Claspin

Overview
NameClaspin
Smed IDSMED30006456
Length (bp)3052
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Claspin (SMED30006456) t-SNE clustered cells

Violin plots show distribution of expression levels for Claspin (SMED30006456) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Claspin (SMED30006456) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Claspin (SMED30006456) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006456

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30006456SMESG000049039.1 SmedASXL_015595SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30006456SMESG000049039.1 SmedASXL_015595SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006456SMESG000049039.1 SmedASXL_015595SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30006456SMESG000049039.1 dd_Smed_v4_7575_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006456SMESG000049039.1 dd_Smed_v4_7575_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30006456SMESG000049039.1 dd_Smed_v6_7575_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30006456SMESG000049039.1 dd_Smed_v6_4671_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30006456SMESG000049039.1 dd_Smed_v4_7575_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30006456SMESG000049039.1 dd_Smed_v4_4671_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006456SMESG000049039.1 SMED_04282_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30006456SMESG000049039.1 SMED_04282_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Claspin vs. Ensembl Human
Match: CLSPN (claspin [Source:HGNC Symbol;Acc:HGNC:19715])

HSP 1 Score: 76.6406 bits (187), Expect = 2.185e-13
Identity = 53/126 (42.06%), Postives = 75/126 (59.52%), Query Frame = 2
Query: 2183 FIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGD--DGFGRYQIDADGDEQDDNSDEA 2554
            +++DEAE+SGSD    + Y    DG ++D YEE D  D E LPS+  L+ QI+KIH +  +D D R +R  +E YL DGDLH  G G R R++ W  I+     D F R   D+D D+ ++  DE+
Sbjct: 1000 YLEDEAEVSGSDVGSEDEY----DGEEIDEYEE-DVID-EVLPSDEELQSQIKKIHMKTMLDDDKRQLRLYQERYLADGDLHSDGPG-RMRKFRWKNIDDASQMDLFHR---DSDDDQTEEQLDES 1115          
BLAST of Claspin vs. Ensembl Human
Match: CLSPN (claspin [Source:HGNC Symbol;Acc:HGNC:19715])

HSP 1 Score: 76.2554 bits (186), Expect = 2.454e-13
Identity = 53/126 (42.06%), Postives = 75/126 (59.52%), Query Frame = 2
Query: 2183 FIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGD--DGFGRYQIDADGDEQDDNSDEA 2554
            +++DEAE+SGSD    + Y    DG ++D YEE D  D E LPS+  L+ QI+KIH +  +D D R +R  +E YL DGDLH  G G R R++ W  I+     D F R   D+D D+ ++  DE+
Sbjct:  989 YLEDEAEVSGSDVGSEDEY----DGEEIDEYEE-DVID-EVLPSDEELQSQIKKIHMKTMLDDDKRQLRLYQERYLADGDLHSDGPG-RMRKFRWKNIDDASQMDLFHR---DSDDDQTEEQLDES 1104          
BLAST of Claspin vs. Ensembl Human
Match: CLSPN (claspin [Source:HGNC Symbol;Acc:HGNC:19715])

HSP 1 Score: 76.2554 bits (186), Expect = 2.471e-13
Identity = 53/126 (42.06%), Postives = 75/126 (59.52%), Query Frame = 2
Query: 2183 FIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGD--DGFGRYQIDADGDEQDDNSDEA 2554
            +++DEAE+SGSD    + Y    DG ++D YEE D  D E LPS+  L+ QI+KIH +  +D D R +R  +E YL DGDLH  G G R R++ W  I+     D F R   D+D D+ ++  DE+
Sbjct: 1053 YLEDEAEVSGSDVGSEDEY----DGEEIDEYEE-DVID-EVLPSDEELQSQIKKIHMKTMLDDDKRQLRLYQERYLADGDLHSDGPG-RMRKFRWKNIDDASQMDLFHR---DSDDDQTEEQLDES 1168          
BLAST of Claspin vs. Ensembl Human
Match: CLSPN (claspin [Source:HGNC Symbol;Acc:HGNC:19715])

HSP 1 Score: 76.2554 bits (186), Expect = 2.686e-13
Identity = 53/126 (42.06%), Postives = 75/126 (59.52%), Query Frame = 2
Query: 2183 FIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGD--DGFGRYQIDADGDEQDDNSDEA 2554
            +++DEAE+SGSD    + Y    DG ++D YEE D  D E LPS+  L+ QI+KIH +  +D D R +R  +E YL DGDLH  G G R R++ W  I+     D F R   D+D D+ ++  DE+
Sbjct: 1053 YLEDEAEVSGSDVGSEDEY----DGEEIDEYEE-DVID-EVLPSDEELQSQIKKIHMKTMLDDDKRQLRLYQERYLADGDLHSDGPG-RMRKFRWKNIDDASQMDLFHR---DSDDDQTEEQLDES 1168          
BLAST of Claspin vs. Ensembl Xenopus
Match: CLSPN (claspin [Source:NCBI gene;Acc:100124314])

