symbol;Acc:HGNC:11397])

HSP 1 Score: 326.635 bits (836), Expect = 1.591e-96
Identity = 159/278 (57.19%), Postives = 207/278 (74.46%), Query Frame = 3
Query:  129 IEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIREN-GPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVN---KVSDLFQDFSITDSG 947
            IEDF+V  +LG+G FA VYRA+S  T  EVAIK+IDKK M+  GM  RV+ EV++H +LKHPSILELY +FED+NYVYLVLEMCHNGE++R ++    P SE++AR ++ QI+ G+ YLHS+ ILHRDLTL+NLLLT++M IKIADFGLATQL+   E H+T+CGTPNYISPE+ +RS  GLE+DVWS+GCM YT+L+G+ PFDT  ++ TLN+V    + +PS +S  ++DLI  LL+ NP  RL+L  + +H FM  N   K  DL       DSG
Sbjct:    9 IEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQIITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISPEIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPSFLSIEAKDLIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSKDLGTVEDSIDSG 286          

HSP 2 Score: 141.739 bits (356), Expect = 1.075e-33
Identity = 117/398 (29.40%), Postives = 184/398 (46.23%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPT--------AILNSLSMPSKSPV---------------------VASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELL 2495
            PL + R++PIRQKT+ AV++ILD+                                   I +YYP     F P  D+P S    + +  +  +++PEKY +KYQ A RFV LVRS++PK+T +T  AKC+LMEN P  DFE+ F + +            KIH   E+  Q+    G +  L   S ++     I  ++D++ +    CL  ++ + S  + K   + F+PI IGRK      SS +    P  V   N PT         +++S + P+++P+                     ++SNS +           S F+ ++GWATQL  G + VQFNDG QL++    ++I      S+ S N GQ  T  + + + LPD +  K++ L
Sbjct:  559 PLVAHRLKPIRQKTKKAVVSILDS---------------------------------EEITIYYPNGGRGF-PLADRPPS--PTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCILMENSPGADFEVWFYDGV------------KIH-KTEDFIQVIEKTGKSYTLKSESEVNSLKEEIKMYMDHANEGHRICL-ALESIISEEERKTRSAPFFPIIIGRK--PGSTSSPKALSPPPSVD-SNYPTRERASFNRMVMHSAASPTQAPILNPSMVTNEGLGLTTTASGTDISSNSLKDCLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSI------SYTSPN-GQ--TTRYGENEKLPDYIKQKLQCL 894          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Human
Match: PLK4 (polo like kinase 4 [Source:HGNC Symbol;Acc:HGNC:11397])

HSP 1 Score: 327.02 bits (837), Expect = 3.565e-96
Identity = 159/278 (57.19%), Postives = 207/278 (74.46%), Query Frame = 3
Query:  129 IEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIREN-GPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVN---KVSDLFQDFSITDSG 947
            IEDF+V  +LG+G FA VYRA+S  T  EVAIK+IDKK M+  GM  RV+ EV++H +LKHPSILELY +FED+NYVYLVLEMCHNGE++R ++    P SE++AR ++ QI+ G+ YLHS+ ILHRDLTL+NLLLT++M IKIADFGLATQL+   E H+T+CGTPNYISPE+ +RS  GLE+DVWS+GCM YT+L+G+ PFDT  ++ TLN+V    + +PS +S  ++DLI  LL+ NP  RL+L  + +H FM  N   K  DL       DSG
Sbjct:    9 IEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQIITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISPEIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPSFLSIEAKDLIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSKDLGTVEDSIDSG 286          

HSP 2 Score: 171.4 bits (433), Expect = 6.126e-43
Identity = 127/398 (31.91%), Postives = 201/398 (50.50%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPT--------AILNSLSMPSKSPV---------------------VASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELL 2495
            PL + R++PIRQKT+ AV++ILD+  VC+E +K  +       Q  + EV+ I S G++I +YYP     F P  D+P S    + +  +  +++PEKY +KYQ A RFV LVRS++PK+T +T  AKC+LMEN P  DFE+ F + +            KIH   E+  Q+    G +  L   S ++     I  ++D++ +    CL  ++ + S  + K   + F+PI IGRK      SS +    P  V   N PT         +++S + P+++P+                     ++SNS +           S F+ ++GWATQL  G + VQFNDG QL++    ++I      S+ S N GQ  T  + + + LPD +  K++ L
Sbjct:  593 PLVAHRLKPIRQKTKKAVVSILDSEEVCVELVKEYAS------QEYVKEVLQISSDGNTITIYYPNGGRGF-PLADRPPS--PTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCILMENSPGADFEVWFYDGV------------KIH-KTEDFIQVIEKTGKSYTLKSESEVNSLKEEIKMYMDHANEGHRICL-ALESIISEEERKTRSAPFFPIIIGRK--PGSTSSPKALSPPPSVD-SNYPTRERASFNRMVMHSAASPTQAPILNPSMVTNEGLGLTTTASGTDISSNSLKDCLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSI------SYTSPN-GQ--TTRYGENEKLPDYIKQKLQCL 955          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Human
Match: PLK4 (polo like kinase 4 [Source:HGNC Symbol;Acc:HGNC:11397])

HSP 1 Score: 288.115 bits (736), Expect = 1.859e-82
Identity = 138/245 (56.33%), Postives = 182/245 (74.29%), Query Frame = 3
Query:  228 IIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIREN-GPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVN---KVSDLFQDFSITDSG 947
            +IDKK M+  GM  RV+ EV++H +LKHPSILELY +FED+NYVYLVLEMCHNGE++R ++    P SE++AR ++ QI+ G+ YLHS+ ILHRDLTL+NLLLT++M IKIADFGLATQL+   E H+T+CGTPNYISPE+ +RS  GLE+DVWS+GCM YT+L+G+ PFDT  ++ TLN+V    + +PS +S  ++DLI  LL+ NP  RL+L  + +H FM  N   K  DL       DSG
Sbjct:    1 MIDKKAMYKAGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQIITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISPEIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPSFLSIEAKDLIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSKDLGTVEDSIDSG 245          

HSP 2 Score: 171.4 bits (433), Expect = 5.718e-43
Identity = 127/398 (31.91%), Postives = 201/398 (50.50%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPT--------AILNSLSMPSKSPV---------------------VASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELL 2495
            PL + R++PIRQKT+ AV++ILD+  VC+E +K  +       Q  + EV+ I S G++I +YYP     F P  D+P S    + +  +  +++PEKY +KYQ A RFV LVRS++PK+T +T  AKC+LMEN P  DFE+ F + +            KIH   E+  Q+    G +  L   S ++     I  ++D++ +    CL  ++ + S  + K   + F+PI IGRK      SS +    P  V   N PT         +++S + P+++P+                     ++SNS +           S F+ ++GWATQL  G + VQFNDG QL++    ++I      S+ S N GQ  T  + + + LPD +  K++ L
Sbjct:  552 PLVAHRLKPIRQKTKKAVVSILDSEEVCVELVKEYAS------QEYVKEVLQISSDGNTITIYYPNGGRGF-PLADRPPS--PTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCILMENSPGADFEVWFYDGV------------KIH-KTEDFIQVIEKTGKSYTLKSESEVNSLKEEIKMYMDHANEGHRICL-ALESIISEEERKTRSAPFFPIIIGRK--PGSTSSPKALSPPPSVD-SNYPTRERASFNRMVMHSAASPTQAPILNPSMVTNEGLGLTTTASGTDISSNSLKDCLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSI------SYTSPN-GQ--TTRYGENEKLPDYIKQKLQCL 914          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Human
Match: PLK4 (polo like kinase 4 [Source:HGNC Symbol;Acc:HGNC:11397])

HSP 1 Score: 269.24 bits (687), Expect = 1.002e-75
Identity = 139/278 (50.00%), Postives = 182/278 (65.47%), Query Frame = 3
Query:  129 IEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIREN-GPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVN---KVSDLFQDFSITDSG 947
            IEDF+V  +LG+G FA VYRA+S  T  EVAIK+                                LY +FED+NYVYLVLEMCHNGE++R ++    P SE++AR ++ QI+ G+ YLHS+ ILHRDLTL+NLLLT++M IKIADFGLATQL+   E H+T+CGTPNYISPE+ +RS  GLE+DVWS+GCM YT+L+G+ PFDT  ++ TLN+V    + +PS +S  ++DLI  LL+ NP  RL+L  + +H FM  N   K  DL       DSG
Sbjct:    9 IEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKM--------------------------------LYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQIITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISPEIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPSFLSIEAKDLIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSKDLGTVEDSIDSG 254          

HSP 2 Score: 171.4 bits (433), Expect = 4.859e-43
Identity = 127/398 (31.91%), Postives = 201/398 (50.50%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPT--------AILNSLSMPSKSPV---------------------VASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELL 2495
            PL + R++PIRQKT+ AV++ILD+  VC+E +K  +       Q  + EV+ I S G++I +YYP     F P  D+P S    + +  +  +++PEKY +KYQ A RFV LVRS++PK+T +T  AKC+LMEN P  DFE+ F + +            KIH   E+  Q+    G +  L   S ++     I  ++D++ +    CL  ++ + S  + K   + F+PI IGRK      SS +    P  V   N PT         +++S + P+++P+                     ++SNS +           S F+ ++GWATQL  G + VQFNDG QL++    ++I      S+ S N GQ  T  + + + LPD +  K++ L
Sbjct:  561 PLVAHRLKPIRQKTKKAVVSILDSEEVCVELVKEYAS------QEYVKEVLQISSDGNTITIYYPNGGRGF-PLADRPPS--PTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCILMENSPGADFEVWFYDGV------------KIH-KTEDFIQVIEKTGKSYTLKSESEVNSLKEEIKMYMDHANEGHRICL-ALESIISEEERKTRSAPFFPIIIGRK--PGSTSSPKALSPPPSVD-SNYPTRERASFNRMVMHSAASPTQAPILNPSMVTNEGLGLTTTASGTDISSNSLKDCLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSI------SYTSPN-GQ--TTRYGENEKLPDYIKQKLQCL 923          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Celegans
Match: air-2 (Aurora/IPL1-related protein kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:O01427])

HSP 1 Score: 197.593 bits (501), Expect = 2.177e-56
Identity = 93/257 (36.19%), Postives = 154/257 (59.92%), Query Frame = 3
Query:  126 SIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ 896
            +I DFE+   LG+G F  VY A+++     VAIK++ K  +   G+  ++ +E+E+ S L HP+I++LYT+F DA  +YLVLE    GE+++++  +   SE  A KY+ +I D L Y H  +++HRD+   NLL+    ++KI DFG +    +     TMCGT +Y+ PE+V+ +      D+W++G + Y  LVGK PF+ ++   T   +++ RF  P ++ + +RDLI  LL  +P  R  L+Q+  H ++Q
Sbjct:   26 TINDFEIGRPLGKGKFGSVYLARTKTGHFHVAIKVLFKSQLISGGVEHQLEREIEIQSHLNHPNIIKLYTYFWDAKKIYLVLEYAPGGEMYKQLTVSKRFSEPTAAKYMYEIADALSYCHRKNVIHRDIKPENLLIGSQGELKIGDFGWSVHAPSNKRQ-TMCGTMDYLPPEMVNGADHSDAVDLWAIGVLCYEFLVGKPPFEHEDQSKTYAAIKAARFTYPDSVKKGARDLIGRLLVVDPKARCTLEQVKEHYWIQ 281          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Celegans
Match: plk-3 (Serine/threonine-protein kinase plk-3 [Source:UniProtKB/Swiss-Prot;Acc:Q20845])

HSP 1 Score: 204.527 bits (519), Expect = 1.019e-55
Identity = 90/240 (37.50%), Postives = 148/240 (61.67%), Query Frame = 3
Query:  138 FEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKR 857
            +E    LG GGFA  +  +    +  +A+K++ K ++       ++ +EVE+H +L H +I++ + FFED+  VY  LE+C    L    ++ GPL+E +AR Y  Q+ +G+K+LH+  I+HRDL L NL L + +++KI DFGLAT  E   +  T  GTPNYI+PEV++ +    E D+W++GC+LY +L G  PF+++ ++ T  R+++  + +P N S ++  LI  LL   PD+R
Sbjct:   35 YEKGAFLGEGGFAHCFEFRKLDCNDRLAVKVVPKVILLKSTAREKLTREVEIHRQLSHRNIVQFHHFFEDSQNVYFTLELCSKNSLMELNKQRGPLTEHEARFYTIQVAEGVKHLHNLQIIHRDLKLGNLFLNEHLQVKIGDFGLATFCEKNEKKMTRGGTPNYIAPEVLNETGHAFEVDIWAIGCILYVLLFGSPPFESRRVQETYVRIKNNDYVVPENASPTANRLIRSLLDPVPDRR 274          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Celegans
Match: plk-3 (Serine/threonine-protein kinase plk-3 [Source:UniProtKB/Swiss-Prot;Acc:Q20845])

HSP 1 Score: 204.527 bits (519), Expect = 1.019e-55
Identity = 90/240 (37.50%), Postives = 148/240 (61.67%), Query Frame = 3
Query:  138 FEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKR 857
            +E    LG GGFA  +  +    +  +A+K++ K ++       ++ +EVE+H +L H +I++ + FFED+  VY  LE+C    L    ++ GPL+E +AR Y  Q+ +G+K+LH+  I+HRDL L NL L + +++KI DFGLAT  E   +  T  GTPNYI+PEV++ +    E D+W++GC+LY +L G  PF+++ ++ T  R+++  + +P N S ++  LI  LL   PD+R
Sbjct:   35 YEKGAFLGEGGFAHCFEFRKLDCNDRLAVKVVPKVILLKSTAREKLTREVEIHRQLSHRNIVQFHHFFEDSQNVYFTLELCSKNSLMELNKQRGPLTEHEARFYTIQVAEGVKHLHNLQIIHRDLKLGNLFLNEHLQVKIGDFGLATFCEKNEKKMTRGGTPNYIAPEVLNETGHAFEVDIWAIGCILYVLLFGSPPFESRRVQETYVRIKNNDYVVPENASPTANRLIRSLLDPVPDRR 274          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Celegans
Match: plk-1 (Serine/threonine-protein kinase plk-1 [Source:UniProtKB/Swiss-Prot;Acc:P34331])

HSP 1 Score: 204.912 bits (520), Expect = 1.434e-55
Identity = 97/256 (37.89%), Postives = 156/256 (60.94%), Query Frame = 3
Query:  138 FEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNG---ELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ 896
            +E    LG+GGFA  Y   ++ T + VA K++ K M+       ++ +EV++H  L H +I++L+ FFED   VY+ LE+C      ELH+R +    ++E +AR +  QIVDG+ YLH  +I+HRD+ L NL L  D+ +KI DFGLAT +       T+CGTPNYI+PEV++++    E D+W+VGC+LY +L G+ PF++K +  T +R++   + +PS  ++ +  LI  +L   P +R   +Q+    F +
Sbjct:   38 YEKGRFLGKGGFAHCYELTNRATREVVAGKVVPKSMLVKQYQRDKMTQEVQIHRELGHINIVKLFNFFEDNLNVYITLELCARRSLMELHKRRKA---VTEPEARYFTHQIVDGVLYLHDLNIIHRDMKLGNLFLNDDLVVKIGDFGLATTVNGDERKKTLCGTPNYIAPEVLNKAGHSFEVDIWAVGCILYILLFGQPPFESKSLEETYSRIRHNNYTIPSIATQPAASLIRKMLDPEPTRRPTAKQVQRDGFFK 290          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Celegans
Match: aak-1 (5'-AMP-activated protein kinase catalytic subunit alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:P45894])

HSP 1 Score: 199.904 bits (507), Expect = 2.764e-54
Identity = 97/267 (36.33%), Postives = 159/267 (59.55%), Query Frame = 3
Query:  129 IEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVS-RSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQD 926
            I +F + E +G+G F  V R    +T  +VAIKI+++  M   G   + R E++   +L HP I  L+      + ++LV+E+   GEL   I   G L   ++R+Y +QI+ G+ Y H++ I+HRDL   NLLL  +  IKIADFGL+  +  G    T CG+PNY +PE++S +   G E D+WS G +LY ML G  PFD + +     +++SGR+ +P ++ + + DLI+ +LQ +P KR +++++ NHS+ +++    LF +
Sbjct:   21 IGNFVIKETIGKGAFGAVKRGTHIQTGYDVAIKILNRGRMKGLGTVNKTRNEIDNLQKLTHPHITRLFRVISTPSDIFLVMELVSGGELFSYITRKGALPIRESRRYFQQIISGVSYCHNHMIVHRDLKPENLLLDANKNIKIADFGLSNYMTDGDLLSTACGSPNYAAPELISNKLYVGPEVDLWSCGVILYAMLCGTLPFDDQNVPTLFAKIKSGRYTVPYSMEKQAADLISTMLQVDPVKRADVKRIVNHSWFRIDLPYYLFPE 287          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Fly
Match: SAK (gene:FBgn0026371 transcript:FBtr0078387)

HSP 1 Score: 415.616 bits (1067), Expect = 1.744e-131
Identity = 293/820 (35.73%), Postives = 439/820 (53.54%), Query Frame = 3
Query:  126 SIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENG-PLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVXXXXXXXXXXESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENIN--NQSTTNFQSIN---KSNSDSSIQTFSSVSN--QCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPV-------SLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILF-NEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQI----------DSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXX--XXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLP 2498
            +IED+EV  +LG+GGFA VY+A+   T Q+VAIK+IDKK++   G+T RVR+EVE+HSRLKHPS+L+LYTFF+DANYVYLVLE+ HNGELHR +     P +E +A   LKQ+V GL YLHS++I+HRD++L+NLLL+++M +KIADFGLATQL+   E H TMCGTPNYISPEVVSR+  GL ADVWSVGCMLYT+LVG+ PF+T  ++ TLN+V    + +P+++S  ++DLI  LL+  P +R+ L+ +  H FM                  +   N GHS+          N+F          S+S++S    II          +   ++ RN +           S+++ G   +      +  Q+H     E      Q++T     N    + S +      +V N  Q   K ++I   PLN+KR+ P R KT+NA+++IL N  V +EFLK       +  + +IN++  I   G  I++Y P      DP R  PV        + SG+ V ++  +++P K+ KKY    RFV LV+S+TPK+T ++ L KC LME     DFEI F +    +KT S            E L      D   +LL  +S    +S+     +++  +C  +C+ I   L  +  +KD  +S +P+TIGR+    +          D++   F  P   S +      L+++S    +    +N +RS+ +    +       +P+IG AT+L+ G ++VQF DG  ++ V  S     I +   N  ++       F K D LP  V  ++  +P
Sbjct:   10 TIEDYEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLLSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVLCHPFM------------------LKCSNGGHSAPG------ALNVF----------SQSMESGDSGII----------TFASSDSRNSQQI--------RSVENSGPQQVLPQIREEFKQVHHKLPYEQTGLFGQASTGLAEPNWPGAAKSSAFCMEAGNVPNSKQASLKEDRISVPPLNTKRLLPTRYKTKNAIMSILRNGEVVLEFLK----FRPTYNEDRINDICRISDDGQRIIIYQP------DPGRGLPVREQPPDLQIPSGDCVYNY--DNLPSKHWKKYIYGARFVGLVKSKTPKVTYFSTLGKCQLMET--MTDFEIRFYSGAKLLKTPS------------EGL---KVYDRNGMLLSDYSCSESRSL-----IEHGNECFTHCVNISNALE-VAQTKD--NSCFPVTIGRRPITDVQPAQRLDGLRDTTNIAFSTPK--SNQGSINFSLSTISSTRNTSDFGTNCSRSNMLAAHQNIPIKRINVPEIGIATELSHGVVQVQFYDG-SVVSVIPSMQGGGITYTQPNGTST------HFGKGDDLPFPVRDRVGQIP 731          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Fly
Match: polo (gene:FBgn0003124 transcript:FBtr0074839)

HSP 1 Score: 225.328 bits (573), Expect = 3.677e-63
Identity = 103/266 (38.72%), Postives = 169/266 (63.53%), Query Frame = 3
Query:  123 NSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNG---ELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLE-AGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKV 908
            N  + ++     G+GGFA+ Y     +TD   A KI+ KK+M  H    +  +E+ +H  L HP+I++ + +FED+  +Y+VLE+C      ELH+R +    ++E + R Y+ QI+ G+KYLH   I+HRDL L NL L   + +KI DFGLAT++E  G    T+CGTPNYI+PE++++     E D+WS+GC++YT+LVG+ PF+TK ++ T ++++   + +PS + + + D++  +LQ NP+ R  + QL N  F++ +KV
Sbjct:   20 NQRKTYKRMRFFGKGGFAKCYEIIDVETDDVFAGKIVSKKLMIKHNQKEKTAQEITIHRSLNHPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKS---ITEFECRYYIYQIIQGVKYLHDNRIIHRDLKLGNLFLNDLLHVKIGDFGLATRIEYEGERKKTLCGTPNYIAPEILTKKGHSFEVDIWSIGCVMYTLLVGQPPFETKTLKDTYSKIKKCEYRVPSYLRKPAADMVIAMLQPNPESRPAIGQLLNFEFLKGSKV 282          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Fly
Match: polo (gene:FBgn0003124 transcript:FBtr0100318)

HSP 1 Score: 225.328 bits (573), Expect = 3.677e-63
Identity = 103/266 (38.72%), Postives = 169/266 (63.53%), Query Frame = 3
Query:  123 NSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNG---ELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLE-AGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKV 908
            N  + ++     G+GGFA+ Y     +TD   A KI+ KK+M  H    +  +E+ +H  L HP+I++ + +FED+  +Y+VLE+C      ELH+R +    ++E + R Y+ QI+ G+KYLH   I+HRDL L NL L   + +KI DFGLAT++E  G    T+CGTPNYI+PE++++     E D+WS+GC++YT+LVG+ PF+TK ++ T ++++   + +PS + + + D++  +LQ NP+ R  + QL N  F++ +KV
Sbjct:   20 NQRKTYKRMRFFGKGGFAKCYEIIDVETDDVFAGKIVSKKLMIKHNQKEKTAQEITIHRSLNHPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKS---ITEFECRYYIYQIIQGVKYLHDNRIIHRDLKLGNLFLNDLLHVKIGDFGLATRIEYEGERKKTLCGTPNYIAPEILTKKGHSFEVDIWSIGCVMYTLLVGQPPFETKTLKDTYSKIKKCEYRVPSYLRKPAADMVIAMLQPNPESRPAIGQLLNFEFLKGSKV 282          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Fly
Match: AMPKalpha (gene:FBgn0023169 transcript:FBtr0070216)

HSP 1 Score: 188.734 bits (478), Expect = 1.897e-50
Identity = 95/282 (33.69%), Postives = 164/282 (58.16%), Query Frame = 3
Query:  117 PENSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVS-RSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLF-----QDFSITDS 944
            P   I  + +   LG G F +V   + Q T  +VA+KI++++ +    +  ++R+E++     +HP I++LY      + +++++E    GEL   I ++G L E QAR++ +QI+ G+ Y H + I+HRDL   NLLL  +M +KIADFGL+  +  G    T CG+PNY +PEV+S +   G E D+WS G +LY +L G  PFD + +     +++SG F +P  +++   +L+  +LQ +P KR N++++  H + Q +  + LF     QD ++ D+
Sbjct:   21 PLVKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQKDLPAYLFPSSIEQDSNVIDT 302          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Fly
Match: AMPKalpha (gene:FBgn0023169 transcript:FBtr0070217)

HSP 1 Score: 188.734 bits (478), Expect = 1.897e-50
Identity = 95/282 (33.69%), Postives = 164/282 (58.16%), Query Frame = 3
Query:  117 PENSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVS-RSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLF-----QDFSITDS 944
            P   I  + +   LG G F +V   + Q T  +VA+KI++++ +    +  ++R+E++     +HP I++LY      + +++++E    GEL   I ++G L E QAR++ +QI+ G+ Y H + I+HRDL   NLLL  +M +KIADFGL+  +  G    T CG+PNY +PEV+S +   G E D+WS G +LY +L G  PFD + +     +++SG F +P  +++   +L+  +LQ +P KR N++++  H + Q +  + LF     QD ++ D+
Sbjct:   21 PLVKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQKDLPAYLFPSSIEQDSNVIDT 302          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Zebrafish
Match: plk4 (polo-like kinase 4 (Drosophila) [Source:NCBI gene;Acc:368390])

HSP 1 Score: 311.227 bits (796), Expect = 9.307e-91
Identity = 164/286 (57.34%), Postives = 204/286 (71.33%), Query Frame = 3
Query:  123 NSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRE-NGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM-----QVNKVSDLFQDFSITDSGIGSM 959
            + IEDF+V  +LG+G FA VYRAKS  T  EVAIK+IDKK MH  GM  RV  EVE+  RLKHPS+LELY +FED+NYVYLVLEMCHNGE+ R ++E   P +E++AR ++ QIV G+ YLH++ I+HRDLTL NLLLT  M IKIADFGLATQL+   E HFTMCGTPNYISPEV +RS  GLE+DVWS+GCM Y  L G+ PFDT  ++ TLN+V  G + +P +IS  ++DLI  LLQ NP  R +L  + +H FM       +K S      SI DSGI ++
Sbjct:    7 DKIEDFKVLTLLGKGSFACVYRAKSVNTGLEVAIKMIDKKAMHKAGMVQRVINEVEIQCRLKHPSVLELYNYFEDSNYVYLVLEMCHNGEMSRYLKERKNPFTEEEARHFMHQIVKGMLYLHTHGIMHRDLTLTNLLLTTSMNIKIADFGLATQLKLPSEKHFTMCGTPNYISPEVATRSAHGLESDVWSLGCMFYAFLTGRPPFDTDTVKRTLNKVVLGEYQMPMHISAEAQDLIQQLLQKNPALRPSLSAVLDHPFMTQSGPTASKDSGSSDGGSI-DSGIATI 291          

HSP 2 Score: 150.214 bits (378), Expect = 1.766e-36
Identity = 120/405 (29.63%), Postives = 181/405 (44.69%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRK-------------------------LQLQIDSSIEYFFHPNLVSL--ENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELRN 2522
            PL + R++PIRQKT+NAV++IL N  VC+E LK      G   Q ++ EV+ I   G  + VY P     F P  D P S      +  F  + +PEKY KKYQ A +FV LV+S+TPK+T+YT  AKCMLMEN P PD E+ F +              K H   E + ++    G +  +     L   +     +++ S +    CL +   + +        + F+PITIGR+                           + +         P+++S    +L TA +   S P +      NS +           S F+P+IGWA+QL  GE+ VQFNDG QL++    + I         +   G +    + + + LP+ V  K+  L   +  L N
Sbjct:  571 PLCAARLKPIRQKTKNAVVSILGNGEVCMELLK------GQGAQERVKEVLRISCDGSMVTVYQPNEGKGF-PVLDHPPSPPEDILICSF--DDLPEKYWKKYQYATKFVQLVKSKTPKVTLYTKFAKCMLMENSPNPDLEVCFYDGA------------KTHKTSEQV-RVVEKSGKSYTVKGDVGLSGLNPECRLYIELSEEGHRMCLSLEAAITAEEQRSSKNTPFFPITIGRRPVNPVPPAPAPSSSSSCRPAAAAEVAHVCLSPPQHPQITPSMISYAGSDLTTASVAKGSSPVRKDERTVNSGK--------VLKSIFVPNIGWASQLTTGEVWVQFNDGSQLMVQVGVSCITF-------TSPEGHIT--RYKENEKLPELVKEKLHCLSSILGLLAN 936          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Zebrafish
Match: plk2b (polo-like kinase 2b (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-070720-17])

HSP 1 Score: 214.157 bits (544), Expect = 1.722e-58
Identity = 101/249 (40.56%), Postives = 153/249 (61.45%), Query Frame = 3
Query:  150 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLE-AGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM 893
            ++LG+GGFA+ Y      + +  A KII    +       ++ +E+ELH  L H  I+  Y  FED + +Y++LE C    L   ++    L+E + R YLKQ V  LKYLH  +ILHRDL L NL ++  M++K+ DFGLA +LE       T+CGTPNY+SPEV+++   G E+DVW++GC++YTML+GK PF+T  ++ T   ++  R+ LPS++S  ++ LI+G+L  NP  R +L  +  H F 
Sbjct:   58 KVLGKGGFAKCYEMTDLSSSKIYAAKIIPHTRVSKPHQREKINREIELHRTLSHKHIVHFYHHFEDKDNIYILLEYCGRRSLAHILKARKVLTEPEVRYYLKQTVSALKYLHDLEILHRDLKLGNLFVSDSMELKVGDFGLAAKLEPVSNRRKTICGTPNYLSPEVLNKQGHGWESDVWALGCIMYTMLLGKPPFETTNLKETYRCIREARYTLPSSLSLPAKQLISGMLAQNPVDRPHLDDIIRHEFF 306          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Zebrafish
Match: plk2b (polo-like kinase 2b (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-070720-17])

HSP 1 Score: 214.157 bits (544), Expect = 1.722e-58
Identity = 101/249 (40.56%), Postives = 153/249 (61.45%), Query Frame = 3
Query:  150 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLE-AGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM 893
            ++LG+GGFA+ Y      + +  A KII    +       ++ +E+ELH  L H  I+  Y  FED + +Y++LE C    L   ++    L+E + R YLKQ V  LKYLH  +ILHRDL L NL ++  M++K+ DFGLA +LE       T+CGTPNY+SPEV+++   G E+DVW++GC++YTML+GK PF+T  ++ T   ++  R+ LPS++S  ++ LI+G+L  NP  R +L  +  H F 
Sbjct:   58 KVLGKGGFAKCYEMTDLSSSKIYAAKIIPHTRVSKPHQREKINREIELHRTLSHKHIVHFYHHFEDKDNIYILLEYCGRRSLAHILKARKVLTEPEVRYYLKQTVSALKYLHDLEILHRDLKLGNLFVSDSMELKVGDFGLAAKLEPVSNRRKTICGTPNYLSPEVLNKQGHGWESDVWALGCIMYTMLLGKPPFETTNLKETYRCIREARYTLPSSLSLPAKQLISGMLAQNPVDRPHLDDIIRHEFF 306          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Zebrafish
Match: plk2a (polo-like kinase 2a (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-060810-71])

HSP 1 Score: 211.46 bits (537), Expect = 1.885e-57
Identity = 107/290 (36.90%), Postives = 165/290 (56.90%), Query Frame = 3
Query:  150 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEA-GVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIF 1016
            ++LG+GGFA+ Y      T +  A KII    +       ++ +E+ELH  L H  I++ Y  FED + +Y++LE C    L   ++    L+E + R YLKQIV GLKYLH  +ILHRDL L N  + + M++K+ DFGLA +LE       T+CGTPNY+SPEV+++   G E+DVW++GC++YTML+G+ PF+T  ++ T   ++  R+  PS++S  ++ LI+ +L  NP  R  L  +  H F       D             S N  H++ D+ H+   ++ F
Sbjct:   57 KVLGKGGFAKCYEFTDLSTGKMYAAKIIPHTRVSKPHQREKIDREIELHRALHHKHIVQFYHHFEDKDNIYILLEYCSRRSLAHILKARKVLTEPEVRYYLKQIVSGLKYLHEQEILHRDLKLGNFFINEFMELKVGDFGLAAKLEPLENRRRTICGTPNYLSPEVLNKQGHGCESDVWALGCVMYTMLLGRPPFETTNLKETYRCIREARYSTPSSLSPQAKHLISSMLAKNPVDRPQLCDILRHDFFCQGFTPDRL-----------SANCCHAAPDIHHTSPAKSFF 335          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Zebrafish
Match: plk3 (polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-6134])

HSP 1 Score: 208.379 bits (529), Expect = 1.706e-56
Identity = 96/250 (38.40%), Postives = 158/250 (63.20%), Query Frame = 3
Query:  150 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHF--TMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM 893
            ++LG+GGFAR Y       ++  A+K+I +  +       ++  E+ELH  L+H  +++    FED + +Y+ LE+C    L    +    L++ + R YL+QI+  LKYLH+  ILHRDL L N  + ++M++++ DFGLA +LE  VE    T+CGTPNY++PEV++R   G E+DVWS+GC++YT+L G  PF+T +++ T   ++  ++ LPS+++ S++ LI+ +LQ NP  RL L Q+  H + 
Sbjct:   63 KLLGKGGFARCYEMTDLANNKMYAVKVIPQSRVSKPHQREKIINEIELHKSLQHKHVVKFSHHFEDQDNIYIFLELCSRKSLAHIWKARHTLTDPEVRYYLRQIISSLKYLHNKGILHRDLKLGNFFVNENMELRLGDFGLAAKLET-VEQRKKTICGTPNYLAPEVLNRQGHGTESDVWSLGCVMYTLLCGNPPFETLDLKETYKCIKEVKYSLPSSLTPSAQKLISSILQKNPCDRLTLDQILAHDYF 311          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Xenopus
Match: rtkn2 (rhotekin 2 [Source:Xenbase;Acc:XB-GENE-993318])

HSP 1 Score: 313.538 bits (802), Expect = 2.110e-92
Identity = 167/305 (54.75%), Postives = 217/305 (71.15%), Query Frame = 3
Query:  132 EDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIR-ENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ-----VNKVSDLFQDFSITDSG---IGSMNKGHSSIDLKHSLRERNIF 1016
            EDF+V  +LG+G FA VYRA+S  T  +VAIK+IDKK M   GM  RVR EVE+H +LKHPSILELY +FED+NYVYL+LEMCHNGE++R ++    P SED+AR ++ QIV G+ YLHS+ ILHRDLTL+NLLL+ DM IKIADFGLATQL+   E HFTMCGTPNYI+PE+ +RS  GLE+DVWS+GCMLYT LVG+ PFDT  ++ TLN++    + +P  +S  ++DLI  LL+ NP  RL+L  + +H+FM       +KV    +D SI DSG   I +   G S + +    +E+ I 
Sbjct:   10 EDFKVLNLLGKGSFACVYRAQSINTGIDVAIKMIDKKAMQKVGMVQRVRNEVEIHCQLKHPSILELYNYFEDSNYVYLILEMCHNGEMNRFLKNRKKPFSEDEARHFMHQIVTGMLYLHSHGILHRDLTLSNLLLSSDMNIKIADFGLATQLKMPNEKHFTMCGTPNYIAPEIATRSAHGLESDVWSLGCMLYTFLVGRPPFDTDTVKNTLNKIVLADYEMPDFVSREAKDLIFQLLRKNPADRLSLSSVLDHAFMTGFSNVQSKVMGAVED-SI-DSGHATISTGFTGSSGVSISGRFQEKRIL 312          

HSP 2 Score: 141.354 bits (355), Expect = 1.070e-33
Identity = 108/352 (30.68%), Postives = 170/352 (48.30%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITI-KTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLI-------IVYDSNTIEM-----IKWFSW 2405
            PLN++R++PIRQKT+NAV++IL+   VC+EFLK  +       Q ++ EV+ I   G+ I VY+P     F P  ++P S     +   +  +S+PEKY KKYQ A +F+ LVRS+ PK+T YT  AKCMLMEN P  DFE+ F +   I KT  + R   K               G +  ++  S L   S  +  +++++ +                DS +L S   P+                 F+ N V L +   ++ ++ +     P   SN+ ++          S F+ ++GWA+QL  G + VQFNDG QL+       I+Y +   ++     + W+ W
Sbjct:  505 PLNAERLKPIRQKTKNAVVSILETGEVCMEFLKEQNS------QERVKEVLRISCDGNLIYVYHPNEGKGF-PLVERPPSPPENMR--SYTFDSLPEKYWKKYQYAAKFIQLVRSKMPKVTYYTRYAKCMLMENGPNADFEVCFYDGAKIHKTPDLIRVIEK--------------SGKSYTVE-GSRLSTLSDQVRSYVNHANEVMS------------ADSTNLAS---PV-----------------FYTNSVDLISYEGSVFSATTAQPSPPT--SNTLKTHAPDRAQVLKSVFVENVGWASQLNSGAVWVQFNDGSQLVVQPGVSSIIYTAPNGQITREISVAWYIW 798          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Xenopus
Match: rtkn2 (rhotekin 2 [Source:Xenbase;Acc:XB-GENE-993318])

HSP 1 Score: 313.923 bits (803), Expect = 2.813e-92
Identity = 167/305 (54.75%), Postives = 217/305 (71.15%), Query Frame = 3
Query:  132 EDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIR-ENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ-----VNKVSDLFQDFSITDSG---IGSMNKGHSSIDLKHSLRERNIF 1016
            EDF+V  +LG+G FA VYRA+S  T  +VAIK+IDKK M   GM  RVR EVE+H +LKHPSILELY +FED+NYVYL+LEMCHNGE++R ++    P SED+AR ++ QIV G+ YLHS+ ILHRDLTL+NLLL+ DM IKIADFGLATQL+   E HFTMCGTPNYI+PE+ +RS  GLE+DVWS+GCMLYT LVG+ PFDT  ++ TLN++    + +P  +S  ++DLI  LL+ NP  RL+L  + +H+FM       +KV    +D SI DSG   I +   G S + +    +E+ I 
Sbjct:   10 EDFKVLNLLGKGSFACVYRAQSINTGIDVAIKMIDKKAMQKVGMVQRVRNEVEIHCQLKHPSILELYNYFEDSNYVYLILEMCHNGEMNRFLKNRKKPFSEDEARHFMHQIVTGMLYLHSHGILHRDLTLSNLLLSSDMNIKIADFGLATQLKMPNEKHFTMCGTPNYIAPEIATRSAHGLESDVWSLGCMLYTFLVGRPPFDTDTVKNTLNKIVLADYEMPDFVSREAKDLIFQLLRKNPADRLSLSSVLDHAFMTGFSNVQSKVMGAVED-SI-DSGHATISTGFTGSSGVSISGRFQEKRIL 312          

HSP 2 Score: 130.568 bits (327), Expect = 3.058e-30
Identity = 72/162 (44.44%), Postives = 100/162 (61.73%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITI-KTESVTRSFNK 1871
            PLN++R++PIRQKT+NAV++IL+   VC+EFLK  +       Q ++ EV+ I   G+ I VY+P     F P  ++P S     +   +  +S+PEKY KKYQ A +F+ LVRS+ PK+T YT  AKCMLMEN P  DFE+ F +   I KT  + R   K
Sbjct:  553 PLNAERLKPIRQKTKNAVVSILETGEVCMEFLKEQNS------QERVKEVLRISCDGNLIYVYHPNEGKGF-PLVERPPSPPENMR--SYTFDSLPEKYWKKYQYAAKFIQLVRSKMPKVTYYTRYAKCMLMENGPNADFEVCFYDGAKIHKTPDLIRVIEK 705          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Xenopus
Match: rtkn2 (rhotekin 2 [Source:Xenbase;Acc:XB-GENE-993318])