HSP 1 Score: 61.2326 bits (147), Expect = 1.068e-8
Identity = 51/123 (41.46%), Postives = 73/123 (59.35%), Query Frame = 2
Query: 2180 DFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGD--DGFGR-YQI-DADGDEQD 2536
            DF++DEAELSGSD       G   D  + D  E E+EA  E LPS+  L+ Q+ KIH ++ +D+D R +R  +E YL DGDLH  G G R R++ W  ++     D F R  ++ DADG+ ++
Sbjct:  949 DFMEDEAELSGSD------VG-SGDEYEGDDDEYEEEAIDEDLPSDEELQDQVNKIHMKVTMDEDQRQLRLYQERYLADGDLHSDGPG-RTRKFRWKNLDDASQLDMFRRDSEVEDADGENEE 1063          
BLAST of Claspin vs. Ensembl Mouse
Match: Clspn (claspin [Source:MGI Symbol;Acc:MGI:2445153])

HSP 1 Score: 73.559 bits (179), Expect = 1.138e-12
Identity = 53/125 (42.40%), Postives = 74/125 (59.20%), Query Frame = 2
Query: 2183 FIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAIN--AGDDGFGRYQIDADGDEQDDNSDE 2551
            +++DEAE+SGSD    + Y    DG ++D YEE D  D E LPS+  L  QI+KIH +  +D D R +R  +E YL DGDLH  G G R R++ W  I+  +  D F R   D+D D+ ++  DE
Sbjct: 1030 YLEDEAEVSGSDVGSEDEY----DGEEIDEYEE-DVID-EVLPSDEELESQIKKIHMKTMLDDDKRRLRLYQERYLADGDLHSDGPG-RTRKFRWKHIDDTSQMDLFHR---DSDDDQVEEQLDE 1144          
BLAST of Claspin vs. UniProt/SwissProt
Match: sp|Q9HAW4|CLSPN_HUMAN (Claspin OS=Homo sapiens OX=9606 GN=CLSPN PE=1 SV=3)

HSP 1 Score: 76.2554 bits (186), Expect = 1.187e-12
Identity = 53/126 (42.06%), Postives = 75/126 (59.52%), Query Frame = 2
Query: 2183 FIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGD--DGFGRYQIDADGDEQDDNSDEA 2554
            +++DEAE+SGSD    + Y    DG ++D YEE D  D E LPS+  L+ QI+KIH +  +D D R +R  +E YL DGDLH  G G R R++ W  I+     D F R   D+D D+ ++  DE+
Sbjct: 1053 YLEDEAEVSGSDVGSEDEY----DGEEIDEYEE-DVID-EVLPSDEELQSQIKKIHMKTMLDDDKRQLRLYQERYLADGDLHSDGPG-RMRKFRWKNIDDASQMDLFHR---DSDDDQTEEQLDES 1168          
BLAST of Claspin vs. UniProt/SwissProt
Match: sp|Q80YR7|CLSPN_MOUSE (Claspin OS=Mus musculus OX=10090 GN=Clspn PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 7.963e-12
Identity = 53/125 (42.40%), Postives = 74/125 (59.20%), Query Frame = 2
Query: 2183 FIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAIN--AGDDGFGRYQIDADGDEQDDNSDE 2551
            +++DEAE+SGSD    + Y    DG ++D YEE D  D E LPS+  L  QI+KIH +  +D D R +R  +E YL DGDLH  G G R R++ W  I+  +  D F R   D+D D+ ++  DE
Sbjct: 1030 YLEDEAEVSGSDVGSEDEY----DGEEIDEYEE-DVID-EVLPSDEELESQIKKIHMKTMLDDDKRRLRLYQERYLADGDLHSDGPG-RTRKFRWKHIDDTSQMDLFHR---DSDDDQVEEQLDE 1144          
BLAST of Claspin vs. UniProt/SwissProt
Match: sp|Q9DF50|CLSPN_XENLA (Claspin OS=Xenopus laevis OX=8355 GN=clspn PE=1 SV=2)