HSP 1 Score: 313.538 bits (802), Expect = 3.111e-92
Identity = 167/305 (54.75%), Postives = 217/305 (71.15%), Query Frame = 3
Query:  132 EDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIR-ENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ-----VNKVSDLFQDFSITDSG---IGSMNKGHSSIDLKHSLRERNIF 1016
            EDF+V  +LG+G FA VYRA+S  T  +VAIK+IDKK M   GM  RVR EVE+H +LKHPSILELY +FED+NYVYL+LEMCHNGE++R ++    P SED+AR ++ QIV G+ YLHS+ ILHRDLTL+NLLL+ DM IKIADFGLATQL+   E HFTMCGTPNYI+PE+ +RS  GLE+DVWS+GCMLYT LVG+ PFDT  ++ TLN++    + +P  +S  ++DLI  LL+ NP  RL+L  + +H+FM       +KV    +D SI DSG   I +   G S + +    +E+ I 
Sbjct:   10 EDFKVLNLLGKGSFACVYRAQSINTGIDVAIKMIDKKAMQKVGMVQRVRNEVEIHCQLKHPSILELYNYFEDSNYVYLILEMCHNGEMNRFLKNRKKPFSEDEARHFMHQIVTGMLYLHSHGILHRDLTLSNLLLSSDMNIKIADFGLATQLKMPNEKHFTMCGTPNYIAPEIATRSAHGLESDVWSLGCMLYTFLVGRPPFDTDTVKNTLNKIVLADYEMPDFVSREAKDLIFQLLRKNPADRLSLSSVLDHAFMTGFSNVQSKVMGAVED-SI-DSGHATISTGFTGSSGVSISGRFQEKRIL 312          

HSP 2 Score: 140.584 bits (353), Expect = 1.826e-33
Identity = 104/325 (32.00%), Postives = 161/325 (49.54%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITI-KTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLII 2360
            PLN++R++PIRQKT+NAV++IL+   VC+EFLK  +       Q ++ EV+ I   G+ I VY+P     F P  ++P S     +   +  +S+PEKY KKYQ A +F+ LVRS+ PK+T YT  AKCMLMEN P  DFE+ F +   I KT  + R   K               G +  ++  S L   S  +  +++++ +                DS +L S   P+                 F+ N V L +   ++ ++ +     P   SN+ ++          S F+ ++GWA+QL  G + VQFNDG QL++
Sbjct:  534 PLNAERLKPIRQKTKNAVVSILETGEVCMEFLKEQNS------QERVKEVLRISCDGNLIYVYHPNEGKGF-PLVERPPSPPENMR--SYTFDSLPEKYWKKYQYAAKFIQLVRSKMPKVTYYTRYAKCMLMENGPNADFEVCFYDGAKIHKTPDLIRVIEK--------------SGKSYTVE-GSRLSTLSDQVRSYVNHANEVMS------------ADSTNLAS---PV-----------------FYTNSVDLISYEGSVFSATTAQPSPPT--SNTLKTHAPDRAQVLKSVFVENVGWASQLNSGAVWVQFNDGSQLVV 800          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Xenopus
Match: rtkn2 (rhotekin 2 [Source:Xenbase;Acc:XB-GENE-993318])

HSP 1 Score: 313.153 bits (801), Expect = 3.976e-92
Identity = 167/305 (54.75%), Postives = 217/305 (71.15%), Query Frame = 3
Query:  132 EDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIR-ENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ-----VNKVSDLFQDFSITDSG---IGSMNKGHSSIDLKHSLRERNIF 1016
            EDF+V  +LG+G FA VYRA+S  T  +VAIK+IDKK M   GM  RVR EVE+H +LKHPSILELY +FED+NYVYL+LEMCHNGE++R ++    P SED+AR ++ QIV G+ YLHS+ ILHRDLTL+NLLL+ DM IKIADFGLATQL+   E HFTMCGTPNYI+PE+ +RS  GLE+DVWS+GCMLYT LVG+ PFDT  ++ TLN++    + +P  +S  ++DLI  LL+ NP  RL+L  + +H+FM       +KV    +D SI DSG   I +   G S + +    +E+ I 
Sbjct:   10 EDFKVLNLLGKGSFACVYRAQSINTGIDVAIKMIDKKAMQKVGMVQRVRNEVEIHCQLKHPSILELYNYFEDSNYVYLILEMCHNGEMNRFLKNRKKPFSEDEARHFMHQIVTGMLYLHSHGILHRDLTLSNLLLSSDMNIKIADFGLATQLKMPNEKHFTMCGTPNYIAPEIATRSAHGLESDVWSLGCMLYTFLVGRPPFDTDTVKNTLNKIVLADYEMPDFVSREAKDLIFQLLRKNPADRLSLSSVLDHAFMTGFSNVQSKVMGAVED-SI-DSGHATISTGFTGSSGVSISGRFQEKRIL 312          

HSP 2 Score: 130.183 bits (326), Expect = 3.790e-30
Identity = 72/162 (44.44%), Postives = 100/162 (61.73%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITI-KTESVTRSFNK 1871
            PLN++R++PIRQKT+NAV++IL+   VC+EFLK  +       Q ++ EV+ I   G+ I VY+P     F P  ++P S     +   +  +S+PEKY KKYQ A +F+ LVRS+ PK+T YT  AKCMLMEN P  DFE+ F +   I KT  + R   K
Sbjct:  544 PLNAERLKPIRQKTKNAVVSILETGEVCMEFLKEQNS------QERVKEVLRISCDGNLIYVYHPNEGKGF-PLVERPPSPPENMR--SYTFDSLPEKYWKKYQYAAKFIQLVRSKMPKVTYYTRYAKCMLMENGPNADFEVCFYDGAKIHKTPDLIRVIEK 696          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Xenopus
Match: rtkn2 (rhotekin 2 [Source:Xenbase;Acc:XB-GENE-993318])

HSP 1 Score: 313.538 bits (802), Expect = 5.175e-92
Identity = 167/305 (54.75%), Postives = 217/305 (71.15%), Query Frame = 3
Query:  132 EDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIR-ENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ-----VNKVSDLFQDFSITDSG---IGSMNKGHSSIDLKHSLRERNIF 1016
            EDF+V  +LG+G FA VYRA+S  T  +VAIK+IDKK M   GM  RVR EVE+H +LKHPSILELY +FED+NYVYL+LEMCHNGE++R ++    P SED+AR ++ QIV G+ YLHS+ ILHRDLTL+NLLL+ DM IKIADFGLATQL+   E HFTMCGTPNYI+PE+ +RS  GLE+DVWS+GCMLYT LVG+ PFDT  ++ TLN++    + +P  +S  ++DLI  LL+ NP  RL+L  + +H+FM       +KV    +D SI DSG   I +   G S + +    +E+ I 
Sbjct:   10 EDFKVLNLLGKGSFACVYRAQSINTGIDVAIKMIDKKAMQKVGMVQRVRNEVEIHCQLKHPSILELYNYFEDSNYVYLILEMCHNGEMNRFLKNRKKPFSEDEARHFMHQIVTGMLYLHSHGILHRDLTLSNLLLSSDMNIKIADFGLATQLKMPNEKHFTMCGTPNYIAPEIATRSAHGLESDVWSLGCMLYTFLVGRPPFDTDTVKNTLNKIVLADYEMPDFVSREAKDLIFQLLRKNPADRLSLSSVLDHAFMTGFSNVQSKVMGAVED-SI-DSGHATISTGFTGSSGVSISGRFQEKRIL 312          

HSP 2 Score: 140.584 bits (353), Expect = 2.310e-33
Identity = 104/325 (32.00%), Postives = 161/325 (49.54%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITI-KTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLII 2360
            PLN++R++PIRQKT+NAV++IL+   VC+EFLK  +       Q ++ EV+ I   G+ I VY+P     F P  ++P S     +   +  +S+PEKY KKYQ A +F+ LVRS+ PK+T YT  AKCMLMEN P  DFE+ F +   I KT  + R   K               G +  ++  S L   S  +  +++++ +                DS +L S   P+                 F+ N V L +   ++ ++ +     P   SN+ ++          S F+ ++GWA+QL  G + VQFNDG QL++
Sbjct:  554 PLNAERLKPIRQKTKNAVVSILETGEVCMEFLKEQNS------QERVKEVLRISCDGNLIYVYHPNEGKGF-PLVERPPSPPENMR--SYTFDSLPEKYWKKYQYAAKFIQLVRSKMPKVTYYTRYAKCMLMENGPNADFEVCFYDGAKIHKTPDLIRVIEK--------------SGKSYTVE-GSRLSTLSDQVRSYVNHANEVMS------------ADSTNLAS---PV-----------------FYTNSVDLISYEGSVFSATTAQPSPPT--SNTLKTHAPDRAQVLKSVFVENVGWASQLNSGAVWVQFNDGSQLVV 820          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Mouse
Match: Plk4 (polo like kinase 4 [Source:MGI Symbol;Acc:MGI:101783])

HSP 1 Score: 323.553 bits (828), Expect = 1.260e-95
Identity = 154/286 (53.85%), Postives = 209/286 (73.08%), Query Frame = 3
Query:  129 IEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIREN-GPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSI 980
            IEDF+V  +LG+G FA VYRA+S  T  EVAIK+IDKK M+  GM  RV+ EV++H +LKHPS+LELY +FED NYVYLVLEMCHNGE++R ++    P SE +AR ++ QI+ G+ YLHS+ ILHRDLTL+N+LLT++M IKIADFGLATQL    E H+T+CGTPNYISPE+ +RS  GLE+D+WS+GCM YT+L+G+ PFDT  ++ TLN+V    + +P+ +S  ++DLI  LL+ NP  RL+L  + +H FM  N         ++ D    SM+ GH+++
Sbjct:    9 IEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVED----SMDSGHATL 290          

HSP 2 Score: 127.872 bits (320), Expect = 1.439e-29
Identity = 115/391 (29.41%), Postives = 182/391 (46.55%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYF----FHPNLVSLENLPTAIL--NSLSMPSKSPVVASNS----NRXXXXXXXXXXXXXXXP------------DIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELL 2495
            PL + R++PIRQKT+ AV++ILD+                                   I VYYP     F P  D+P  L + N +  +  +++PEKY +KYQ A RF+ LVRS+TPK+T +T  AKC+LMEN P  DFE+ F +              KIH   ENL  I    G +  L   + +      +  ++D++ +    CL  ++ + S  + +   SSF+PI +GRK      SS +        P+    E    + L  NS + P++SP ++ ++          T   +  S+ +P            ++GWATQL  G + VQFNDG QL++    ++I      S+ S + GQ  T  + + + LP+ +  K++ L
Sbjct:  554 PLIAHRLKPIRQKTKKAVVSILDS---------------------------------EEITVYYPNDGRGF-PLADRP-PLPTDN-ISRYSFDNLPEKYWRKYQYASRFIQLVRSKTPKITYFTRYAKCILMENSPGADFEVWFYDGA------------KIH-KTENLIHIIEKTGISYNLKNENEVTSLKEEVKVYMDHANEGHRICLS-LESVISEEEKRSRGSSFFPIIVGRK--PGNTSSPKALSAPPVDPSCCKGEQASASRLSVNSAAFPTQSPGLSPSTVTVEGLGHTATATGTGVSSSLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSI------SYTSPD-GQ--TTRYGENEKLPEYIKQKLQCL 883          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Mouse
Match: Plk4 (polo like kinase 4 [Source:MGI Symbol;Acc:MGI:101783])

HSP 1 Score: 323.553 bits (828), Expect = 1.260e-95
Identity = 154/286 (53.85%), Postives = 209/286 (73.08%), Query Frame = 3
Query:  129 IEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIREN-GPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSI 980
            IEDF+V  +LG+G FA VYRA+S  T  EVAIK+IDKK M+  GM  RV+ EV++H +LKHPS+LELY +FED NYVYLVLEMCHNGE++R ++    P SE +AR ++ QI+ G+ YLHS+ ILHRDLTL+N+LLT++M IKIADFGLATQL    E H+T+CGTPNYISPE+ +RS  GLE+D+WS+GCM YT+L+G+ PFDT  ++ TLN+V    + +P+ +S  ++DLI  LL+ NP  RL+L  + +H FM  N         ++ D    SM+ GH+++
Sbjct:    9 IEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVED----SMDSGHATL 290          

HSP 2 Score: 127.872 bits (320), Expect = 1.439e-29
Identity = 115/391 (29.41%), Postives = 182/391 (46.55%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYF----FHPNLVSLENLPTAIL--NSLSMPSKSPVVASNS----NRXXXXXXXXXXXXXXXP------------DIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELL 2495
            PL + R++PIRQKT+ AV++ILD+                                   I VYYP     F P  D+P  L + N +  +  +++PEKY +KYQ A RF+ LVRS+TPK+T +T  AKC+LMEN P  DFE+ F +              KIH   ENL  I    G +  L   + +      +  ++D++ +    CL  ++ + S  + +   SSF+PI +GRK      SS +        P+    E    + L  NS + P++SP ++ ++          T   +  S+ +P            ++GWATQL  G + VQFNDG QL++    ++I      S+ S + GQ  T  + + + LP+ +  K++ L
Sbjct:  554 PLIAHRLKPIRQKTKKAVVSILDS---------------------------------EEITVYYPNDGRGF-PLADRP-PLPTDN-ISRYSFDNLPEKYWRKYQYASRFIQLVRSKTPKITYFTRYAKCILMENSPGADFEVWFYDGA------------KIH-KTENLIHIIEKTGISYNLKNENEVTSLKEEVKVYMDHANEGHRICLS-LESVISEEEKRSRGSSFFPIIVGRK--PGNTSSPKALSAPPVDPSCCKGEQASASRLSVNSAAFPTQSPGLSPSTVTVEGLGHTATATGTGVSSSLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSI------SYTSPD-GQ--TTRYGENEKLPEYIKQKLQCL 883          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Mouse
Match: Plk4 (polo like kinase 4 [Source:MGI Symbol;Acc:MGI:101783])

HSP 1 Score: 323.553 bits (828), Expect = 2.044e-95
Identity = 154/286 (53.85%), Postives = 209/286 (73.08%), Query Frame = 3
Query:  129 IEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIREN-GPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSI 980
            IEDF+V  +LG+G FA VYRA+S  T  EVAIK+IDKK M+  GM  RV+ EV++H +LKHPS+LELY +FED NYVYLVLEMCHNGE++R ++    P SE +AR ++ QI+ G+ YLHS+ ILHRDLTL+N+LLT++M IKIADFGLATQL    E H+T+CGTPNYISPE+ +RS  GLE+D+WS+GCM YT+L+G+ PFDT  ++ TLN+V    + +P+ +S  ++DLI  LL+ NP  RL+L  + +H FM  N         ++ D    SM+ GH+++
Sbjct:    9 IEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVED----SMDSGHATL 290          

HSP 2 Score: 155.606 bits (392), Expect = 3.002e-38
Identity = 124/391 (31.71%), Postives = 197/391 (50.38%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYF----FHPNLVSLENLPTAIL--NSLSMPSKSPVVASNS----NRXXXXXXXXXXXXXXXP------------DIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELL 2495
            PL + R++PIRQKT+ AV++ILD+  VC+E L+  +       +  + EV+ I S G  I VYYP     F P  D+P  L + N +  +  +++PEKY +KYQ A RF+ LVRS+TPK+T +T  AKC+LMEN P  DFE+ F +              KIH   ENL  I    G +  L   + +      +  ++D++ +    CL  ++ + S  + +   SSF+PI +GRK      SS +        P+    E    + L  NS + P++SP ++ ++          T   +  S+ +P            ++GWATQL  G + VQFNDG QL++    ++I      S+ S + GQ  T  + + + LP+ +  K++ L
Sbjct:  551 PLIAHRLKPIRQKTKKAVVSILDSEEVCVELLRECAS------EGYVKEVLQISSDGTMITVYYPNDGRGF-PLADRP-PLPTDN-ISRYSFDNLPEKYWRKYQYASRFIQLVRSKTPKITYFTRYAKCILMENSPGADFEVWFYDGA------------KIH-KTENLIHIIEKTGISYNLKNENEVTSLKEEVKVYMDHANEGHRICLS-LESVISEEEKRSRGSSFFPIIVGRK--PGNTSSPKALSAPPVDPSCCKGEQASASRLSVNSAAFPTQSPGLSPSTVTVEGLGHTATATGTGVSSSLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSI------SYTSPD-GQ--TTRYGENEKLPEYIKQKLQCL 907          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Mouse
Match: Plk4 (polo like kinase 4 [Source:MGI Symbol;Acc:MGI:101783])

HSP 1 Score: 323.553 bits (828), Expect = 2.044e-95
Identity = 154/286 (53.85%), Postives = 209/286 (73.08%), Query Frame = 3
Query:  129 IEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIREN-GPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSI 980
            IEDF+V  +LG+G FA VYRA+S  T  EVAIK+IDKK M+  GM  RV+ EV++H +LKHPS+LELY +FED NYVYLVLEMCHNGE++R ++    P SE +AR ++ QI+ G+ YLHS+ ILHRDLTL+N+LLT++M IKIADFGLATQL    E H+T+CGTPNYISPE+ +RS  GLE+D+WS+GCM YT+L+G+ PFDT  ++ TLN+V    + +P+ +S  ++DLI  LL+ NP  RL+L  + +H FM  N         ++ D    SM+ GH+++
Sbjct:    9 IEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVED----SMDSGHATL 290          

HSP 2 Score: 155.606 bits (392), Expect = 3.002e-38
Identity = 124/391 (31.71%), Postives = 197/391 (50.38%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYF----FHPNLVSLENLPTAIL--NSLSMPSKSPVVASNS----NRXXXXXXXXXXXXXXXP------------DIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELL 2495
            PL + R++PIRQKT+ AV++ILD+  VC+E L+  +       +  + EV+ I S G  I VYYP     F P  D+P  L + N +  +  +++PEKY +KYQ A RF+ LVRS+TPK+T +T  AKC+LMEN P  DFE+ F +              KIH   ENL  I    G +  L   + +      +  ++D++ +    CL  ++ + S  + +   SSF+PI +GRK      SS +        P+    E    + L  NS + P++SP ++ ++          T   +  S+ +P            ++GWATQL  G + VQFNDG QL++    ++I      S+ S + GQ  T  + + + LP+ +  K++ L
Sbjct:  551 PLIAHRLKPIRQKTKKAVVSILDSEEVCVELLRECAS------EGYVKEVLQISSDGTMITVYYPNDGRGF-PLADRP-PLPTDN-ISRYSFDNLPEKYWRKYQYASRFIQLVRSKTPKITYFTRYAKCILMENSPGADFEVWFYDGA------------KIH-KTENLIHIIEKTGISYNLKNENEVTSLKEEVKVYMDHANEGHRICLS-LESVISEEEKRSRGSSFFPIIVGRK--PGNTSSPKALSAPPVDPSCCKGEQASASRLSVNSAAFPTQSPGLSPSTVTVEGLGHTATATGTGVSSSLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSI------SYTSPD-GQ--TTRYGENEKLPEYIKQKLQCL 907          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Mouse
Match: Plk4 (polo like kinase 4 [Source:MGI Symbol;Acc:MGI:101783])

HSP 1 Score: 323.553 bits (828), Expect = 2.117e-95
Identity = 154/286 (53.85%), Postives = 209/286 (73.08%), Query Frame = 3
Query:  129 IEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIREN-GPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSI 980
            IEDF+V  +LG+G FA VYRA+S  T  EVAIK+IDKK M+  GM  RV+ EV++H +LKHPS+LELY +FED NYVYLVLEMCHNGE++R ++    P SE +AR ++ QI+ G+ YLHS+ ILHRDLTL+N+LLT++M IKIADFGLATQL    E H+T+CGTPNYISPE+ +RS  GLE+D+WS+GCM YT+L+G+ PFDT  ++ TLN+V    + +P+ +S  ++DLI  LL+ NP  RL+L  + +H FM  N         ++ D    SM+ GH+++
Sbjct:    9 IEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVED----SMDSGHATL 290          