HSP 1 Score: 63.1586 bits (152), Expect = 1.278e-8
Identity = 44/99 (44.44%), Postives = 61/99 (61.62%), Query Frame = 2
Query: 2180 DFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAI 2476
            DF++DEAELSGSD       G   D  + D  E E+EA  E LPS+  L+ Q+ KIH ++ +D+D R +R+ +E YL DGDLH  G G R R++ W  +
Sbjct:  999 DFMEDEAELSGSD------VG-SGDEYEGDDDEYEEEAIDEDLPSDEELQDQVNKIHMKVTMDEDQRQLRFYQERYLADGDLHSDGPG-RTRKFRWKHL 1089          
BLAST of Claspin vs. TrEMBL
Match: A0A4Z2DMN0 (Claspin isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_010808 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 7.028e-16
Identity = 56/136 (41.18%), Postives = 85/136 (62.50%), Query Frame = 2
Query: 2180 DFIDDEAELSGSDDDDNEHYGP------------DEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGDDGFGRYQIDADGDEQDDNSDE 2551
            DF+D+EAELSG D+++  ++              +E+ +DL     ED++D   +PS GRLRRQIE++H+RL+ D+D R++RYLKELY EDGDLH      R+RR+ W  +   +D     Q++AD  + + +SDE
Sbjct:  998 DFVDEEAELSG-DENEQAYFMDDEDELILDDNDVNEEFADLIT---EDDSD---IPSAGRLRRQIERVHHRLQTDQDLRELRYLKELYFEDGDLHTENGQVRQRRFRWRGLE--NDDISADQLNADNSDDNISSDE 1124          
BLAST of Claspin vs. TrEMBL
Match: A0A4Z2DMR5 (Claspin isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_010808 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 7.196e-16
Identity = 56/136 (41.18%), Postives = 85/136 (62.50%), Query Frame = 2
Query: 2180 DFIDDEAELSGSDDDDNEHYGP------------DEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGDDGFGRYQIDADGDEQDDNSDE 2551
            DF+D+EAELSG D+++  ++              +E+ +DL     ED++D   +PS GRLRRQIE++H+RL+ D+D R++RYLKELY EDGDLH      R+RR+ W  +   +D     Q++AD  + + +SDE
Sbjct: 1007 DFVDEEAELSG-DENEQAYFMDDEDELILDDNDVNEEFADLIT---EDDSD---IPSAGRLRRQIERVHHRLQTDQDLRELRYLKELYFEDGDLHTENGQVRQRRFRWRGLE--NDDISADQLNADNSDDNISSDE 1133          
BLAST of Claspin vs. TrEMBL
Match: A0A4Z2DMP9 (Claspin isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010808 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 7.432e-16
Identity = 56/136 (41.18%), Postives = 85/136 (62.50%), Query Frame = 2
Query: 2180 DFIDDEAELSGSDDDDNEHYGP------------DEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGDDGFGRYQIDADGDEQDDNSDE 2551
            DF+D+EAELSG D+++  ++              +E+ +DL     ED++D   +PS GRLRRQIE++H+RL+ D+D R++RYLKELY EDGDLH      R+RR+ W  +   +D     Q++AD  + + +SDE
Sbjct:  970 DFVDEEAELSG-DENEQAYFMDDEDELILDDNDVNEEFADLIT---EDDSD---IPSAGRLRRQIERVHHRLQTDQDLRELRYLKELYFEDGDLHTENGQVRQRRFRWRGLE--NDDISADQLNADNSDDNISSDE 1096          
BLAST of Claspin vs. TrEMBL
Match: Q5C803 (SJCHGC03480 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 1.377e-15
Identity = 56/137 (40.88%), Postives = 85/137 (62.04%), Query Frame = 2
Query: 2177 TDFIDDEAELSGSDDDDNEHY------------GPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGDDGFGRYQIDADGDEQDDNSDE 2551
             DF+D+EAELSG D+++  ++              +E+ +DL     ED++D   +PS GRLRRQIE++H+RL+ D+D R++RYLKELY EDGDLH      R+RR+ W  +   +D     Q++AD  + + +SDE
Sbjct:   68 NDFVDEEAELSG-DENERAYFMDDEDELILDDNDVNEEFADL---ITEDDSD---IPSAGRLRRQIERVHHRLQTDQDLRELRYLKELYFEDGDLHTENGQVRQRRFRWRGLE--NDDISADQLNADNSDDNISSDE 195          
BLAST of Claspin vs. TrEMBL
Match: A0A1S8X1J6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_03529 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.895e-15
Identity = 52/108 (48.15%), Postives = 73/108 (67.59%), Query Frame = 2
Query: 2183 FIDDEAELSGSDDDDNEHYGPD------EDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGD 2488
            F+D+EAELSG D+++  +Y  D      E GSD    E ED+A+   LPS GRLRRQ+E++H RL+ D+D R++R+LKELY EDGDL+      R+RR+ W  ++A D
Sbjct:  991 FLDEEAELSG-DENERAYYMDDEDDDDVEGGSD--EMEFEDDAN---LPSAGRLRRQVERVHQRLQADQDQRELRFLKELYFEDGDLYAETGQVRQRRFRWRGLDAQD 1092          
BLAST of Claspin vs. Ensembl Cavefish
Match: CLSPN (claspin [Source:NCBI gene;Acc:103043308])

HSP 1 Score: 58.9214 bits (141), Expect = 3.169e-8
Identity = 48/114 (42.11%), Postives = 61/114 (53.51%), Query Frame = 2
Query: 2165 RMVPTDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGDDG--FG 2500
            +M   +F+D EAELSGSD    +         D    E E+E   E+LPS+  L  Q+ KIH +  +D D R +R  +E YL DGDLH  G G R RR+ W  I   DDG  FG
Sbjct:  994 KMRMAEFVDSEAELSGSDLGSEDED-------DEGGDEYEEEELQEELPSDEELMDQVNKIHMKQIMDDDKRKLRLYQERYLADGDLHSEGPG-RERRFRWKNI---DDGIEFG 1096          
BLAST of Claspin vs. Ensembl Sea Lamprey
Match: CLSPN (claspin [Source:HGNC Symbol;Acc:HGNC:19715])

HSP 1 Score: 59.3066 bits (142), Expect = 4.155e-9
Identity = 40/98 (40.82%), Postives = 62/98 (63.27%), Query Frame = 2
Query: 2177 TDFIDDEAELSGSDDDDNEHYGPDEDGS-DLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEW 2467
            + F+++EAELSGS+       G DED S + +  E E+E   E+LPS+  L+ Q++++H +  +D+D R +R  +E+ L DGDLH  G G RRR + W
Sbjct:  781 SHFVEEEAELSGSE------AGSDEDFSGNEEDNEYEEEDIQEELPSDDELQDQVKRLHMKALLDEDKRQLRLYQEVLLPDGDLHSDGPG-RRRTFRW 871          
BLAST of Claspin vs. Ensembl Sea Lamprey
Match: CLSPN (claspin [Source:HGNC Symbol;Acc:HGNC:19715])

HSP 1 Score: 59.3066 bits (142), Expect = 4.191e-9
Identity = 40/96 (41.67%), Postives = 61/96 (63.54%), Query Frame = 2
Query: 2183 FIDDEAELSGSDDDDNEHYGPDEDGS-DLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEW 2467
            F+++EAELSGS+       G DED S + +  E E+E   E+LPS+  L+ Q++++H +  +D+D R +R  +E+ L DGDLH  G G RRR + W
Sbjct:  818 FVEEEAELSGSE------AGSDEDFSGNEEDNEYEEEDIQEELPSDDELQDQVKRLHMKALLDEDKRQLRLYQEVLLPDGDLHSDGPG-RRRTFRW 906          
BLAST of Claspin vs. Ensembl Medaka
Match: CLSPN (claspin [Source:NCBI gene;Acc:101169623])

HSP 1 Score: 60.077 bits (144), Expect = 1.417e-8
Identity = 48/120 (40.00%), Postives = 65/120 (54.17%), Query Frame = 2
Query: 2138 LRKQVVAVARMVPTDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGDDGF 2497
            LR +     +M   D+++ EAELSGSD          ED  D    E E+E   E+LPS+  L+ Q+ KIH +  +D D R +R  +E YL DGDLH  G G R RR+ W  +   D+GF
Sbjct:  978 LRVKRRKKKKMTLMDYVESEAELSGSDVGS-------EDEDDERGSEYEEEESLEELPSDEELQDQVNKIHMKQVLDDDKRRLRLYQERYLADGDLHSDGPG-RARRFRWKNM---DEGF 1086          
BLAST of Claspin vs. Planmine SMEST
Match: SMESG000049039.1 (SMESG000049039.1)