HSP 2 Score: 155.992 bits (393), Expect = 2.948e-38
Identity = 124/391 (31.71%), Postives = 197/391 (50.38%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYF----FHPNLVSLENLPTAIL--NSLSMPSKSPVVASNS----NRXXXXXXXXXXXXXXXP------------DIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELL 2495
            PL + R++PIRQKT+ AV++ILD+  VC+E L+  +       +  + EV+ I S G  I VYYP     F P  D+P  L + N +  +  +++PEKY +KYQ A RF+ LVRS+TPK+T +T  AKC+LMEN P  DFE+ F +              KIH   ENL  I    G +  L   + +      +  ++D++ +    CL  ++ + S  + +   SSF+PI +GRK      SS +        P+    E    + L  NS + P++SP ++ ++          T   +  S+ +P            ++GWATQL  G + VQFNDG QL++    ++I      S+ S + GQ  T  + + + LP+ +  K++ L
Sbjct:  554 PLIAHRLKPIRQKTKKAVVSILDSEEVCVELLRECAS------EGYVKEVLQISSDGTMITVYYPNDGRGF-PLADRP-PLPTDN-ISRYSFDNLPEKYWRKYQYASRFIQLVRSKTPKITYFTRYAKCILMENSPGADFEVWFYDGA------------KIH-KTENLIHIIEKTGISYNLKNENEVTSLKEEVKVYMDHANEGHRICLS-LESVISEEEKRSRGSSFFPIIVGRK--PGNTSSPKALSAPPVDPSCCKGEQASASRLSVNSAAFPTQSPGLSPSTVTVEGLGHTATATGTGVSSSLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSI------SYTSPD-GQ--TTRYGENEKLPEYIKQKLQCL 910          
BLAST of Serine/threonine-protein kinase PLK4 vs. UniProt/SwissProt
Match: sp|B4MXR8|PLK4_DROWI (Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni OX=7260 GN=SAK PE=3 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 5.352e-134
Identity = 285/791 (36.03%), Postives = 438/791 (55.37%), Query Frame = 3
Query:  126 SIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRE--NGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM----------QVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVXXXXXXXXXXESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVH-KSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLE--------SGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEI-LFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKL-----------QLQIDSSIEY-----------FFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIV 2363
            +IE++EV  +LG+GGFA VY+A+ ++T Q+VAIK+IDKK++H  G+++RVR+EVE+HSRLKHPS+L+LYTFF+DANYVYLVLE+ HNGELHR + +  + P +E  A   L+Q+V GL YLHS++I+HRD++L+NLLL+KDM +KIADFGLATQL+   E H TMCGTPN+ISPEVVSR   GL ADVWSVGC+LYT++VG+ PFDT  ++ TLN+V    F +P+++S  + DLI  LL+ NP +R++L+Q+  H FM          Q N       DF +   G  S+  G S I                     ++ES  S+  + IE +++   N  M           +Q    + + S +H  Y      P P SS    N + E + ++        N+ ++ +S+ T          + +Q++  PLN+ R++P R KT+NA+++IL +  V +EF+K  S L     + ++ ++  I   G  I++Y P      DP R  P+  +        +G+K + +  +S+P K+ KKY  A RFV LV+S+TPK+T ++ LAKC LMEN    DFE+  ++    +KT             GE L    +N+   +L D+     K      K +++  +C  +C+ I   L     S D  ++ +P+TIGR+             L+  ++I Y           F    + S++N   ++ ++ S  S++ + AS  N               IPD+G AT+L+ G ++VQF DG  + ++
Sbjct:   10 TIEEYEVQHLLGKGGFASVYKARCRRTYQDVAIKMIDKKLIHGTGLSSRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNQQMSHPFTEADAATILQQVVAGLLYLHSHNIMHRDISLSNLLLSKDMHVKIADFGLATQLKRPDEKHMTMCGTPNFISPEVVSRLSHGLAADVWSVGCLLYTLVVGRPPFDTDAVQSTLNKVVMSEFIMPTHLSFEACDLIEKLLKKNPHERISLEQVLRHPFMSKRSAGAEEPQYNSSKPGACDFYMEAQG-QSVASGDSGI-----------------VTFASNESRSSQRLRSIEKSAQSSSNPQMLPQ--------IQEEYGYWQPSTEHKPY------PMPLSSD---NAEWERLGSKG-------NQPHTAASVIT----------EEQQMRVPPLNTIRLQPTRYKTKNAIMSILRHGEVVLEFVKFRSKL----NEDRVTDICRISGDGRRIIIYQP------DPGRGLPIREQPPPPESHIAGDKSV-YNYDSLPSKHWKKYLYAARFVGLVKSKTPKITYFSSLAKCHLMEN--MIDFEMSYYSGAKYVKTSP-----------GEELKL--YNNYGMLLSDLACPEAK------KMIEHGNECFSHCINICNALELAQQSADSRNTCFPVTIGRRPLTDVSHSQRFDGLRDTTNIAYSTPKSHQGSINFSMSTISSVQNGSESVSSTHSHASRAQIQASQQN--------VPIKRINIPDVGIATELSHGIVQVQFYDGSMISLI 708          
BLAST of Serine/threonine-protein kinase PLK4 vs. UniProt/SwissProt
Match: sp|B4KYX8|PLK4_DROMO (Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis OX=7230 GN=SAK PE=3 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 2.104e-133
Identity = 289/817 (35.37%), Postives = 434/817 (53.12%), Query Frame = 3
Query:  126 SIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIREN--GPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVXXXXXXXXXXESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSS-------VSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRK-----LQLQIDSSIE----YFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELR 2519
            +I+++EV  +LG+GGFA VY+AK  +T Q VAIK+IDKK++   G++ RVR+EV++HSRLKHPS+L+LYTFF+DANYVYL+LE+  NGELHR + +    P +ED+A   L+Q+VDGL YLHS++I+HRD++L+NLLL+KDM +KIADFGLATQL+   E H TMCGTPNYISPEVVS    GL AD+WSVGCMLYT+LVG+ PFDT  ++ TLN+V    + +PS++S  +RDLI  LL+ NP +R++L+Q+  H FM             +  S I     G SS+D                      +SI S    I+   S    N S      R+ +      ++ +   +  GY+    N  P  +   R   TE ++N S  ++Q +  +    +    S+       V        E I   PLN+ R++P R KT+NA+++I+ N  V IEF+K  S +     + +I ++  I + G  I++Y P       P R+KP  L +      +  +++P K+ KKY  A RFV LV+S+TPK+T ++ LAKC LMEN    DFE+ F          +T+S ++          I   D +  LL  H++   K     + +++S +C  +CL I   L       +   + +P+TIGR+     L  Q   S+     + +        ++  +I    SM S + ++ S   +              I  IG AT+L+ G ++VQF DG  + ++ +S         ++   N    V+  F   D LP  V  ++  LP    +LR
Sbjct:   10 TIDEYEVQHLLGKGGFACVYKAKCLRTHQNVAIKMIDKKLIQGSGLSNRVRQEVDIHSRLKHPSVLQLYTFFQDANYVYLILELADNGELHRYMNQQMKRPFTEDEASSILRQVVDGLLYLHSHNIMHRDISLSNLLLSKDMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSHMSHGLPADLWSVGCMLYTLLVGRPPFDTDAVQSTLNKVVHSDYTMPSHLSYEARDLIDKLLRKNPHERISLEQVLRHPFM-----------LKVGGSTISYTTPG-SSVDC-------------------YGQSIASGDSGIVTFAS----NDSKNSQRLRSVEQQSMQQMLPQIQ-EEFGYYQ--ENQKPKYAAF-RLGSTEAVDN-SDMDWQRMGPNTQKGNFLVHSTPSLAPAPVPADVKANNEHISVPPLNTLRLQPTRYKTKNAIMSIVANGEVVIEFIKCKSRM----NEDRIVDICRISNDGRRIIIYQPDPGRGL-PIREKPSELHANGTDNAYTYDNLPSKHWKKYVYAARFVGLVKSKTPKVTYFSKLAKCHLMEN--MADFEMSF-----YSGAKLTKSPSE---------GIKVYDASGALLSDHTSSEAK-----RLIEHSNECFAHCLSICNALELAQTGSN---TCFPVTIGRRPIAEVLPTQRSESLRDTTNFMYSTPKSQQGSINFSISTISSMRSDNDLIGS---QMLAAQQNVPIKRLNIQGIGTATELSHGVVQVQFYDGSVISVIPESQG----GGITYTQPNG---VSTHFPNHDDLPLAVRERVSQLPQVQMKLR 747          
BLAST of Serine/threonine-protein kinase PLK4 vs. UniProt/SwissProt
Match: sp|B4LDJ6|PLK4_DROVI (Serine/threonine-protein kinase PLK4 OS=Drosophila virilis OX=7244 GN=SAK PE=3 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 1.201e-131
Identity = 282/829 (34.02%), Postives = 440/829 (53.08%), Query Frame = 3
Query:  126 SIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIREN--GPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM----------QVNKVSDLF-QDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVXXXXXXXXXXESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLE------SGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSN--LHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSS---------IEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELR 2519
            +I+++EV  +LG+GGFA VY+AK  ++ Q VAIK+IDKK++   G++ RVR+EVE+HSRLKHPS+L+LYTFF+DANYVYL+LE+  NGELHR + +    P +E +A   L+Q+VDGL YLHS++I+HRD++++NLLL+KDM +KIADFGLATQL+   E H TMCGTPNYISPEVVS    GL AD+WSVGCMLYT+LVG+ PFDT  ++ TLN+V    + +P ++S  +RDLI  LL+ NP +R++L+Q+  H FM            N  SD + Q     DSGI +     +S D K+S R R++               Q+ P    +   +I + Y   ++              H+     H  +   S  + DS+++      +N       NF +    ++ ++      +     +  E I   PLN+ R++P R KT+NA+++I+ N  V IEF+K  S +     + +I ++  I   G  I+++ P      DP R  P+  +      SG   + +  +++P K+ KKY  A RFV LV+S+TPK+T ++ LAKC LMEN    DFE+ +                   ++G  L + S ++G  +  D+H    L + S    + +++S +C  +CL I   L       +   + +P+TIGR+  +++  S           + +        ++  +I    SM S S  + S   +              +P +G AT+L+ G ++VQF DG  + ++ ++         ++   N    V+  F   D LP  V  ++  LP    +LR
Sbjct:   10 TIDEYEVQHLLGKGGFACVYKAKCLRSHQNVAIKMIDKKLIQGSGLSNRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLILELADNGELHRYMNQQMKRPFTEQEAASILRQVVDGLLYLHSHNIMHRDISMSNLLLSKDMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSHQSHGLPADLWSVGCMLYTLLVGRPPFDTDAVQSTLNKVVQSDYTIPGHLSYEARDLIDKLLRKNPHERISLEQVLRHPFMVKAGGSTISYTTNGASDGYGQSIVSGDSGIVTF----ASNDSKNSHRLRSV-------------EQQATP----QMMPQIQEEYGYYQD--------------HRQKYAPHAAYRQSSAETLDSTEMDWQRMGQNAQK---ANFLA---HSTPAAPVPAPVIRKAGKHNTEHISVPPLNTLRLQPTRYKTKNAIMSIVANGEVVIEFIKSKSKM----NEDRIIDICRISGDGRRIIIHQP------DPGRGLPIQEQTSETHSSGTDNV-YNYDNLPSKHWKKYVYAARFVGLVKSKTPKVTYFSALAKCHLMEN--MTDFEMNY-------------------YSGAKLTK-SPSEGIKV-FDIHGVQLLDQSSSEAKRLIEHSNECFAHCLSICNALELAQTGSN---TCFPVTIGRRPVVEVLPSHRPEGLRDTTNFAYSTPKSQQGSINFSISTISSMRSGSDNIGS---QLLAAQQNVPIKRLNVPGVGTATELSHGIVQVQFVDGSVISVIPEAQG----GGITYTQSNG---VSTHFPDHDDLPLSVRDRLSHLPQVQMKLR 750          
BLAST of Serine/threonine-protein kinase PLK4 vs. UniProt/SwissProt
Match: sp|O97143|PLK4_DROME (Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster OX=7227 GN=SAK PE=1 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 1.748e-130
Identity = 293/820 (35.73%), Postives = 439/820 (53.54%), Query Frame = 3
Query:  126 SIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENG-PLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVXXXXXXXXXXESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENIN--NQSTTNFQSIN---KSNSDSSIQTFSSVSN--QCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPV-------SLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILF-NEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQI----------DSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXX--XXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLP 2498
            +IED+EV  +LG+GGFA VY+A+   T Q+VAIK+IDKK++   G+T RVR+EVE+HSRLKHPS+L+LYTFF+DANYVYLVLE+ HNGELHR +     P +E +A   LKQ+V GL YLHS++I+HRD++L+NLLL+++M +KIADFGLATQL+   E H TMCGTPNYISPEVVSR+  GL ADVWSVGCMLYT+LVG+ PF+T  ++ TLN+V    + +P+++S  ++DLI  LL+  P +R+ L+ +  H FM                  +   N GHS+          N+F          S+S++S    II          +   ++ RN +           S+++ G   +      +  Q+H     E      Q++T     N    + S +      +V N  Q   K ++I   PLN+KR+ P R KT+NA+++IL N  V +EFLK       +  + +IN++  I   G  I++Y P      DP R  PV        + SG+ V ++  +++P K+ KKY    RFV LV+S+TPK+T ++ L KC LME     DFEI F +    +KT S            E L      D   +LL  +S    +S+     +++  +C  +C+ I   L  +  +KD  +S +P+TIGR+    +          D++   F  P   S +      L+++S    +    +N +RS+ +    +       +P+IG AT+L+ G ++VQF DG  ++ V  S     I +   N  ++       F K D LP  V  ++  +P
Sbjct:   10 TIEDYEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLLSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVLCHPFM------------------LKCSNGGHSAPG------ALNVF----------SQSMESGDSGII----------TFASSDSRNSQQI--------RSVENSGPQQVLPQIREEFKQVHHKLPYEQTGLFGQASTGLAEPNWPGAAKSSAFCMEAGNVPNSKQASLKEDRISVPPLNTKRLLPTRYKTKNAIMSILRNGEVVLEFLK----FRPTYNEDRINDICRISDDGQRIIIYQP------DPGRGLPVREQPPDLQIPSGDCVYNY--DNLPSKHWKKYIYGARFVGLVKSKTPKVTYFSTLGKCQLMET--MTDFEIRFYSGAKLLKTPS------------EGL---KVYDRNGMLLSDYSCSESRSL-----IEHGNECFTHCVNISNALE-VAQTKD--NSCFPVTIGRRPITDVQPAQRLDGLRDTTNIAFSTPK--SNQGSINFSLSTISSTRNTSDFGTNCSRSNMLAAHQNIPIKRINVPEIGIATELSHGVVQVQFYDG-SVVSVIPSMQGGGITYTQPNGTST------HFGKGDDLPFPVRDRVGQIP 731          
BLAST of Serine/threonine-protein kinase PLK4 vs. UniProt/SwissProt
Match: sp|Q2LYK3|PLK4_DROPS (Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=SAK PE=3 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 1.758e-130
Identity = 282/832 (33.89%), Postives = 444/832 (53.37%), Query Frame = 3
Query:  126 SIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIREN--GPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ-----------VNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVXXXXXXXXXXESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKI--EQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKY-QWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVS-------LESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEY--------FFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXX--XXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELR 2519
            +IE++EV  +LG+GGFA VY+A+   + Q+VAIK+IDKK++   G+T+RVR+EVE+HSRLKHPS+L+LYTFF+D NYVYLVLE+ HNGEL R ++++   P +E +    L+Q+V GL YLHS++I+HRD++L+NLLL+K+M IKIADFGLATQL+   E H TMCGTPNYISPEVVSR   GL ADVWSVGCMLYT+LVG+ PF+T+ +  TLN+V    F +PS++S  ++DLI  LL+ +P +R+ L+Q+  H F++              +++  Q  + +DSGI +     +S D + S R R++          ++ S QS P        +I++ Y    N   + K        H+   + HG +     P+P     +R+ K    NN                 +  F+S S+   + +  +++   PL +KR++P R KT+NA+++IL    V +EF+K        KY + +I ++  I   G  I++Y P      DP R  P+        + S N V ++  E++P K+ KKY  A RFV LV+S+TPK+T ++ L KC LME     DFE+ F     +  +S T      + NG  L      +  N+                  +D+  +C  +C+ I   L  L  +K+  ++ +P+TIGR+    + +   +        F +    S +      ++++S    +    SN+ R + +    +       +P+IG  T+L+ G ++VQF DG  + ++            ++   N    ++  F   D LP  V  +I  +P    +L+
Sbjct:   10 TIEEYEVQHLLGKGGFASVYKARCLHSHQDVAIKMIDKKLIQGTGLTSRVRQEVEIHSRLKHPSVLQLYTFFQDVNYVYLVLELAHNGELQRYMKQHLLRPFTESEGATILRQVVAGLLYLHSHNIMHRDISLSNLLLSKEMHIKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRLSHGLPADVWSVGCMLYTLLVGRPPFETEGVESTLNKVVMSEFMMPSHLSFEAQDLIHKLLKKSPHERITLEQVLRHPFLKRTVGGSSYSTTPGALNEFSQSLASSDSGIVTF----ASSDSRKSHRLRSV----------DNSSGQSMP--------QIMEEYLPSSNLGYDSKE-------HRPVYEQHGSYL----PTPGDQLENRDAKWPGTNN-----------------LAPFTSDSDMIPSPVGEKRLLMPPLETKRLQPTRYKTKNAIMSILRTGEVVLEFVKFK-----VKYNEDRITDICRISEDGRRIIIYQP------DPGRGLPIREHPPDPLIPSENCVYNY--ENLPNKHWKKYVYAARFVGLVKSKTPKITFFSSLGKCQLMET--MTDFEVRFYSGAKL-LKSSTDGVKVFNSNGAVLSDNGCAEARNL------------------IDHGNECFSHCVNISNAL-ELAQTKE--NTCFPVTIGRRPAADMHAGQRFDGLRDTTNFAYSTPKSNQGSINFSVSTISTTRSASDYNSNTPRLNMLAAHQNVPIKRITVPEIGIVTELSHGVVQVQFYDGSMVSVIPKVQG----GGITYTQANG---LSTHFGNNDDLPFAVRDRINQMPQLQMKLK 747          
BLAST of Serine/threonine-protein kinase PLK4 vs. TrEMBL
Match: A0A4E0RMG5 (Serine/threonine-protein kinase PLK4 OS=Fasciola hepatica OX=6192 GN=D915_000406 PE=4 SV=1)