HSP 1 Score: 1469.52 bits (3803), Expect = 0.000e+0
Identity = 870/955 (91.10%), Postives = 874/955 (91.52%), Query Frame = 2
Query:  203 MYVNNQENISPTIDKNAEHDIYIADDLHEXXXXXXXXXXXXXXXIQLESDTQRIIRENASVEFSYKPQKFKTIKELKEMLARNRENAN--KKPIGTGLAGTKETEERKGQTEPAAPIGGRINVCQNNETARGDMLTKAKLLEKVDTVLRERYQRHKGNRAQLIELKSREQYVEDNRNAEAFMQKLRRNFLLNPERNGSVDFVIKEQRDKQLVEHHIVVKDTAKCVQLAGEIDPMLSKGVIQMLSEHEQQKLLTMSERDKWKKHRSLLLAAEAEKRKTAVDARRKEMGLLEGKLDQPGVAVATAGNADGLSDDDYEWXXXXXXXXXXXXXXXTXXXXXXXXXXXXXXEQDDFGK-LRRTTRAIIDSEDEASPDVTIAYDSNCDSSNLLGNLSNFIEIPSSEDLFAESQSFRTTASCSMDKSDILPAGFSLVVDQPGNRDWWNVHSVDTATVLMRMVSNEALVLDDTVVMERTAQQLDNTVVIDRTAQQLDDTVVMKRTAQQL------------------------------------------------------------------------------DDTVVMCNAYSSVLDKSSTKIAPNRKPEGTLDSSLEMRSEHRKMFNFPXXXXXXXXXXXXXXKCAALRSLKDLMGEDSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIDTETLXXXXXXXXXXXXXQLRKQVVAVARMVPTDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGDDGFGRYQIDADGDEQDDNSDEANNDQVDLDQSNADITAATGNDDEQEEGNEPLMERYGRHLHARKYVPRVQEQQQHNAWQPLTARATLGSNGGTHKGGPTDSGDFMRPVQQK 2824
            MYVNNQENISPTIDKNAEHDIYIADDLHENKKLTKFKPLNKKDKIQLESDTQRIIRENASVEFSYKPQKFKTIKELKEMLARNRENAN  +KPIGTGLAGTKETEERKGQTEPAAPIGGRINVCQNNETARGDMLTKAKLLEKVDTVLRERYQRHKGNRAQLIELKSREQYVEDNRNAEAFMQKLRRNFLLNPERNGSVDFVIKEQRDKQLVEHHIVVKDTAKCVQLAGEIDPMLSKGVIQMLSEHEQQKLLTMSERDKWKKHRSLLLAAEAEKRKTAVDARRKEMGLLEGKLDQPGVAVATAGNADGLSDDDYEWKASESSDSDSKSGSATDRGGDGSDCSLSDDEQDDFGK LRRTTRAIIDSEDEASPDVTIAYDSNCDSSNLLGNLSNFIEIPSSEDLFAESQSFRTTASCSMDKSDILPAGFSLVVDQPGNRDWWNVHSVDTATVLMRMVSNEALVLDDTVVMERTAQQLD+TVV++RTAQQLDDTVVMKRTAQQL                                                                              DDTVVMCNAYSSVLDKSSTKIAPNRKPEGTLDSSLEMRSEHRKMFNFPSSGSSISANEESLSKCAALRSLKDLMGEDSEDEKDIDDVQLDDDDDEEEDAAGGADGVDLDRDLDDEQLEQEHDRDDISIDTETLDSDDNRYDDDEEEQLRKQVVAVARMVPTDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGDDGFGRYQIDADGDEQDDNSDEANNDQVDLDQSNADITAATGNDDEQEEGNEPLMERYGRHLHARKYVPRVQEQQQHNAWQPLTARATLGSNGGTHKGGPTDSGDFMRPVQQK
Sbjct:    1 MYVNNQENISPTIDKNAEHDIYIADDLHENKKLTKFKPLNKKDKIQLESDTQRIIRENASVEFSYKPQKFKTIKELKEMLARNRENANNCRKPIGTGLAGTKETEERKGQTEPAAPIGGRINVCQNNETARGDMLTKAKLLEKVDTVLRERYQRHKGNRAQLIELKSREQYVEDNRNAEAFMQKLRRNFLLNPERNGSVDFVIKEQRDKQLVEHHIVVKDTAKCVQLAGEIDPMLSKGVIQMLSEHEQQKLLTMSERDKWKKHRSLLLAAEAEKRKTAVDARRKEMGLLEGKLDQPGVAVATAGNADGLSDDDYEWKASESSDSDSKSGSATDRGGDGSDCSLSDDEQDDFGKQLRRTTRAIIDSEDEASPDVTIAYDSNCDSSNLLGNLSNFIEIPSSEDLFAESQSFRTTASCSMDKSDILPAGFSLVVDQPGNRDWWNVHSVDTATVLMRMVSNEALVLDDTVVMERTAQQLDDTVVMERTAQQLDDTVVMKRTAQQLDNTVVMERTAQQLDDTVVMERTAQQLDNTVVIDRTAQQLDDTVVMERTAQQLDNTVVIDRTAQQLDDTVVMKRTAQQLDDTVVMCNAYSSVLDKSSTKIAPNRKPEGTLDSSLEMRSEHRKMFNFPSSGSSISANEESLSKCAALRSLKDLMGEDSEDEKDIDDVQLDDDDDEEEDAAGGADGVDLDRDLDDEQLEQEHDRDDISIDTETLDSDDNRYDDDEEEQLRKQVVAVARMVPTDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAINAGDDGFGRYQIDADGDEQDDNSDEANNDQVDLDQSNADITAATGNDDEQEEGNEPLMERYGRHLHARKYVPRVQEQQQHNAWQPLTARATLGSNGGTHKGGPTDSGDFMRPVQQK 955          

HSP 2 Score: 127.487 bits (319), Expect = 1.460e-29
Identity = 60/61 (98.36%), Postives = 61/61 (100.00%), Query Frame = 1
Query: 2869 QHGSLMNKISQLPPVNPNHQSTMSLKSRMQQHTFTVQSKQSATKRQPSNANEELGNDASKK 3051
            +HGSLMNKISQLPPVNPNHQSTMSLKSRMQQHTFTVQSKQSATKRQPSNANEELGNDASKK
Sbjct:  955 KHGSLMNKISQLPPVNPNHQSTMSLKSRMQQHTFTVQSKQSATKRQPSNANEELGNDASKK 1015          
The following BLAST results are available for this feature:
BLAST of Claspin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CLSPN2.185e-1342.06claspin [Source:HGNC Symbol;Acc:HGNC:19715][more]
CLSPN2.454e-1342.06claspin [Source:HGNC Symbol;Acc:HGNC:19715][more]
CLSPN2.471e-1342.06claspin [Source:HGNC Symbol;Acc:HGNC:19715][more]
CLSPN2.686e-1342.06claspin [Source:HGNC Symbol;Acc:HGNC:19715][more]
back to top
BLAST of Claspin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Claspin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Claspin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Claspin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CLSPN1.068e-841.46claspin [Source:NCBI gene;Acc:100124314][more]
back to top
BLAST of Claspin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Clspn1.138e-1242.40claspin [Source:MGI Symbol;Acc:MGI:2445153][more]
back to top
BLAST of Claspin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9HAW4|CLSPN_HUMAN1.187e-1242.06Claspin OS=Homo sapiens OX=9606 GN=CLSPN PE=1 SV=3[more]
sp|Q80YR7|CLSPN_MOUSE7.963e-1242.40Claspin OS=Mus musculus OX=10090 GN=Clspn PE=1 SV=... [more]
sp|Q9DF50|CLSPN_XENLA1.278e-844.44Claspin OS=Xenopus laevis OX=8355 GN=clspn PE=1 SV... [more]
back to top
BLAST of Claspin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DMN07.028e-1641.18Claspin isoform 3 OS=Schistosoma japonicum OX=6182... [more]
A0A4Z2DMR57.196e-1641.18Claspin isoform 1 OS=Schistosoma japonicum OX=6182... [more]
A0A4Z2DMP97.432e-1641.18Claspin isoform 2 OS=Schistosoma japonicum OX=6182... [more]
Q5C8031.377e-1540.88SJCHGC03480 protein (Fragment) OS=Schistosoma japo... [more]
A0A1S8X1J63.895e-1548.15Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Claspin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CLSPN3.169e-842.11claspin [Source:NCBI gene;Acc:103043308][more]
back to top
BLAST of Claspin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CLSPN4.155e-940.82claspin [Source:HGNC Symbol;Acc:HGNC:19715][more]
CLSPN4.191e-941.67claspin [Source:HGNC Symbol;Acc:HGNC:19715][more]
back to top
BLAST of Claspin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Claspin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Claspin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CLSPN1.417e-840.00claspin [Source:NCBI gene;Acc:101169623][more]
back to top
BLAST of Claspin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000049039.11.460e-2991.10SMESG000049039.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006456 ID=SMED30006456|Name=Claspin|organism=Schmidtea mediterranea sexual|type=transcript|length=3052bp
CTTCCGATCTTTTTAATTAAATTTATTTTACGAATTTTTTAAATTAGCTA