HSP 1 Score: 557.37 bits (1435), Expect = 1.577e-180
Identity = 356/902 (39.47%), Postives = 489/902 (54.21%), Query Frame = 3
Query:  111 EYPENSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSM----------NKGHSSIDLKHSLRE---RNIFVXXXXXXXXXXESIQSKP-FKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGY----------HSLFSNPSPD-----------SSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPAS----DLPGSK----------YQWKINEVMCIDSSGHSILVYYPLST---CPFD----------------------PDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFN-GENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKI-------IQQLHSLPDSKDLISSFYPITIGRKLQ----LQIDSSIEYFFHPNLV------SLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNS--GQVVTKE-FSKTDTLPDEVHSKIELLPLFVKELRNKYS 2531
            +YPE SI DF V+E+LGRGGFA+VYRAKS  T QEVAIK+IDKK M  HG+T RVR+EVE+HSRLKHPSILELYT FEDANYVYLVLE+CHNGEL   IR+NGP+SED AR YLKQ++ GL YLHS++ILHRDLTLANLLLTKDMK+KIADFGLAT++E G +H TMCGTPNYISPEV S  +QGLE DVWSVGCM YT++VG+ PFDT+E+R TLNRV +  + LP+ +S  + DLI  LL+ +P +R+ L+ ++ H FM    ++    + S  DSGI SM          N   SS     +  E   R      + +L++    + S P F+     S          +       +  N L    ++D  GY           S  S P+P+           SS       TE +  Q+  + +     +S        S      N +E  +P PLN +R+RP+R  TR AV+NI D+ +VC+EFL+ +     +  G K           Q  + EVM ID +G  I+VY P S+    P D                      P R +P     G+ V  F L+ +PEKY KKYQ   +F+ +VR+ TPK+T+Y+  AKCMLMEN P  DF   F E+ T    S   S      + G + P        +I+LD   +L   + +    LDY  + +E C          I Q  ++ + +   S  +P  IGR+ +    +  +S        +L       +L +LP  +L+ +S    S VV    ++       +S    FIP +GWA Q +  EL+VQFNDG QL++ YD + +  I +      +   GQ+ T + ++ +D LPDEVH ++EL+PL ++ LR + S
Sbjct:   40 DYPETSIFDFHVFELLGRGGFAQVYRAKSIITGQEVAIKMIDKKAMLQHGLTNRVRREVEIHSRLKHPSILELYTCFEDANYVYLVLEICHNGELQTYIRQNGPVSEDVARHYLKQLISGLAYLHSHNILHRDLTLANLLLTKDMKVKIADFGLATKIEPGEDHKTMCGTPNYISPEVASHGQQGLETDVWSVGCMFYTLIVGRPPFDTREVRSTLNRVLAVDYELPTTLSPEATDLIGCLLKRHPQERIKLRAIAQHPFMCKKAINPRLMETS-NDSGIDSMARTPLGCLTNNLTRSSTTKSEASAEPHSRPPLGLLSAALSDAQYQVSSTPYFQTFPRQSSFSGTIGSAGSVPPKSAKSASNTLPRSGTLDQEGYLQMGTARVTLPSCPSAPNPNRGLTSLSGLSMSSVSRPTGCTETVTAQTKPDTRRPQSRDSSRRPVGVRSRMGSASNSVES-RPSPLNGRRLRPMRTYTRLAVINIFDDESVCVEFLRGSQGKRKESMGRKPIDPSCFNGDRQLVVMEVMGIDRTGMQIVVYQPGSSNHGVPLDTRGLFETSQSSEPCDSTQQSGFPPRAQP-----GDHVSLFWLDKLPEKYWKKYQFVSKFITMVRAHTPKITMYSQRAKCMLMENGPPADFLAEFYEDETRIACSADGSIRITQIDPGSSKP-------VSIILDSDRSLTALAPTTRGLLDYVSEQREKCQTFEKLLSASINQCSTIDEPR---SCPFPAIIGRRPKPAGIVHSNSKSAAPAQTSLCMVNCGSTLADLPATLLDLIS----SNVVP---DQRCSQICPTSSKPVFIPQVGWADQRSADELQVQFNDGAQLLLTYDRSLVRSIHFTPPPHPDGTVGQMATAQRYTTSDPLPDEVHRRLELMPLVIQHLRMQSS 917          
BLAST of Serine/threonine-protein kinase PLK4 vs. TrEMBL
Match: A0A504YXI7 (Serine/threonine-protein kinase PLK4 OS=Fasciola gigantica OX=46835 GN=FGIG_01934 PE=4 SV=1)

HSP 1 Score: 555.444 bits (1430), Expect = 7.963e-180
Identity = 359/901 (39.84%), Postives = 491/901 (54.50%), Query Frame = 3
Query:  111 EYPENSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSM----------NKGHSSIDLKHSLRE---RNIFVXXXXXXXXXXESIQSKP-FKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGY----------HSLFSNPSPD-----------SSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFL-------------KPA--SDLPGSKYQWKINEVMCIDSSGHSILVYYPLS---TCPFD----------------------PDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFN-GENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSK-----DLISSFYPITIGRKLQ----LQIDSSIEYFFHPNLV------SLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNS--GQVVTKE-FSKTDTLPDEVHSKIELLPLFVKELRNKYS 2531
            +YPE SI DF V+E+LGRGGFA+VYRAKS  T QEVAIK+IDKK M  HG+T RVR+EVE+HSRLKHPSILELYT FEDANYVYLVLE+CHNGEL   IR+NGP+SED AR YLKQ++ GL YLHS++ILHRDLTLANLLLTKDMK+KIADFGLAT++E G +H TMCGTPNYISPEV S  +QGLE DVWSVGCM YT++VG+ PFDT+E+R TLNRV +  + LP+ +S  + DLI  LL+ +P +R+ L+ ++ H FM    V+    + S  DSGI SM          N   SS     +  E   R      + +L++    + S P F+     S          +       +  N L    ++D   Y           S  S P+P+           SS       TE +  Q+  + +     +S        S      N +E  +P PLN +R+RP+R  TR AV+NI D+ +VC+EFL             KP   S   G + Q  + EVM ID +G  I+VY P S     P D                      P R +P     G+ V  F L+ +PEKY KKYQ   +F+ +VR+ TPK+T+Y+  AKCMLMEN P  DF   F E+ T    S   S      + G + P        +I+LD   +L   + +    LDY  + +E C +  ++L S   ++     +L S  +P  IGR+ +    +  +S        +L       +L +LP  +L+ +S PS +P      ++       +S    FIP +GWA Q +  EL+VQFNDG QL++ YD + +  I +      +   GQ+ T + ++ +D LPDEVH ++EL+PL ++ LR + S
Sbjct:   35 DYPETSIFDFHVFELLGRGGFAQVYRAKSIITGQEVAIKMIDKKAMLQHGLTNRVRREVEIHSRLKHPSILELYTCFEDANYVYLVLEICHNGELQTYIRQNGPVSEDVARHYLKQLISGLVYLHSHNILHRDLTLANLLLTKDMKVKIADFGLATKIEPGEDHKTMCGTPNYISPEVASHGQQGLETDVWSVGCMFYTLIVGRPPFDTREVRSTLNRVLAVDYELPTTLSPEATDLIGCLLKRHPQERIKLRAIAQHPFMCKKAVNPRLMETS-NDSGIDSMARTPLGCLTNNLTRSSTTKSEASAEPHSRPPLGLLSAALSDAQYQVSSTPYFQTFPRQSSFSGTIGSAGSVPPKSAKSASNTLPRSGTLDQESYLQMGTARVTLPSCPSAPNPNRGLTSLSGLSMSSVSRPTGCTETVTAQTKPDTRRSQSRDSSRRPVGVRSRMGSGSNSVES-RPSPLNGRRLRPMRTYTRLAVINIFDDESVCVEFLRGSQGKRKESMGRKPTDPSCFNGDR-QLVVMEVMGIDRTGMQIVVYQPGSLSHGVPLDTRGLFETSQSSEPCDSTQQSGFPPRAQP-----GDHVSLFWLDKLPEKYWKKYQFVSKFITMVRAHTPKITMYSQRAKCMLMENGPPADFLAEFYEDETRIACSADGSIRITQIDPGSSKP-------VSIILDSDRSLTALAPTTRGLLDYVSEQREKC-QTFEKLLSASINQCSTIDELRSCPFPAIIGRRPKPAGIVHSNSKSAAPAQTSLCMVNCGSTLADLPATLLDLIS-PSVAP------DQRCAQIFSTSSKPVFIPQVGWADQRSADELQVQFNDGAQLLLTYDRSLVRSIHFTPPPHPDGTVGQMATAQRYTTSDPLPDEVHRRLELMPLVIQHLRMQSS 912          
BLAST of Serine/threonine-protein kinase PLK4 vs. TrEMBL
Match: W6U897 (Serine/threonine-protein kinase PLK4 OS=Echinococcus granulosus OX=6210 GN=EGR_08557 PE=4 SV=1)

HSP 1 Score: 529.635 bits (1363), Expect = 1.398e-171
Identity = 322/821 (39.22%), Postives = 458/821 (55.79%), Query Frame = 3
Query:  114 YPENSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVXXXXXXXXXXESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMEN-DPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTN--ILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLH----SLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXX---XXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWF--SWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELRNKYSSQS 2540
            Y E  + DF+V+E+LGRGGFA+VYRAKS  T QEVAIK+IDKK MH HG+T RV++EVE+HSRLKHP++LELYT FEDANYVYLVLE C NGEL   IR+NG +SED AR Y+KQI+ GL YLHS++ILHRDLTLANLLLTKDMK+KIADFGLAT++E G +H TMCGTPNYISPEV SR  Q LE DVWS+GCMLYT++VG  PFDT+E+R TL+RV +G + +P ++S    DLIA LL+  P  R+ L  +  H F+  +       + S  DSGI SM++   +  +               S  N+  S+  +P   I               + +N ++  Q PL   +  D  G+        P S+   R    +++   S +    ++ + S  S    +SV N       Q +  PL + R+RP+R  TR AV+NIL + +VC+EF  P  D      Q  + EVM I + G  +++Y+P       P+ + PV+  SG+    + L  +PEKY KKYQ   +F+++ ++ TPK+T+YT  AKC+LME  +PQ DFE+          E +T     I   GE    +     TN  + +D    L     +  + + Y+ +C+  CL++   L     +L      +SS +P+ IGR+                  S     T+    +S    S +VAS S   S    +S        F+P +GW +Q +  EL+VQFNDG +L++VY + T+  I++   +   +   + V    S +  LP EV S++E++P  VK LR++  + S
Sbjct:    7 YLERRLHDFQVFELLGRGGFAQVYRAKSVITGQEVAIKMIDKKYMHQHGLTHRVQREVEIHSRLKHPAVLELYTCFEDANYVYLVLEFCDNGELQAYIRQNGSVSEDMARHYMKQIISGLLYLHSHNILHRDLTLANLLLTKDMKVKIADFGLATKIEPGEDHTTMCGTPNYISPEVASRGHQVLETDVWSLGCMLYTLVVGHPPFDTREVRSTLSRVIAGDYEMPEHLSPDCSDLIAKLLRKQPQDRIKLSDMIRHPFITRSTTPRRKMEHS-RDSGIDSMSR---TPTIGMQSNSLTATTTTTASTANSRHSLPYRPGASILPPRPASRLSVDMHRSTQNQQSGHQTPL---TPFDSRGHQ------PPTSATRLRGGSLQHLLPPSKS-MSGLSLATSSPSPCRSASVGN-LQRISHQPRLSPLCTCRLRPMRTVTRMAVINILPDESVCLEFFDPQVD-----QQKLVVEVMGISADGQEVIIYHPNGGRGVPPNTNSPVAARSGDTYGVYRLAQLPEKYWKKYQFVSKFINMAKAHTPKVTLYTSRAKCILMEKVEPQADFEM----------EVLTDGSRVICLGGEATGTVQVITQTNGTVTVDRKQPLDNLPTTTRELISYAERCRRRCLEVESSLEKFNVALSPLDAEVSSPFPVIIGRR------------------SCAASKTSSKGPVSSTCLSQLVASCSTSVSDSQPRSFSRHYDPVFVPSVGWVSQPSPEELQVQFNDGARLVVVYSTATVHSIRYHPPAIAGEEEEEQVYSTASSSTPLPAEVRSRLEVIPKVVKCLRSRSKTPS 779          
BLAST of Serine/threonine-protein kinase PLK4 vs. TrEMBL
Match: A0A087VY93 (Serine:threonine protein kinase PLK4 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000104700 PE=4 SV=1)

HSP 1 Score: 527.709 bits (1358), Expect = 6.942e-171
Identity = 318/814 (39.07%), Postives = 461/814 (56.63%), Query Frame = 3
Query:  123 NSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVXXXXXXXXXXESIQSKPFK----IIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMEN-DPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTN--ILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLH----SLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWF--SWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELRNK 2525
            +S +DF+V+E+LGRGGFA+VYRAKS  T QEVAIK+IDKK MH HG+T RV++EVE+HSRLKHP++LELYT FEDANYVYLVLE C NGEL   IR+NG +SED AR Y+KQI+ GL YLHS++ILHRDLTLANLLLTKDMK+KIADFGLAT++E G +H TMCGTPNYISPEV SR  Q LE DVWS+GCMLYT++VG  PFDT+E+R TL+RV +G + +P ++S    DLIA LL+  P  R+ L  +  H F+  +       + S  DSGI SM++   +I +     + N       +    + S  S P++    I+   +    +  M  +  +N ++  Q PL   +  D  G+        P S+   R    +++   S +    ++ + S  S    +SV N       Q    PL + R+RP+R  TR AV+NIL + +VC+EF  P  +      Q  + EVM I + G  +++Y+P       P+ + PV+  SG+    + L  +PEKY KKYQ   +F+++ ++ TPK+T+YT  AKC+LME  +PQ DFE+          E +T     I   GE    +     TN  + +D    L     +  + + Y+ +C+  CL++   L     +L      +SS +P+ IGR+      +S          S   + +A L+ L     + V  S        +        F+P +GW +Q +  EL+VQFNDG +L++VY + T+  I++   +   +   + V    S +  LP EV S++E++P  VK LR++
Sbjct:   12 SSKDDFQVFELLGRGGFAQVYRAKSVITGQEVAIKMIDKKYMHQHGLTHRVQREVEIHSRLKHPAVLELYTCFEDANYVYLVLEFCDNGELQAYIRQNGSVSEDMARHYMKQIISGLLYLHSHNILHRDLTLANLLLTKDMKVKIADFGLATKIEPGEDHTTMCGTPNYISPEVASRGHQVLETDVWSLGCMLYTLVVGHPPFDTREVRSTLSRVIAGDYEMPEHLSPDCSDLIAKLLRKQPQDRIKLSDMIRHPFITRSTTPRRKMEHS-RDSGIDSMSRT-PTIGM-----QSNSLTATTTTTAATANSRHSLPYRPGASILPPRAASRLSVDMHRST-QNQQSGHQTPL---TPFDSRGHQ------PPTSATRLRGGSLQHLLPPSKS-MSGLSLATSSPSPCRSASVGN-LQRTSHQPSLSPLCTCRLRPMRTVTRMAVINILPDESVCLEFFDPQVN-----QQKLVVEVMGISADGQEVIIYHPNGGRGVPPNTNSPVAARSGDTYGVYRLAQLPEKYWKKYQFVSKFINMAKAHTPKVTLYTSRAKCILMEKVEPQADFEM----------EVLTDGSRVICLGGEAAGTVQVITQTNGTVTVDRKQPLDNLPTATRELISYAERCRRRCLEVESSLEKFNVALSPLDAEVSSPFPVIIGRRSCAASKTS----------SKGPVSSACLSQLVASCGTSVSDSQPR-----SFSRHYDPVFVPSVGWVSQSSPEELQVQFNDGARLVVVYSTATVHSIRYHPPAIAGEEEEEQVYSTASSSTPLPAEVRSRLEVIPKVVKCLRSR 776          
BLAST of Serine/threonine-protein kinase PLK4 vs. TrEMBL
Match: A0A068WV30 (Serine:threonine protein kinase PLK4 OS=Echinococcus granulosus OX=6210 GN=EgrG_000104700 PE=4 SV=1)

HSP 1 Score: 527.324 bits (1357), Expect = 9.675e-171
Identity = 321/818 (39.24%), Postives = 458/818 (55.99%), Query Frame = 3
Query:  123 NSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVXXXXXXXXXXESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMEN-DPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTN--ILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLH----SLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXX---XXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWF--SWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELRNKYSSQS 2540
            +S +DF+V+E+LGRGGFA+VYRAKS  T QEVAIK+IDKK MH HG+T RV++EVE+HSRLKHP++LELYT FEDANYVYLVLE C NGEL   IR+NG +SED AR Y+KQI+ GL YLHS++ILHRDLTLANLLLTKDMK+KIADFGLAT++E G +H TMCGTPNYISPEV SR  Q LE DVWS+GCMLYT++VG  PFDT+E+R TL+RV +G + +P ++S    DLIA LL+  P  R+ L  +  H F+  +       + S  DSGI SM++   +  +               S  N+  S+  +P   I               + +N ++  Q PL   +  D  G+        P S+   R    +++   S +    ++ + S  S    +SV N       Q +  PL + R+RP+R  TR AV+NIL + +VC+EF  P  D      Q  + EVM I + G  +++Y+P       P+ + PV+  SG+    + L  +PEKY KKYQ   +F+++ ++ TPK+T+YT  AKC+LME  +PQ DFE+          E +T     I   GE    +     TN  + +D    L     +  + + Y+ +C+  CL++   L     +L      +SS +P+ IGR+                  S     T+    +S    S +VAS S   S    +S        F+P +GW +Q +  EL+VQFNDG +L++VY + T+  I++   +   +   + V    S +  LP EV S++E++P  VK LR++  + S
Sbjct:   12 SSKDDFQVFELLGRGGFAQVYRAKSVITGQEVAIKMIDKKYMHQHGLTHRVQREVEIHSRLKHPAVLELYTCFEDANYVYLVLEFCDNGELQAYIRQNGSVSEDMARHYMKQIISGLLYLHSHNILHRDLTLANLLLTKDMKVKIADFGLATKIEPGEDHTTMCGTPNYISPEVASRGHQVLETDVWSLGCMLYTLVVGHPPFDTREVRSTLSRVIAGDYEMPEHLSPDCSDLIAKLLRKQPQDRIKLSDMIRHPFITRSTTPRRKMEHS-RDSGIDSMSR---TPTIGMQSNSLTATTTTTASTANSRHSLPYRPGASILPPRPASRLSVDMHRSTQNQQSGHQTPL---TPFDSRGHQ------PPTSATRLRGGSLQHLLPPSKS-MSGLSLATSSPSPCRSASVGN-LQRISHQPRLSPLCTCRLRPMRTVTRMAVINILPDESVCLEFFDPQVD-----QQKLVVEVMGISADGQEVIIYHPNGGRGVPPNTNSPVAARSGDTYGVYRLAQLPEKYWKKYQFVSKFINMAKAHTPKVTLYTSRAKCILMEKVEPQADFEM----------EVLTDGSRVICLGGEATGTVQVITQTNGTVTVDRKQPLDNLPTTTRELISYAERCRRRCLEVESSLEKFNVALSPLDAEVSSPFPVIIGRR------------------SCAASKTSSKGPVSSTCLSQLVASCSTSVSDSQPRSFSRHYDPVFVPSVGWVSQPSPEELQVQFNDGARLVVVYSTATVHSIRYHPPAIAGEEEEEQVYSTASSSTPLPAEVRSRLEVIPKVVKCLRSRSKTPS 781          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Cavefish
Match: plk4 (polo like kinase 4 [Source:NCBI gene;Acc:103032271])