TGAATGAAGTAGAAATGAACTTGTTAGCAAAAGATTGTGAAGTAAACTTA
AACAACAATGATTCCATTGATGATCCATCACTAAGAGAACGTTTGAAAGG
AGATTTTTCATTTCTTGATGTTATCGATAGAAATGAAGACAGCAGAAATG
AAATGTATGTGAATAATCAAGAAAATATTAGTCCTACAATTGATAAAAAT
GCTGAACATGACATTTATATTGCGGATGATTTGCATGAGAATAAGAAACT
GACCAAATTTAAACCCTTGAATAAGAAGGATAAAATTCAATTGGAAAGTG
ACACACAAAGAATAATAAGGGAAAATGCCAGTGTTGAATTTAGTTATAAG
CCGCAGAAATTCAAAACTATCAAAGAACTGAAAGAGATGCTGGCAAGAAA
TCGTGAAAATGCCAATAAGAAGCCAATTGGAACTGGGCTAGCGGGTACTA
AGGAAACAGAGGAGCGAAAGGGACAGACAGAACCAGCTGCACCAATCGGC
GGCAGAATCAATGTCTGCCAGAACAATGAGACAGCGAGAGGTGACATGCT
GACCAAGGCAAAACTCCTGGAAAAGGTGGACACGGTACTGAGGGAGCGGT
ACCAGCGGCACAAGGGAAACCGGGCACAATTGATCGAATTGAAGAGCCGT
GAACAGTATGTGGAAGACAATCGCAACGCGGAGGCCTTCATGCAGAAGCT
GCGAAGAAATTTCCTGTTGAATCCGGAACGGAACGGGAGCGTTGACTTTG
TGATAAAGGAGCAACGGGACAAGCAACTAGTGGAGCATCACATCGTAGTC
AAGGACACCGCGAAATGCGTCCAATTAGCAGGCGAGATCGATCCGATGCT
ATCGAAAGGCGTGATTCAAATGCTGTCAGAGCATGAGCAACAGAAACTTT
TGACTATGTCGGAACGGGACAAATGGAAAAAGCATCGTAGCTTGCTATTG
GCTGCCGAGGCAGAGAAGCGCAAAACAGCTGTCGACGCGCGACGGAAGGA
AATGGGCCTATTGGAGGGGAAACTTGACCAGCCGGGCGTTGCTGTGGCGA
CGGCGGGGAATGCTGATGGGCTATCTGATGATGATTACGAATGGAAGGCC
TCCGAGTCCAGTGATTCTGACAGCAAATCGGGATCTGCAACTGACCGCGG
CGGAGATGGATCTGATTGCTCATTATCGGACGATGAGCAGGACGATTTCG
GCAAGCTCAGGAGGACCACGAGAGCTATCATTGACAGCGAGGACGAAGCA
AGCCCTGACGTGACAATTGCTTATGACAGCAATTGTGATTCTAGTAATCT
CCTTGGGAACTTATCCAACTTCATCGAAATTCCCTCCAGTGAAGATCTGT
TTGCTGAATCGCAATCATTCAGGACGACAGCGAGCTGCTCAATGGATAAG
TCGGATATTTTACCCGCTGGCTTTTCATTGGTCGTTGATCAACCTGGCAA
TCGAGACTGGTGGAATGTGCATTCTGTGGATACCGCGACGGTTCTCATGA
GGATGGTGTCTAATGAGGCTTTGGTATTAGATGACACTGTTGTCATGGAG
CGCACTGCTCAGCAACTGGATAATACTGTTGTTATAGACCGCACTGCTCA
GCAACTGGATGACACTGTTGTCATGAAGCGCACTGCTCAGCAACTGGATG
ATACTGTTGTCATGTGCAATGCGTATTCCTCCGTATTGGACAAGTCAAGC
ACAAAAATTGCACCCAATCGAAAGCCTGAAGGAACATTGGATAGTAGTTT
GGAAATGCGATCGGAACATCGAAAAATGTTCAATTTCCCATCATCAGGCA
GCTCAATCAGTGCCAATGAAGAATCCTTGTCCAAATGTGCAGCATTGAGA
TCTTTGAAGGATTTAATGGGGGAGGATTCTGAAGATGAGAAAGATATTGA
TGATGTGCAGCTCGATGATGATGATGATGAGGAGGAGGATGCAGCTGGTG
GTGCTGATGGGGTGGATCTAGACCGAGACCTTGATGATGAGCAACTGGAA
CAAGAGCACGATCGAGATGATATATCTATCGATACGGAAACCTTGGACAG
TGATGACAATCGATACGATGATGACGAGGAGGAGCAGTTGAGGAAGCAAG
TTGTAGCGGTTGCTAGAATGGTTCCGACGGATTTTATTGATGACGAGGCA
GAATTATCGGGATCAGATGATGATGATAACGAGCATTATGGGCCGGACGA
GGACGGGTCTGATCTGGATCGATATGAGGAGGAAGATGAAGCAGACTCAG
AGAAGTTGCCATCGGAGGGCCGCTTGCGTCGGCAAATTGAGAAAATTCAC
AACCGACTTGAGATCGACAAGGACGCTCGTGACATTCGGTACTTGAAGGA
GCTGTACCTGGAGGACGGTGACCTGCACATTGCTGGCGCTGGCCAGAGGA
GGCGCCGATACGAGTGGGCGGCCATCAACGCCGGTGATGACGGATTCGGT
CGGTACCAGATCGATGCTGATGGTGACGAGCAAGATGATAACTCCGATGA
GGCAAATAACGATCAGGTGGATTTGGACCAATCAAATGCCGACATCACTG
CTGCTACTGGTAACGATGATGAGCAGGAGGAGGGCAATGAGCCACTGATG
GAGCGGTACGGCAGGCATCTCCATGCCAGGAAATACGTCCCGAGGGTTCA
GGAACAACAACAACACAATGCATGGCAACCGCTCACTGCCCGTGCGACAT
TGGGTAGCAACGGCGGCACACACAAAGGAGGACCAACGGACAGTGGTGAT
TTCATGCGGCCGGTGCAGCAAAAGGTAGCTATTATCGATATTATTGGTAT
TCCTGATCAGCAGTGATGCAGCACGGGTCACTGATGAACAAGATCAGTCA
GCTGCCGCCAGTCAATCCCAATCATCAATCCACAATGTCACTCAAATCCA
GAATGCAGCAGCACACATTCACTGTCCAATCCAAGCAATCTGCAACCAAG
CGGCAACCTAGCAACGCGAATGAGGAGCTCGGAAATGACGCCAGCAAGAA
AC
back to top

protein sequence of SMED30006456-orf-1

>SMED30006456-orf-1 ID=SMED30006456-orf-1|Name=SMED30006456-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=939bp
MNEVEMNLLAKDCEVNLNNNDSIDDPSLRERLKGDFSFLDVIDRNEDSRN
EMYVNNQENISPTIDKNAEHDIYIADDLHENKKLTKFKPLNKKDKIQLES
DTQRIIRENASVEFSYKPQKFKTIKELKEMLARNRENANKKPIGTGLAGT
KETEERKGQTEPAAPIGGRINVCQNNETARGDMLTKAKLLEKVDTVLRER
YQRHKGNRAQLIELKSREQYVEDNRNAEAFMQKLRRNFLLNPERNGSVDF
VIKEQRDKQLVEHHIVVKDTAKCVQLAGEIDPMLSKGVIQMLSEHEQQKL
LTMSERDKWKKHRSLLLAAEAEKRKTAVDARRKEMGLLEGKLDQPGVAVA
TAGNADGLSDDDYEWKASESSDSDSKSGSATDRGGDGSDCSLSDDEQDDF
GKLRRTTRAIIDSEDEASPDVTIAYDSNCDSSNLLGNLSNFIEIPSSEDL
FAESQSFRTTASCSMDKSDILPAGFSLVVDQPGNRDWWNVHSVDTATVLM
RMVSNEALVLDDTVVMERTAQQLDNTVVIDRTAQQLDDTVVMKRTAQQLD
DTVVMCNAYSSVLDKSSTKIAPNRKPEGTLDSSLEMRSEHRKMFNFPSSG
SSISANEESLSKCAALRSLKDLMGEDSEDEKDIDDVQLDDDDDEEEDAAG
GADGVDLDRDLDDEQLEQEHDRDDISIDTETLDSDDNRYDDDEEEQLRKQ
VVAVARMVPTDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADS
EKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQR
RRRYEWAAINAGDDGFGRYQIDADGDEQDDNSDEANNDQVDLDQSNADIT
AATGNDDEQEEGNEPLMERYGRHLHARKYVPRVQEQQQHNAWQPLTARAT
LGSNGGTHKGGPTDSGDFMRPVQQKVAIIDIIGIPDQQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007095mitotic G2 DNA damage checkpoint
GO:0000076DNA replication checkpoint
GO:0000077DNA damage checkpoint
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
GO:0007049cell cycle
GO:0018105peptidyl-serine phosphorylation
GO:0031572G2 DNA damage checkpoint
GO:0032147activation of protein kinase activity
GO:0033314mitotic DNA replication checkpoint
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR024146Claspin
Vocabulary: molecular function
TermDefinition
GO:0000217DNA secondary structure binding
GO:0003677DNA binding
GO:0010997anaphase-promoting complex binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005694chromosome
GO:0005794Golgi apparatus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 217..237
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 364..398
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 709..759
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 372..386
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 622..697
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 825..846
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 137..162
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 627..669
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 716..750
IPR024146ClaspinPANTHERPTHR14396CLASPINcoord: 681..832