HSP 1 Score: 304.294 bits (778), Expect = 2.112e-88
Identity = 159/284 (55.99%), Postives = 203/284 (71.48%), Query Frame = 3
Query:  123 NSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRE-NGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM-----QVNKVSDLFQDFSITDSGIG 953
            + IEDF+V  +LG+G FA VYRAKS  T  EVAIK+IDKK MH  GM  RV  EVE+  RLKHPSILELY +FED+NYVYLVLEMCHNGE+ R +++   P +E++ R ++ QIV G+ YLH++ I+HRDLTL+NLLL+  M IKIADFGLATQL+   E HFTMCGTPNYISPEV +RS  GLE+DVWS+GCM Y  L G+ PFDT  ++ TLN+V  G + + +++S  ++DLI  LLQ +P  R +L  + +H FM       +K S   +  SI DSGI 
Sbjct:    7 DKIEDFKVLTLLGKGSFACVYRAKSVNTGLEVAIKMIDKKAMHKAGMVQRVINEVEIQCRLKHPSILELYNYFEDSNYVYLVLEMCHNGEMSRYLKDRKKPFTEEEVRLFMHQIVKGMLYLHTHGIMHRDLTLSNLLLSSSMNIKIADFGLATQLKLPSEKHFTMCGTPNYISPEVATRSAHGLESDVWSLGCMFYAFLTGRPPFDTDTVKQTLNKVVLGEYQMATHVSAEAQDLIRQLLQKDPTLRPSLSAVLDHPFMTQSGPTASKDSGASEGGSI-DSGIA 289          

HSP 2 Score: 150.599 bits (379), Expect = 9.763e-37
Identity = 112/351 (31.91%), Postives = 164/351 (46.72%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRK-------------------------LQLQIDSSIEYFFHPNLVSL--ENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLII 2360
            PL + R++PIRQKT+NAV++ILD   VC+E LK      G   Q ++ EV+ I   G  + VY P     F P  D P S      +  +  E +PEKY KKYQ A +FV LV+S+TPK+T+YT  AKCMLMEN P  D E+ F +              K H +G+ + ++    G +  +     L   S     +++ + +    CL +   + +        + F+PITIGR+                          Q+ +         P+++S    +  TA L   S P +S     N N            S F+P+IGWA+QL  GE+ VQFNDG QL++
Sbjct:  562 PLCAARLKPIRQKTKNAVVSILDTGEVCMELLK------GQGTQERVKEVLRISCDGSMVTVYQPNDGKGF-PVLDHPPSPPEDIFICSY--EDLPEKYWKKYQYATKFVQLVKSKTPKVTLYTKFAKCMLMENSPNADLEVCFYDGA------------KTHRSGDQV-RVVEKSGKSYTMKGDIGLSGVSPECRLYMELADEGHRMCLSLEAAISAEEQRSARATPFFPITIGRRPTNPTSSFPATQPASDQSPAMPAEVAQVCLSPPQAPHITPSMISYNGSDFTTASLAKGSSP-QSAKDGHNVN------TGKVLKSIFVPNIGWASQLTTGEVWVQFNDGSQLVV 883          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Cavefish
Match: plk2b (serine/threonine-protein kinase PLK2 [Source:NCBI gene;Acc:103027010])

HSP 1 Score: 217.624 bits (553), Expect = 1.046e-59
Identity = 103/249 (41.37%), Postives = 152/249 (61.04%), Query Frame = 3
Query:  150 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLE-AGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM 893
            ++LG+GGFA+ Y        +  A KII    +       ++ +E+ELH  L H  I+  Y  FED + +Y++LE C    L   ++    L+E + R YL+Q V  LKYLH  +ILHRDL L NL ++  M++K+ DFGLA +LE       T+CGTPNY+SPEV+++   G E+D+W++GC++YTML+GK PF+T  +R T   ++  R+ LPS IS S+R LIA +L  NP  R  L ++  H F+
Sbjct:   59 KVLGKGGFAKCYELTDLSAGKVYAAKIIPHSRVAKPHQREKINREIELHRALSHKHIVHFYHSFEDKDNIYILLEYCSRRSLAHILKARKVLTEPEVRYYLRQTVSALKYLHDQEILHRDLKLGNLFVSDSMELKVGDFGLAAKLEPVSNRRKTICGTPNYLSPEVLNKQGHGWESDIWALGCVMYTMLLGKPPFETTNLRETYRCIREARYSLPSTISLSARQLIASMLSRNPTDRPRLDEIIRHEFL 307          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Cavefish
Match: plk2a (serine/threonine-protein kinase PLK2 [Source:NCBI gene;Acc:103036971])

HSP 1 Score: 216.083 bits (549), Expect = 3.224e-59
Identity = 108/291 (37.11%), Postives = 171/291 (58.76%), Query Frame = 3
Query:  150 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEH--FTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIF 1016
            ++LG+GGFA+ Y      + +  A+KII    +       ++ +E+ELH  L H  I++ Y  FED   +Y++LE C    L   ++    L+E + R YL+QIV GLKYLH  +ILHRDL L N  + + M++KI DFGLA +LE  VE+   T+CGTPNY+SPEV+++   G E+DVW++GC++YTML+G+ PF+T  ++ T   ++  R+ +PS +S  ++ LI+ +L  +P+ RL L  +  H F       D             S +  H++ DL+H+   ++ F
Sbjct:   57 KVLGKGGFAKCYEFTDLSSGKVYAVKIIPHTRVSKPHQREKIDREIELHRTLHHKHIVQFYHHFEDKENIYILLEYCSRRSLAHILKARKVLTEPEVRYYLRQIVTGLKYLHEQEILHRDLKLGNFFINEGMELKIGDFGLAAKLEP-VENRRRTICGTPNYLSPEVLNKQGHGCESDVWALGCVMYTMLLGRPPFETTNLKETYRCIREARYSMPSTLSPQAKHLISNMLAKSPEDRLRLDDVLRHDFFSQGFTPDRL-----------SSSCCHTAPDLQHTSPAKSFF 335          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Cavefish
Match: plk3 (polo like kinase 3 [Source:NCBI gene;Acc:103024965])

HSP 1 Score: 211.846 bits (538), Expect = 1.166e-57
Identity = 98/257 (38.13%), Postives = 159/257 (61.87%), Query Frame = 3
Query:  150 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHF--TMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSD 914
            ++LG+GGFAR Y      + +  A+K+I +  +       ++  E+ELH  L+H  +++    FED + +Y+ LE+C    L    +    L++ + R YL+QI+ GLKYLH+  ILHRDL L N  + ++M++++ DFGLA +LE  VE    T+CGTPNY++PEV++R   G E+DVWS+GC++YT+L G  PF+T +++ T   ++  R+ LP ++S +++ LI+ +LQ NP  RL L Q+  H +       D
Sbjct:   69 KLLGKGGFARCYEMTDLASSRMYAVKVIPQSRVSKPHQREKITNEIELHKTLQHKHVVKFSHHFEDQDNIYIFLELCSRKSLAHIWKARHTLTDPEVRYYLRQIISGLKYLHNKGILHRDLKLGNFFVNENMELRLGDFGLAAKLET-VEQRKKTICGTPNYLAPEVLNRQGHGTESDVWSLGCVMYTLLCGNPPFETLDLKETYKCIKEVRYSLPPSLSPAAQKLISAVLQKNPSDRLTLDQILVHEYFSKGFTPD 324          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Cavefish
Match: aurka (aurora kinase C-like [Source:NCBI gene;Acc:103034578])

HSP 1 Score: 199.519 bits (506), Expect = 5.334e-56
Identity = 95/256 (37.11%), Postives = 157/256 (61.33%), Query Frame = 3
Query:  126 SIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM 893
            S+E+F++   LG+G F  VY A+ ++T   +A+K++ KK +   G+  ++R+EVE+ S L+HP+IL LY +F D+  VYL+LE    GEL+  ++  G   + ++  Y+ ++ D L Y HS  ++HRD+   NLLL  + ++KIADFG +    +     T+CGT +Y+ PE++       + D+WS+G + Y  LVG+ PF+TK    T  ++    F  P+++SE SR+LI GLL+ NP  RL +Q +  H ++
Sbjct:  104 SLENFDIGRALGKGKFGSVYLARERQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDSARVYLILEFAPKGELYGELQRCGMFDDQRSATYIMELADALHYCHSKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSS-RRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSEGSRNLINGLLKHNPMHRLPIQGVLTHYWV 358          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002824.1 (pep scaffold:Pmarinus_7.0:GL476598:1893846:1903215:-1 gene:ENSPMAG00000002574.1 transcript:ENSPMAT00000002824.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 282.722 bits (722), Expect = 6.142e-88
Identity = 144/289 (49.83%), Postives = 193/289 (66.78%), Query Frame = 3
Query:  132 EDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENG-PLSEDQ-ARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLE-AGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ---VNKVSDLFQDFSITDSGIGSMNKGHSSI 980
            +DF+V  +LG+G FA VYRA+S  T  EVAIK+IDK+ M   GM  RVR EVE+HS+LKHP+ILE+Y  FED NYVYLVLEMCHNGE+ R ++  G P +E+Q AR++L++I  GL YLH++ ++HRDLTLANLLL  DM  +IADFGLA +L   G    T+CGTPNY+SPEV SR   G  AD W++GC  Y MLVG+ PF    +  TL RV + RF LP  +S ++RDL+  LL+ +P KR  L  +  H F+        + L     +     GS++ G++++
Sbjct:   11 KDFQVMNLLGKGSFACVYRARSCHTGIEVAIKMIDKQAMRRAGMVDRVRAEVEIHSQLKHPAILEMYGCFEDDNYVYLVLEMCHNGEMSRYLKNQGRPFTEEQEARQFLREISSGLLYLHAHGVIHRDLTLANLLLASDMSTRIADFGLAARLPLPGESRLTVCGTPNYMSPEVASRGPHGTPADAWALGCAAYAMLVGRPPFQASAVPATLARVLA-RFELPPTLSPAARDLLRRLLRRDPGKRPGLPAVLEHPFLADGGGETTAGLMAGPPLRPGDEGSLDSGNATM 298          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010747.1 (pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1 gene:ENSPMAG00000009735.1 transcript:ENSPMAT00000010747.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 279.641 bits (714), Expect = 5.511e-82
Identity = 137/227 (60.35%), Postives = 164/227 (72.25%), Query Frame = 3
Query:  237 KKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENG-PLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVS 911
            +K M   GM    R EVE+H +LKHPS+LELYT FED NYVYLVLEMC+NGE+ R ++  G P SE+Q R ++KQ V G+ YLHS+ ILHRDLTL+NLLLT DM IKIADFGLA QL    E HFTMCGTPNYISPE+ +R   GLE+DVWS+GCMLYTMLVG+ PFDT  I  TLNRV  G +  P ++S+ +R LI  LLQ NP  RL L  + +H FM +   S
Sbjct:    1 QKAMKKAGMLNTFRNEVEIHCQLKHPSVLELYTCFEDQNYVYLVLEMCNNGEVGRYLKAKGTPFSEEQVRHFMKQTVHGMLYLHSHGILHRDLTLSNLLLTADMNIKIADFGLAAQLRLPEEKHFTMCGTPNYISPEIATRGAHGLESDVWSLGCMLYTMLVGRPPFDTDAIGTTLNRVVLGEYSEPMHLSKPARSLIHQLLQKNPVDRLGLACVLDHPFMALRGAS 227          

HSP 2 Score: 132.494 bits (332), Expect = 5.063e-32
Identity = 70/144 (48.61%), Postives = 93/144 (64.58%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILF 1820
            PLNS R+RPIRQ T+NAV+++L++  VC+EFLK      G   + ++ EV+ I S G  I +Y P     F  D D+P S     +V+ +   ++PE Y KKY+ A RFV LVRS+TPK+T+YT  AKC LMEN PQPDFE  F
Sbjct:  531 PLNSIRLRPIRQLTKNAVVSVLEDGEVCLEFLK------GRSGRERVREVLRISSDGQQIRLYQPNEGRGFPLD-DRPSSPP--EEVVIYSYHTLPEPYWKKYKYAARFVQLVRSKTPKVTLYTQHAKCTLMENSPQPDFEACF 665          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010749.1 (pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1 gene:ENSPMAG00000009735.1 transcript:ENSPMAT00000010749.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 279.256 bits (713), Expect = 7.375e-82
Identity = 137/227 (60.35%), Postives = 164/227 (72.25%), Query Frame = 3
Query:  237 KKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENG-PLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVS 911
            +K M   GM    R EVE+H +LKHPS+LELYT FED NYVYLVLEMC+NGE+ R ++  G P SE+Q R ++KQ V G+ YLHS+ ILHRDLTL+NLLLT DM IKIADFGLA QL    E HFTMCGTPNYISPE+ +R   GLE+DVWS+GCMLYTMLVG+ PFDT  I  TLNRV  G +  P ++S+ +R LI  LLQ NP  RL L  + +H FM +   S
Sbjct:    1 QKAMKKAGMLNTFRNEVEIHCQLKHPSVLELYTCFEDQNYVYLVLEMCNNGEVGRYLKAKGTPFSEEQVRHFMKQTVHGMLYLHSHGILHRDLTLSNLLLTADMNIKIADFGLAAQLRLPEEKHFTMCGTPNYISPEIATRGAHGLESDVWSLGCMLYTMLVGRPPFDTDAIGTTLNRVVLGEYSEPMHLSKPARSLIHQLLQKNPVDRLGLACVLDHPFMALRGAS 227          

HSP 2 Score: 132.109 bits (331), Expect = 7.263e-32
Identity = 70/144 (48.61%), Postives = 93/144 (64.58%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILF 1820
            PLNS R+RPIRQ T+NAV+++L++  VC+EFLK      G   + ++ EV+ I S G  I +Y P     F  D D+P S     +V+ +   ++PE Y KKY+ A RFV LVRS+TPK+T+YT  AKC LMEN PQPDFE  F
Sbjct:  531 PLNSIRLRPIRQLTKNAVVSVLEDGEVCLEFLK------GRSGRERVREVLRISSDGQQIRLYQPNEGRGFPLD-DRPSSPP--EEVVIYSYHTLPEPYWKKYKYAARFVQLVRSKTPKVTLYTQHAKCTLMENSPQPDFEACF 665          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Sea Lamprey
Match: plk3 (polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-6134])

HSP 1 Score: 229.565 bits (584), Expect = 6.637e-65
Identity = 103/255 (40.39%), Postives = 162/255 (63.53%), Query Frame = 3
Query:  153 ILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAG-VEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSD 914
            +LG+GGFAR Y    + T    A KII K+ +   G  A++ +E+ LH +L H  I++  + F+D N++Y++LE+C+   L   +R    L+E + + YL+Q++ GL+YLH   ++HRDL L N  +T  M++KI D GLAT LE   +   T+CGTPNY++PEV+++   G EAD+WS+GC ++TML G+ PF T ++  T   ++SGRF+ P ++S ++RDL+   L  +PD R +L  L +H F+    V D
Sbjct:   32 LLGKGGFARCYLVTEEYTGCHFAAKIITKQRVEKPGHRAKIEQEISLHRKLHHRHIVQFISSFKDENFIYIILELCNGQSLAHMLRSRKVLTETEVKYYLRQLISGLRYLHQCGVVHRDLKLGNFFVTDSMEVKIGDLGLATTLEPPEMRKRTVCGTPNYLAPEVLNKRGHGPEADIWSLGCAVFTMLAGRPPFSTSDLANTYACIRSGRFNFPPSLSHAARDLLTSALTPDPDLRASLLDLQSHPFLTQGFVPD 286          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Sea Lamprey
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 182.57 bits (462), Expect = 1.031e-51
Identity = 91/259 (35.14%), Postives = 155/259 (59.85%), Query Frame = 3
Query:  126 SIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVN 902
            S+++F++   LG+G F  VY A+ + T   +A+K++ K  +   G+  ++R+E+E+ S L+HP+IL LY +F D   VYL+LE    GEL++ +++ G   E+++  Y+  + D L Y HS  ++HRD+   NLLL    ++KIADFG +    +     T+CGT +Y+ PE++       + D+WS+G + Y  LVG+ PF+++    T  R+       PS++S+ ++DLIA LL+ NP  RL L  +  H +++ N
Sbjct:   11 SLDNFDIGRPLGKGKFGNVYLAREKSTKFILALKVLFKSQLEKSGVEHQLRREIEIQSHLRHPNILRLYGYFHDRTRVYLILEYAPRGELYKLLQKLGKFDEERSASYVADMADALIYCHSKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSS-RRATLCGTLDYLPPEMIEGRTHDEKVDLWSLGVLCYEFLVGRPPFESETHNETYRRISKVDLRFPSHLSDGAKDLIANLLKHNPHTRLQLASVLQHPWVKAN 268          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 188.348 bits (477), Expect = 2.794e-49
Identity = 101/278 (36.33%), Postives = 157/278 (56.47%), Query Frame = 3
Query:  120 ENSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTAR--------------VRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSR-SKQGLEADVWSVGCMLYTMLVGKAPFDTKE--IRGTLNRVQSGRFHLPSN--ISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ 896
            +N+I  +++ E LG G   +V  A++  T QE A+K+I K + +   ++                + +E+ +   L HP++L LY  +E    +YLVLE    GEL   + E GPL E +A ++ +QI+ G+ Y H+  I+HRDL   NLLL     IKIADFG+A     G    T CG+P+Y +PE+VS    QG  +DVWS G +L+ +L G+ PFD ++  IR  L +VQ G F +PS+  IS  ++DLI  +L  +P++R+  + +  H  +Q
Sbjct:   13 DNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 181.03 bits (458), Expect = 2.161e-48
Identity = 92/259 (35.52%), Postives = 151/259 (58.30%), Query Frame = 3
Query:  129 IEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVS-RSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVN 902
            I ++++ + LG G F +V  A    T Q+VA+KII+KK++    M  R+ +E+     L+HP I++LY   +  + + +V+E   N EL   I +   +SE +AR++ +QI+  ++Y H + I+HRDL   NLLL + + +KIADFGL+  +  G    T CG+PNY +PEV+S +   G E DVWS G +LY ML  + PFD + I      + +G + LP  +S  +  LI  +L  NP  R+++ ++    + +V+
Sbjct:   52 IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGN-ELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVD 309          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Yeast
Match: KCC4 (Protein kinase of the bud neck involved in the septin checkpoint; associates with septin proteins, negatively regulates Swe1p by phosphorylation, shows structural homology to bud neck kinases Gin4p and Hsl1p; KCC4 has a paralog, GIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000000529])

HSP 1 Score: 181.03 bits (458), Expect = 4.079e-47
Identity = 96/274 (35.04%), Postives = 162/274 (59.12%), Query Frame = 3
Query:  117 PENSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHG--------MTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLAT-QLEAGVEHFTMCGTPNYISPEVVSR-SKQGLEADVWSVGCMLYTMLVGKAPFDTK--EIRGTLNRVQSGRFHLPSN--ISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ 896
            P ++I  +++ E LG G   +V  A+ ++T    A+K+I K + +++G        +   + +E+ +   L HP++L LY  +E  N +YL+LE    GEL   + ++GPL E +A    +QI+ G+ Y H+  I+HRDL   NLLL     IKIADFG+A  Q +A +   T CG+P+Y +PE+VS    +G  +DVWS G +L+ +L G+ PFD +   +R  L +VQ G+F +P++  IS  ++DLI  +L  +P +R+ ++ + +H  ++
Sbjct:   14 PSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLE-TSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Yeast
Match: HSL1 (Nim1p-related protein kinase; septin-binding kinase that localizes to the bud neck septin ring and regulates the morphogenesis checkpoint; phosphorylates Hsl7p and cooperates with Elm1p to recruit Hsl7p to the mother-bud neck, as a prerequisite for the subsequent recruitment, phosphorylation, and degradation of Swe1p; autophosphorylation enhances interactions with Hsl7p [Source:SGD;Acc:S000001584])

HSP 1 Score: 181.8 bits (460), Expect = 4.633e-47
Identity = 109/325 (33.54%), Postives = 173/325 (53.23%), Query Frame = 3
Query:  123 NSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHH-----------------------GMTAR------------VRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLL-TKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVV-SRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDL 986
            +++  +++ + LG+G   RV  AK+ +T Q  AIKI+ KK    H                        + +R            + +E+ +   + H +++ L+  +E+ + +YLVLE    GEL   +   G L E +A  Y KQIV+G+ Y HS++I HRDL   NLLL  K+ +IKIADFG+A          T CG+P+Y SPE+V  R   G  +DVWS G +L+ +L G  PF+   I+  L +VQSG++ +PSN+S  +RDLI+ +L  +P+KR+  Q++  H  ++  K  DL  +  +      +M +G S+ DL
Sbjct:   76 DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSNLSSEARDLISKILVIDPEKRITTQEILKHPLIK--KYDDLPVNKVLRKMRKDNMARGKSNSDL 398          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 176.792 bits (447), Expect = 1.502e-46
Identity = 88/260 (33.85%), Postives = 147/260 (56.54%), Query Frame = 3
Query:  132 EDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEH-FTMCGTPNYISPEVVSRSKQG--LEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSN--ISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ 896
            +D+     LG GGFAR ++ K   + +  A K + K  +       ++  E+++H  + HP+I++    FED + VY++LE+C NG L   ++    L+E + R +  QI   +KY+HS  ++HRDL L N+    +  +KI DFGLA  L    E  +T+CGTPNYI+PEV+     G   E D+WS+G MLY +L+GK PF  +++     R++   F  P +  IS+  + LI  +L  +P +R +L ++ ++ + +
Sbjct:   80 KDYHRGHFLGEGGFARCFQIKDD-SGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFR 338          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Nematostella
Match: EDO34707 (Serine/threonine-protein kinase PLK4 [Source:UniProtKB/Swiss-Prot;Acc:A7SNN5])

HSP 1 Score: 321.242 bits (822), Expect = 1.213e-94
Identity = 160/316 (50.63%), Postives = 218/316 (68.99%), Query Frame = 3
Query:  108 SEYPENSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENG-PLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSIT-----------DSGIGSM---NKGHSSI--DLKHSLR 1001
            ++Y  +SIEDF+V ++LG+GGFA VYR +   T QEVAIK+IDKK M   GM  RV  EVE+H RLKHPSILELYT+FED NYVYLVLE+  NGE +R +R+ G  L E + R+ + Q+V G+ YLHS+ I+HRDL+L N+LL+ DM  KIADFGLAT+L    E H+TMCGTPNYISPE+ +R   GLE+DVWS+GCML+T+LVGK PFDT+ +R TLN+V    + +P+++S  +RDLI+ LL+ NP  RL L  + +H F+    ++  +   +             DSG G+M   + GH+    D +H+++
Sbjct:    3 TQYMGDSIEDFQVLDLLGKGGFACVYRGRCLATGQEVAIKMIDKKAMRTAGMVNRVCNEVEIHCRLKHPSILELYTYFEDDNYVYLVLELAENGEANRYLRKQGHTLKESEVRRIMLQVVKGVLYLHSHGIIHRDLSLGNILLSSDMDAKIADFGLATRLSLPDEKHYTMCGTPNYISPEIATRDPHGLESDVWSIGCMLFTLLVGKPPFDTEAVRSTLNKVVLAEYDIPNHVSIEARDLISKLLKKNPQDRLTLSGILDHPFITNQTLNTKYSSPTRQHLNPRAYENSLDSGTGTMATISTGHAPFQQDNRHAVK 318          

HSP 2 Score: 124.79 bits (312), Expect = 4.968e-29
Identity = 68/145 (46.90%), Postives = 90/145 (62.07%), Query Frame = 3
Query: 1386 EPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILF 1820
            EPLN++R+RPIRQKTRNAV++I D   VC+EFL+          Q  + EV+ I S+G  I VY P S        + P+   +GN    +L  S+P KY KKY+ A +FV LVR  TPK+T+Y+  AKC+LMEN P  DFE+ F
Sbjct:  571 EPLNAERLRPIRQKTRNAVVSITDEAEVCLEFLQQKGG------QSIVTEVIRIASNGMKISVYQP-SEAEKVLGSEPPLPPSAGNG--SYLFPSLPSKYWKKYKYAAKFVQLVRKLTPKVTLYSKHAKCVLMENYPHADFEVCF 706          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Nematostella
Match: EDO37827 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEP8])

HSP 1 Score: 228.024 bits (580), Expect = 3.857e-64
Identity = 106/252 (42.06%), Postives = 163/252 (64.68%), Query Frame = 3
Query:  150 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNG---ELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ 896
            + LG+GGFA+ Y      T++  A KII K M+       ++  E+E+H ++ H  I+  + +FED +Y+Y++LE+C      ELH+R R    L+E + R ++KQI+D   YLH   I+HRDL L NL L  DM++K+ DFGLAT+ E G    T+CGTPNYI+PEV+S+     E DVWSVGC+LYT+LVGK PF+T+ ++ T +R++   +++PS +S +++ LI  LL+ +P  R  +QQ+ +  F +
Sbjct:   27 KFLGKGGFAKCYELTDLDTNKIYAGKIISKSMLTKPHQKEKMAMEIEIHGKVMHKHIVGFHGYFEDRDYIYILLELCPRRSLMELHKRRRA---LTEPEVRYFMKQIIDACIYLHKSRIIHRDLKLGNLFLNDDMEVKVGDFGLATRAEEGERKKTLCGTPNYIAPEVLSKRGHSFEVDVWSVGCILYTLLVGKPPFETQSLKTTYDRIKRNEYYIPSKVSHTAQLLIIKLLRPDPTTRPTMQQVLDDDFFK 275          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Nematostella
Match: EDO35437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH0])

HSP 1 Score: 194.512 bits (493), Expect = 1.686e-55
Identity = 96/266 (36.09%), Postives = 157/266 (59.02%), Query Frame = 3
Query:  126 SIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQ 923
            ++ DF++ + LG+G F  VY A+ +K+   VA+K++ K  +    +  ++R+E+E+ S L+H +IL L+ +F D   VYL+LE    GEL++ +       E +A KY++Q+ D L Y HS  ++HRD+   NLLL     IKIADFG +    +     T+CGT +Y+ PE++   +   + D+WS+G + Y  LVGK PF+ +    T  R+       PS++S  +RDLI+ LLQ NP+ RL L+ + NH +++++    L Q
Sbjct:   44 NLSDFDIGKPLGKGKFGNVYLAREKKSKYIVALKVLFKSQLQKSNVEHQLRREIEIQSHLRHNNILRLFGYFYDDTRVYLILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCHSKKVIHRDIKPENLLLNYKGDIKIADFGWSVHAPSS-RRTTLCGTLDYLPPEMIEGKEHDEKVDLWSIGVLCYEFLVGKPPFEAEGHNETYRRISRVDLRFPSHVSPGARDLISKLLQHNPNNRLPLKAVLNHPWIRMHATPVLEQ 308          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Nematostella
Match: EDO33652 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRL3])

HSP 1 Score: 198.749 bits (504), Expect = 2.179e-54
Identity = 90/249 (36.14%), Postives = 151/249 (60.64%), Query Frame = 3
Query:  153 ILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTAR-VRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHF-TMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM 893
            +LG+GGFARVY      T++  A+K++ KK +       R +  E+ELH  L+H  ++  +  F+D    Y++LE+C    L + ++  G L+E + R +++Q ++   YLH   ++HRD+ + N  +  +M++++ DFGLA +L+       TMCGTPNYI+PEV+S+     E D W++GC++YTMLVG  PF+TK +R T  R+++  + +PS +S+S+  LI  +L  NP+ R  L  + +  F 
Sbjct:   22 LLGKGGFARVYEVTDMSTNKIYALKVVPKKRLSKSTKEYRKIEMEIELHRTLRHHYVVGFHGSFQDEMNFYILLELCSRKSLVQMLKTRGKLTEPEVRFFMQQAIEACSYLHEQRVIHRDIKVGNFFINSNMELRLGDFGLAVRLKPDEYKIRTMCGTPNYIAPEVLSKEGHSYEVDTWALGCVMYTMLVGHPPFETKSLRETYRRIRNNDYTIPSRVSDSAARLIQRMLHANPENRPKLSDIFSDDFF 270          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Nematostella
Match: EDO30768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZV3])

HSP 1 Score: 189.119 bits (479), Expect = 1.683e-50
Identity = 97/259 (37.45%), Postives = 148/259 (57.14%), Query Frame = 3
Query:  129 IEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSK-QGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVN 902
            I  + + + +G+G FA+V  AK   T +EVAIKIIDK  ++   +  ++ +EV +   L HP+I++LY   E    +YLV+E    GE+   +  +G + E +AR   +QIV  ++Y H   ++HRDL   NLLL  DM IKIADFG + +   G +  T CG+P Y +PE+    K  G E DVWS+G +LYT++ G  PFD + ++    RV  G++ +P  +S    +L+   L  NP KR  L+Q     +M +N
Sbjct:   35 IGRYRLIKTIGKGNFAKVKLAKHVPTGKEVAIKIIDKTQLNPSSL-QKLFREVRIMKFLDHPNIVKLYEVIETDKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHVIHRDLKAENLLLDADMNIKIADFGFSNEFTPGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVLNPQKRARLEQTMTDKWMNIN 292          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Medaka
Match: plk4 (polo like kinase 4 [Source:NCBI gene;Acc:101161450])

HSP 1 Score: 305.834 bits (782), Expect = 3.864e-89
Identity = 154/257 (59.92%), Postives = 195/257 (75.88%), Query Frame = 3
Query:  129 IEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRE-NGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVE-HFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM 893
            ++DF V  +LG+G FA VYRAKS KT  EVAIK IDKK M   GM  RV  EVE+H RLKHPS+LELY +FED+NYVYLVLEMCHNGE+ R ++E   P SED+AR ++ QIV G+ YLH++ ILHRDLTL+NLLLT +M IKIADFGLATQL+   E HFTMCGTPNYISPEV +RS  GLE+DVWS+GCM +  L+G+ PFDT  ++ TL++V  G + +P+++S  ++DLI  LLQ +P  R +L  + +H FM
Sbjct:    1 MQDFRVLTLLGKGSFACVYRAKSVKTGLEVAIKTIDKKAMQKAGMVQRVSNEVEIHCRLKHPSVLELYNYFEDSNYVYLVLEMCHNGEMSRYLKERKKPFSEDEARHFMHQIVKGMLYLHTHGILHRDLTLSNLLLTSNMNIKIADFGLATQLKLPHEKHFTMCGTPNYISPEVATRSAHGLESDVWSLGCMFFAFLMGRPPFDTDTVKHTLSKVVLGDYEMPTHVSVEAQDLIDQLLQKDPAHRPSLSAVLDHPFM 257          

HSP 2 Score: 145.206 bits (365), Expect = 4.364e-35
Identity = 117/395 (29.62%), Postives = 187/395 (47.34%), Query Frame = 3
Query: 1389 PLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEI-TIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRK----------LQLQIDSSI----EYFFHPNLVSLE--NLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELRN 2522
            PL + R++PIRQKT+NAV++ILD   VC+E +K  +       Q ++ EV+ I   G  + +Y P     F P  D P +      +  +  E +PEKY KKYQ A +FV LV+S+TPK+T+YT  AK MLMEN P  D E+ F +   T KT  + R   K               G +  +     L   S     +++ S +    CL +   + +     +    F+PITIGR+          LQ  + ++          P+++S +  +  TA ++    P +  +V S+              S F+P++GWA+QL  GE+ VQFNDG QL++    + I      ++ S + G++    + + + LP+ V  K+  L   +  L N
Sbjct:  546 PLCAARLKPIRQKTKNAVVSILDTGEVCMELVKCQNG------QERVKEVLRISCDGTMVTIYQPNGGKGF-PVLDCPPAAPEDILICSY--EDLPEKYWKKYQYASKFVQLVKSKTPKVTLYTKFAKVMLMENSPNADLEVCFYDGAKTHKTPELIRVVEK--------------SGKSYTVKGDVGLGGLSPESRLYVELSDEGHSMCLSLEAAITAEEQRSNKKVPFFPITIGRRPVTSDAPCLPLQQMLRNTASPPKSTQITPSMISYDGSDFTTASMSRKCSPVRQDLVQSSGK---------VLKSIFVPNVGWASQLTSGEVWVQFNDGSQLVVQAGVSCI------TYTSPD-GRIT--RYKENEKLPENVKEKLHCLSTILGLLAN 899          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Medaka
Match: plk3 (polo like kinase 3 [Source:NCBI gene;Acc:101155385])

HSP 1 Score: 223.016 bits (567), Expect = 1.631e-61
Identity = 101/251 (40.24%), Postives = 162/251 (64.54%), Query Frame = 3
Query:  150 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHF--TMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ 896
            ++LG+GGFAR Y      +++  A+K+I +  +       ++  E+ELH  L H  +++   +FED   +Y+ LE+C    L    +    L+E + R YL+QI+ GLKYLH+  ILHRDL L N  + ++M +++ DFGLA +LE  VE    T+CGTPNY++PEV++R   G E+DVWS+GC++YT++ G  PF+T +++ T   ++  R++LPS++S +++ LI+G+LQ NP  RL L Q+ NH F +
Sbjct:   68 KLLGKGGFARCYEMTDLSSNKMYAVKVIPQSRVSKPHQREKITNEIELHRTLAHKHVVKFSHYFEDQENIYIFLELCSRKSLAHIWKARHTLTEPEVRYYLRQIISGLKYLHNRGILHRDLKLGNFFINENMDLRLGDFGLAAKLET-VEQRKKTICGTPNYLAPEVLNRQGHGTESDVWSLGCVMYTLMCGSPPFETLDLKETYKCIKEVRYNLPSSLSPAAQKLISGILQKNPSDRLTLDQILNHEFFK 317          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Medaka
Match: plk2b (polo like kinase 2 [Source:NCBI gene;Acc:101166557])

HSP 1 Score: 216.853 bits (551), Expect = 8.325e-60
Identity = 100/249 (40.16%), Postives = 154/249 (61.85%), Query Frame = 3
Query:  150 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLE-AGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM 893
            ++LG+GGFA+ Y      T +  A KII    +       ++ +E+ELH  L H  ++  Y  FED   +Y++LE C    L   ++    L+E + R YL+QIV GLKYLH  +ILHRDL L N  +++ M++K+ DFGLA +LE  G    T+CGTPNY+SPEV+++   G E+D+W++GC++YTML+G+ PF+T  ++ T   ++  R+ LPS++S  ++ LI+ LL   P+ R NL  +  H F 
Sbjct:   55 KVLGKGGFAKCYEMTDLSTSKVYAAKIIPHARVSKPHQREKIDREIELHRALNHRHVVHFYHHFEDKENIYILLEYCSRKSLAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFVSESMELKVGDFGLAAKLEPVGNRRKTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYKCIREARYSLPSSLSPQAKQLISSLLAKIPEDRPNLDHILRHDFF 303          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Medaka
Match: plk2b (polo like kinase 2 [Source:NCBI gene;Acc:101166557])

HSP 1 Score: 218.009 bits (554), Expect = 1.156e-59
Identity = 100/249 (40.16%), Postives = 154/249 (61.85%), Query Frame = 3
Query:  150 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLE-AGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM 893
            ++LG+GGFA+ Y      T +  A KII    +       ++ +E+ELH  L H  ++  Y  FED   +Y++LE C    L   ++    L+E + R YL+QIV GLKYLH  +ILHRDL L N  +++ M++K+ DFGLA +LE  G    T+CGTPNY+SPEV+++   G E+D+W++GC++YTML+G+ PF+T  ++ T   ++  R+ LPS++S  ++ LI+ LL   P+ R NL  +  H F 
Sbjct:   55 KVLGKGGFAKCYEMTDLSTSKVYAAKIIPHARVSKPHQREKIDREIELHRALNHRHVVHFYHHFEDKENIYILLEYCSRKSLAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFVSESMELKVGDFGLAAKLEPVGNRRKTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYKCIREARYSLPSSLSPQAKQLISSLLAKIPEDRPNLDHILRHDFF 303          
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Medaka
Match: plk2b (polo like kinase 2 [Source:NCBI gene;Acc:101166557])

HSP 1 Score: 216.853 bits (551), Expect = 1.404e-59
Identity = 100/249 (40.16%), Postives = 154/249 (61.85%), Query Frame = 3
Query:  150 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLE-AGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFM 893
            ++LG+GGFA+ Y      T +  A KII    +       ++ +E+ELH  L H  ++  Y  FED   +Y++LE C    L   ++    L+E + R YL+QIV GLKYLH  +ILHRDL L N  +++ M++K+ DFGLA +LE  G    T+CGTPNY+SPEV+++   G E+D+W++GC++YTML+G+ PF+T  ++ T   ++  R+ LPS++S  ++ LI+ LL   P+ R NL  +  H F 
Sbjct:   55 KVLGKGGFAKCYEMTDLSTSKVYAAKIIPHARVSKPHQREKIDREIELHRALNHRHVVHFYHHFEDKENIYILLEYCSRKSLAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFVSESMELKVGDFGLAAKLEPVGNRRKTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYKCIREARYSLPSSLSPQAKQLISSLLAKIPEDRPNLDHILRHDFF 303          
BLAST of Serine/threonine-protein kinase PLK4 vs. Planmine SMEST
Match: SMESG000076532.1 (SMESG000076532.1)

HSP 1 Score: 1627.07 bits (4212), Expect = 0.000e+0
Identity = 814/814 (100.00%), Postives = 814/814 (100.00%), Query Frame = 3
Query:   99 MYYSEYPENSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVXXXXXXXXXXESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELRNKYSSQS 2540
            MYYSEYPENSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVNKNLSLNNNSESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRSSFITVQSSQSSTFIPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELRNKYSSQS
Sbjct:    1 MYYSEYPENSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVNKNLSLNNNSESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRSSFITVQSSQSSTFIPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELRNKYSSQS 814          
BLAST of Serine/threonine-protein kinase PLK4 vs. Planmine SMEST
Match: SMESG000076532.1 (SMESG000076532.1)

HSP 1 Score: 1605.11 bits (4155), Expect = 0.000e+0
Identity = 803/803 (100.00%), Postives = 803/803 (100.00%), Query Frame = 3
Query:  132 EDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVXXXXXXXXXXESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRXXXXXXXXXXXXXXXPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELRNKYSSQS 2540
            EDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVNKNLSLNNNSESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRSSFITVQSSQSSTFIPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELRNKYSSQS
Sbjct:   11 EDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSLRERNIFVNKNLSLNNNSESIQSKPFKIIESTSEIIDNYSMKENNCRNCKNTVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQSINKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLNILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCPFDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKLTVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLPQISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLPDSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPTAILNSLSMPSKSPVVASNSNRSSFITVQSSQSSTFIPDIGWATQLADGELKVQFNDGCQLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLPLFVKELRNKYSSQS 813          
BLAST of Serine/threonine-protein kinase PLK4 vs. Planmine SMEST
Match: SMESG000022441.1 (SMESG000022441.1)

HSP 1 Score: 201.06 bits (510), Expect = 9.431e-55
Identity = 110/306 (35.95%), Postives = 176/306 (57.52%), Query Frame = 3
Query:  150 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNG---ELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEA-GVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDL----------FQDFSITD---------------SGIGSMNKGHSSI 980
            ++LGRGGFA+ Y  +    ++  A KII K  + + G   ++++E+ +H  L + +I++ Y +FED   VY++LE+C      ELH+R ++   ++E + R + KQI    +Y+H   I+HRDL LAN+ L KDM +K+ DFGLAT+LE  G    TMCGTPNYI+PEV+ +     E D WS+GC++YT+L+GK PF+T+ +R T  +++   + +P N+ +S++++I  LL ++  KR ++ +L    F +    S L          F +  I +               SGIG    GHS I
Sbjct:   21 KLLGRGGFAKCYELRDS-NNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMLELCKCKSLLELHKRRKK---ITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEI 322          
BLAST of Serine/threonine-protein kinase PLK4 vs. Planmine SMEST
Match: SMESG000055720.1 (SMESG000055720.1)

HSP 1 Score: 194.897 bits (494), Expect = 8.451e-53
Identity = 97/280 (34.64%), Postives = 162/280 (57.86%), Query Frame = 3
Query:  120 ENSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVS-RSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDLF-----QDFSITD 941
            E  I ++ + E LG G F +V     + T  +VA+KI+++  +    +  ++R+E++     +HP I++LY        +++++E    GEL   I ++G L+E  ARK+ +QIV G+ Y H + ++HRDL   NLLL     +KIADFGL+  ++ G    T CG+PNY +PEV+S +   G E DVWS G +LY +L G  PFD + I     +++SG FH+P  +S + +DL+  +L  +P KR+ ++++  H +  ++  + LF     +D SI D
Sbjct:   17 EVRIGNYTIGETLGVGTFGKVKVGIHKSTGVQVAVKIVNRDKIKALDVAGKLRREIQNLWLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDHIVKSGKLNEKDARKFFQQIVSGVDYCHRHKVVHRDLKPENLLLDSQKNVKIADFGLSNIMQDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDEHIPNLFKKIKSGLFHMPDYLSSNVKDLLKKMLTVDPVKRVTVEEIRKHPWFIIDLPNYLFPQERDEDASIID 296          
BLAST of Serine/threonine-protein kinase PLK4 vs. Planmine SMEST
Match: SMESG000006604.1 (SMESG000006604.1)

HSP 1 Score: 186.808 bits (473), Expect = 9.804e-53
Identity = 93/269 (34.57%), Postives = 160/269 (59.48%), Query Frame = 3
Query:  117 PEN-SIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQ--VNKVSD 914
            P+N  I++F + + +G G F  VY  K ++ +  +AIK+I K  +  + +  ++++E+E+HS L HP+IL LY +F D   VYL++E+   GEL+  I++ G    ++A  Y+ Q+   LKY H   ++HRD+   N+L+    + K+ADFG +   + GV + TMCGT +Y++PE+V +     E D+W +G +LY ML    PF+    + T+ R++S  F +P  ++ ++ D+I  +L  NP  RL+L Q+  H ++     KV+D
Sbjct:    4 PQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRN-TMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTD 271          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLK47.032e-9757.19polo like kinase 4 [Source:HGNC Symbol;Acc:HGNC:11... [more]
PLK41.591e-9657.19polo like kinase 4 [Source:HGNC Symbol;Acc:HGNC:11... [more]
PLK43.565e-9657.19polo like kinase 4 [Source:HGNC Symbol;Acc:HGNC:11... [more]
PLK41.859e-8256.33polo like kinase 4 [Source:HGNC Symbol;Acc:HGNC:11... [more]
PLK41.002e-7550.00polo like kinase 4 [Source:HGNC Symbol;Acc:HGNC:11... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
air-22.177e-5636.19Aurora/IPL1-related protein kinase 2 [Source:UniP... [more]
plk-31.019e-5537.50Serine/threonine-protein kinase plk-3 [Source:Uni... [more]
plk-31.019e-5537.50Serine/threonine-protein kinase plk-3 [Source:Uni... [more]
plk-11.434e-5537.89Serine/threonine-protein kinase plk-1 [Source:Uni... [more]
aak-12.764e-5436.335'-AMP-activated protein kinase catalytic subunit ... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SAK1.744e-13135.73gene:FBgn0026371 transcript:FBtr0078387[more]
polo3.677e-6338.72gene:FBgn0003124 transcript:FBtr0074839[more]
polo3.677e-6338.72gene:FBgn0003124 transcript:FBtr0100318[more]
AMPKalpha1.897e-5033.69gene:FBgn0023169 transcript:FBtr0070216[more]
AMPKalpha1.897e-5033.69gene:FBgn0023169 transcript:FBtr0070217[more]
back to top
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plk49.307e-9157.34polo-like kinase 4 (Drosophila) [Source:NCBI gene;... [more]
plk2b1.722e-5840.56polo-like kinase 2b (Drosophila) [Source:ZFIN;Acc:... [more]
plk2b1.722e-5840.56polo-like kinase 2b (Drosophila) [Source:ZFIN;Acc:... [more]
plk2a1.885e-5736.90polo-like kinase 2a (Drosophila) [Source:ZFIN;Acc:... [more]
plk31.706e-5638.40polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtkn22.110e-9254.75rhotekin 2 [Source:Xenbase;Acc:XB-GENE-993318][more]
rtkn22.813e-9254.75rhotekin 2 [Source:Xenbase;Acc:XB-GENE-993318][more]
rtkn23.111e-9254.75rhotekin 2 [Source:Xenbase;Acc:XB-GENE-993318][more]
rtkn23.976e-9254.75rhotekin 2 [Source:Xenbase;Acc:XB-GENE-993318][more]
rtkn25.175e-9254.75rhotekin 2 [Source:Xenbase;Acc:XB-GENE-993318][more]
back to top
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plk41.260e-9553.85polo like kinase 4 [Source:MGI Symbol;Acc:MGI:1017... [more]
Plk41.260e-9553.85polo like kinase 4 [Source:MGI Symbol;Acc:MGI:1017... [more]
Plk42.044e-9553.85polo like kinase 4 [Source:MGI Symbol;Acc:MGI:1017... [more]
Plk42.044e-9553.85polo like kinase 4 [Source:MGI Symbol;Acc:MGI:1017... [more]
Plk42.117e-9553.85polo like kinase 4 [Source:MGI Symbol;Acc:MGI:1017... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4MXR8|PLK4_DROWI5.352e-13436.03Serine/threonine-protein kinase PLK4 OS=Drosophila... [more]
sp|B4KYX8|PLK4_DROMO2.104e-13335.37Serine/threonine-protein kinase PLK4 OS=Drosophila... [more]
sp|B4LDJ6|PLK4_DROVI1.201e-13134.02Serine/threonine-protein kinase PLK4 OS=Drosophila... [more]
sp|O97143|PLK4_DROME1.748e-13035.73Serine/threonine-protein kinase PLK4 OS=Drosophila... [more]
sp|Q2LYK3|PLK4_DROPS1.758e-13033.89Serine/threonine-protein kinase PLK4 OS=Drosophila... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RMG51.577e-18039.47Serine/threonine-protein kinase PLK4 OS=Fasciola h... [more]
A0A504YXI77.963e-18039.84Serine/threonine-protein kinase PLK4 OS=Fasciola g... [more]
W6U8971.398e-17139.22Serine/threonine-protein kinase PLK4 OS=Echinococc... [more]
A0A087VY936.942e-17139.07Serine:threonine protein kinase PLK4 OS=Echinococc... [more]
A0A068WV309.675e-17139.24Serine:threonine protein kinase PLK4 OS=Echinococc... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plk42.112e-8855.99polo like kinase 4 [Source:NCBI gene;Acc:103032271... [more]
plk2b1.046e-5941.37serine/threonine-protein kinase PLK2 [Source:NCBI ... [more]
plk2a3.224e-5937.11serine/threonine-protein kinase PLK2 [Source:NCBI ... [more]
plk31.166e-5738.13polo like kinase 3 [Source:NCBI gene;Acc:103024965... [more]
aurka5.334e-5637.11aurora kinase C-like [Source:NCBI gene;Acc:1030345... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002824.16.142e-8849.83pep scaffold:Pmarinus_7.0:GL476598:1893846:1903215... [more]
ENSPMAT00000010747.15.511e-8260.35pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1... [more]
ENSPMAT00000010749.17.375e-8260.35pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1... [more]
plk36.637e-6540.39polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:Z... [more]
aurka1.031e-5135.14aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GIN42.794e-4936.33Protein kinase involved in bud growth and assembly... [more]
SNF12.161e-4835.52AMP-activated S/T protein kinase; forms a complex ... [more]
KCC44.079e-4735.04Protein kinase of the bud neck involved in the sep... [more]
HSL14.633e-4733.54Nim1p-related protein kinase; septin-binding kinas... [more]
CDC51.502e-4633.85Polo-like kinase; controls targeting and activatio... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO347071.213e-9450.63Serine/threonine-protein kinase PLK4 [Source:UniP... [more]
EDO378273.857e-6442.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354371.686e-5536.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336522.179e-5436.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307681.683e-5037.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plk43.864e-8959.92polo like kinase 4 [Source:NCBI gene;Acc:101161450... [more]
plk31.631e-6140.24polo like kinase 3 [Source:NCBI gene;Acc:101155385... [more]
plk2b8.325e-6040.16polo like kinase 2 [Source:NCBI gene;Acc:101166557... [more]
plk2b1.156e-5940.16polo like kinase 2 [Source:NCBI gene;Acc:101166557... [more]
plk2b1.404e-5940.16polo like kinase 2 [Source:NCBI gene;Acc:101166557... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076532.10.000e+0100.00SMESG000076532.1[more]
SMESG000076532.10.000e+0100.00SMESG000076532.1[more]
SMESG000022441.19.431e-5535.95SMESG000022441.1[more]
SMESG000055720.18.451e-5334.64SMESG000055720.1[more]
SMESG000006604.19.804e-5334.57SMESG000006604.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006459 ID=SMED30006459|Name=Serine/threonine-protein kinase PLK4|organism=Schmidtea mediterranea sexual|type=transcript|length=2927bp
ATCGATGTTACTATAGAAACTGACAACAAAATGTGTTTAATTTGATAGCA
GAAAATTTAAATTTTTGCATTTCACATCAGGTTTAGAATAGTGACGATAT
GTATTATTCTGAATATCCTGAAAATTCAATCGAAGATTTTGAAGTGTATG
AGATTCTCGGCCGAGGAGGATTTGCAAGAGTATATCGGGCAAAATCTCAA
AAAACCGACCAAGAAGTTGCCATAAAAATAATTGACAAGAAAATGATGCA
CCATCACGGAATGACTGCACGGGTAAGAAAGGAAGTTGAATTGCATAGTC
GCTTAAAGCATCCTTCAATCCTAGAACTTTACACATTTTTTGAAGATGCA
AATTATGTTTATTTAGTATTAGAGATGTGTCACAATGGGGAATTACATAG
GAGAATTAGAGAAAATGGTCCATTGTCAGAAGATCAAGCTCGAAAATATC
TAAAACAAATTGTCGATGGACTGAAATATCTCCATTCATATGATATTCTC
CATCGTGATTTGACTCTCGCTAATTTATTGCTGACAAAGGATATGAAGAT
AAAGATCGCTGATTTCGGTTTGGCAACTCAATTGGAAGCGGGAGTCGAAC
ATTTCACCATGTGTGGCACACCGAATTATATCTCTCCAGAAGTTGTCAGT
CGATCGAAACAAGGTCTCGAAGCCGATGTTTGGAGCGTCGGCTGCATGCT
GTACACGATGCTTGTCGGTAAGGCGCCGTTCGACACCAAAGAAATTAGAG
GTACTCTCAATCGTGTCCAGTCCGGCCGTTTTCATTTACCATCCAATATC
AGTGAAAGTTCCAGAGATTTGATTGCTGGTTTATTGCAAACCAATCCGGA
TAAGCGACTGAATCTCCAGCAGTTGTCGAATCATAGTTTTATGCAAGTCA
ATAAAGTTTCGGATTTATTTCAGGATTTCTCTATAACAGACAGTGGCATA
GGATCAATGAACAAAGGTCATTCTAGTATTGATTTAAAACATTCCTTGCG
CGAGCGAAACATATTTGTCAATAAAAATCTGTCACTGAATAACAATTCAG
AATCAATTCAATCGAAACCATTTAAAATTATCGAAAGCACATCAGAAATA
ATCGATAATTATAGTATGAAAGAAAATAATTGTAGAAATTGTAAAAACAC
CGTTCAAAATCCATTGGTTCATAAATCATCTATTGATCATCACGGTTATC
ATTCACTCTTTTCCAATCCATCTCCAGACTCTTCACAGTTACACCGTAAT
AATAAAACGGAAAATATCAATAATCAATCGACGACTAATTTCCAAAGCAT
AAATAAATCGAATTCCGATAGTTCCATTCAGACATTCTCTTCGGTTTCTA
ACCAATGTGATAATAAAATCGAACAAATAAAGCCGGAACCGTTGAATTCC
AAAAGAATGAGACCGATTCGTCAGAAAACACGAAATGCTGTTCTTAATAT
TCTCGACAATTGCACTGTTTGTATTGAATTTCTGAAACCGGCTTCTGACT
TACCGGGATCCAAATATCAATGGAAAATAAATGAAGTGATGTGTATCGAT
TCATCGGGACATAGCATATTGGTCTATTATCCATTGAGCACTTGTCCATT
TGATCCAGACAGAGATAAACCGGTTTCGCTTGAATCAGGAAATAAAGTCA
TACACTTTCTTCTTGAATCGATTCCGGAAAAATACCTGAAAAAATATCAA
CTGGCAAAAAGATTTGTTGATTTGGTGCGAAGCAGAACTCCTAAATTGAC
TGTTTATACCGATCTGGCAAAATGTATGTTGATGGAAAATGATCCCCAGC
CAGACTTTGAAATATTATTCAATGAGGAAATTACAATTAAAACCGAATCA
GTAACTCGTAGTTTTAATAAAATTCATTTTAATGGTGAAAATCTTCCTCA
AATTTCTTTCAATGATGGAACAAATATTTTACTGGATGTACACTCAAATT
TGCACAAGAAATCAGTATCAATAAATAAATGGCTGGATTATTCTCTCAAG
TGCAAAGAGTATTGTCTGAAAATCATCCAACAACTCCATTCTTTGCCTGA
TTCTAAAGATCTCATTTCATCATTCTATCCAATCACAATCGGTCGCAAGC
TCCAACTGCAAATTGATTCGTCGATCGAATATTTTTTTCATCCAAATTTA
GTGTCACTCGAAAATTTACCAACAGCAATTTTGAATTCTCTCTCTATGCC
ATCGAAATCACCGGTTGTCGCCAGCAATTCCAACAGATCATCATTCATCA
CAGTACAATCATCCCAATCATCCACATTTATTCCTGATATTGGCTGGGCA
ACTCAATTAGCTGATGGGGAATTGAAGGTTCAATTTAACGATGGATGCCA
ACTGATTATCGTTTATGACTCCAATACGATTGAAATGATCAAATGGTTCT
CTTGGAATTCTGATAATTCCGGTCAAGTTGTCACGAAGGAATTCAGCAAA
ACTGATACGCTACCCGACGAAGTCCATTCTAAAATAGAGCTGTTGCCATT
ATTTGTCAAAGAGTTACGCAATAAATACTCCAGCCAATCATGAACCTGCA
TCATTTGCATCATTGGTGGAATTCAGCCCAAATCAACATATCTTTGCTTT
ATATTTTTTGCAATTTCAATTTTCACATCATTTCCTGATGAAATTTTAAT
CTTTCTTTAATAATAATAATTTATTTATTTTTATTTATCTAAATCATGTC
TTAAATCGATGGTGATGATAGTGGTGATAATAGTCATTGATTGTGTTTTG
ATTTGTATGTTTATTTTTTATATTATCATGAAAGCTTTTGTTTTGATTTG
CTACCTGCTGGTGCTACTGGATCATGTACAATTTATATTATTGTTCTCAG
ATTTCGTTGCAATCACTGTCGTCATCGTTATGTCCAACTATAAATATATA
TATCAATTGCTTTTCATTATATAAATA
back to top

protein sequence of SMED30006459-orf-1

>SMED30006459-orf-1 ID=SMED30006459-orf-1|Name=SMED30006459-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=815bp
MYYSEYPENSIEDFEVYEILGRGGFARVYRAKSQKTDQEVAIKIIDKKMM
HHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELH
RRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMK
IKIADFGLATQLEAGVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCM
LYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNP
DKRLNLQQLSNHSFMQVNKVSDLFQDFSITDSGIGSMNKGHSSIDLKHSL
RERNIFVNKNLSLNNNSESIQSKPFKIIESTSEIIDNYSMKENNCRNCKN
TVQNPLVHKSSIDHHGYHSLFSNPSPDSSQLHRNNKTENINNQSTTNFQS
INKSNSDSSIQTFSSVSNQCDNKIEQIKPEPLNSKRMRPIRQKTRNAVLN
ILDNCTVCIEFLKPASDLPGSKYQWKINEVMCIDSSGHSILVYYPLSTCP
FDPDRDKPVSLESGNKVIHFLLESIPEKYLKKYQLAKRFVDLVRSRTPKL
TVYTDLAKCMLMENDPQPDFEILFNEEITIKTESVTRSFNKIHFNGENLP
QISFNDGTNILLDVHSNLHKKSVSINKWLDYSLKCKEYCLKIIQQLHSLP
DSKDLISSFYPITIGRKLQLQIDSSIEYFFHPNLVSLENLPTAILNSLSM
PSKSPVVASNSNRSSFITVQSSQSSTFIPDIGWATQLADGELKVQFNDGC
QLIIVYDSNTIEMIKWFSWNSDNSGQVVTKEFSKTDTLPDEVHSKIELLP
LFVKELRNKYSSQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR033698POLO_box_Plk4_2
IPR033699POLO_box_Plk4_1
IPR036947POLO_box_dom_sf
IPR033700Plk4
IPR000959POLO_box_dom
IPR000719Prot_kinase_dom
IPR008266Tyr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007099centriole replication
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005814centriole
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR033698Plk4, second cryptic polo-box domainPFAMPF18409Plk4_PB2coord: 546..667
e-value: 3.9E-21
score: 75.8
IPR000959POLO box domainPFAMPF00659POLO_boxcoord: 732..799
e-value: 1.0E-5
score: 25.6
IPR000959POLO box domainPROSITEPS50078POLO_BOXcoord: 727..800
score: 11.9
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 14..265
e-value: 6.9E-74
score: 248.5
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 14..265
score: 51.947
NoneNo IPR availableGENE3DG3DSA:3.30.1120.120coord: 421..547
e-value: 1.7E-30
score: 107.6
NoneNo IPR availableGENE3DG3DSA:3.30.1120.130coord: 548..668
e-value: 6.0E-20
score: 73.7
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 5..358
e-value: 1.7E-94
score: 318.8
NoneNo IPR availablePANTHERPTHR24345SERINE/THREONINE-PROTEIN KINASE PLKcoord: 10..753
NoneNo IPR availableSUPERFAMILYSSF82615Polo-box domaincoord: 726..803
IPR033699Plk4, first cryptic polo-box domainPFAMPF18190Plk4_PB1coord: 430..544
e-value: 1.9E-25
score: 89.1
IPR036947POLO box domain superfamilyGENE3DG3DSA:3.30.1120.30coord: 723..813
e-value: 9.1E-17
score: 62.8
IPR033700Serine/threonine-protein kinase Plk4PANTHERPTHR24345:SF82SERINE/THREONINE-PROTEIN KINASE PLK4coord: 10..753
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 20..43
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 133..145
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 11..266