Forkhead box protein N3

Overview
NameForkhead box protein N3
Smed IDSMED30006455
Length (bp)2595
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Forkhead box protein N3 (SMED30006455) t-SNE clustered cells

Violin plots show distribution of expression levels for Forkhead box protein N3 (SMED30006455) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Forkhead box protein N3 (SMED30006455) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Forkhead box protein N3 (SMED30006455) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006455

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30006455SMESG000033244.1 SmedASXL_013163SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neuronSMED30006455SMESG000032627.1 SMESG000033244.1 dd_Smed_v4_4078_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006455SMESG000032627.1 SMESG000033244.1 dd_Smed_v4_4078_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006455SMESG000032627.1 SMESG000033244.1 dd_Smed_v4_4078_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006455SMESG000032627.1 SMESG000033244.1 dd_Smed_v4_4078_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Forkhead box protein N3 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 89.3521 bits (220), Expect = 3.118e-18
Identity = 43/114 (37.72%), Postives = 61/114 (53.51%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLL 862
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   ++++L
Sbjct:   77 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDVL 163          
BLAST of Forkhead box protein N3 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 89.7373 bits (221), Expect = 9.757e-18
Identity = 48/140 (34.29%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   ++++L +  +         R+ +R   PYS+
Sbjct:   77 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDVLPTRPKKR------ARSVERASTPYSI 183          
BLAST of Forkhead box protein N3 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 89.7373 bits (221), Expect = 9.757e-18
Identity = 48/140 (34.29%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   ++++L +  +         R+ +R   PYS+
Sbjct:   77 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDVLPTRPKKR------ARSVERASTPYSI 183          
BLAST of Forkhead box protein N3 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 89.7373 bits (221), Expect = 9.757e-18
Identity = 48/140 (34.29%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   ++++L +  +         R+ +R   PYS+
Sbjct:   77 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDVLPTRPKKR------ARSVERASTPYSI 183          
BLAST of Forkhead box protein N3 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 89.7373 bits (221), Expect = 9.757e-18
Identity = 48/140 (34.29%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   ++++L +  +         R+ +R   PYS+
Sbjct:   77 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDVLPTRPKKR------ARSVERASTPYSI 183          
BLAST of Forkhead box protein N3 vs. Ensembl Celegans
Match: fkh-6 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q10924])

HSP 1 Score: 73.1738 bits (178), Expect = 1.339e-13
Identity = 42/112 (37.50%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  524 KPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGP----SWKNSLRHNLSINKSFRRMPRDGQTTI----GNYEMNSGDDMSE---ETISQRDNKQGGPGRGAY 826
            KP  SY  LI MAI+   D+ MT+N IY++ E  +PYY+         W+NS+RHNLS+N  F +  RDGQ+      GNY     D+  +       +R  K+ G G+  Y
Sbjct:   21 KPPYSYVALIAMAIDASPDKRMTLNQIYKFIEAKFPYYRDADAKRKQGWQNSIRHNLSLNDCFVKKARDGQSCANDRKGNYWQMVADNAPQFDNGNFKRRRVKRLGIGKMGY 132          
BLAST of Forkhead box protein N3 vs. Ensembl Celegans
Match: fkh-2 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q95QA9])

HSP 1 Score: 72.0182 bits (175), Expect = 1.636e-13
Identity = 37/105 (35.24%), Postives = 55/105 (52.38%), Query Frame = 2
Query:  524 KPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVD 838
            KP  SY  LI MAI+   ++ +T+  IY++   NYP+Y+     W+NS+RHNLS+NK F ++PR+             DD               PG+G YW++D
Sbjct:   93 KPPFSYNALIMMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRN------------FDD---------------PGKGNYWMLD 170          
BLAST of Forkhead box protein N3 vs. Ensembl Celegans
Match: unc-130 (pep chromosome:WBcel235:II:11281986:11283953:1 gene:WBGene00006853.1 transcript:C47G2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-130)

HSP 1 Score: 66.6254 bits (161), Expect = 2.169e-11
Identity = 35/112 (31.25%), Postives = 54/112 (48.21%), Query Frame = 2
Query:  503 HQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVD 838
            H+ S  AKP  SY  LI M+I    ++ +T+++I ++    + YYK   P+W+NS+RHNLS+N  F ++ R                             G PG+G YW +D
Sbjct:  120 HRKSSHAKPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARG---------------------------PGNPGKGNYWALD 204          
BLAST of Forkhead box protein N3 vs. Ensembl Celegans
Match: fkh-10 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:O17593])

HSP 1 Score: 63.929 bits (154), Expect = 3.046e-11
Identity = 30/79 (37.97%), Postives = 43/79 (54.43%), Query Frame = 2
Query:  479 TDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPR 715
            T+C Q          KP  SY  LI MAI +   + M + ++Y+W    YPY++  G  W+NS+RHNLS+N  F +  R
Sbjct:   36 TECQQ---------PKPQHSYIGLIAMAILSSPQKKMVLAEVYEWIMNEYPYFRSRGAGWRNSIRHNLSLNDCFVKAGR 105          
BLAST of Forkhead box protein N3 vs. Ensembl Celegans
Match: fkh-10 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:O17593])

HSP 1 Score: 63.929 bits (154), Expect = 3.046e-11
Identity = 30/79 (37.97%), Postives = 43/79 (54.43%), Query Frame = 2
Query:  479 TDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPR 715
            T+C Q          KP  SY  LI MAI +   + M + ++Y+W    YPY++  G  W+NS+RHNLS+N  F +  R
Sbjct:   36 TECQQ---------PKPQHSYIGLIAMAILSSPQKKMVLAEVYEWIMNEYPYFRSRGAGWRNSIRHNLSLNDCFVKAGR 105          
BLAST of Forkhead box protein N3 vs. Ensembl Fly
Match: CHES-1-like (gene:FBgn0029504 transcript:FBtr0112946)

HSP 1 Score: 82.0333 bits (201), Expect = 1.746e-15
Identity = 40/119 (33.61%), Postives = 65/119 (54.62%), Query Frame = 2
Query:  524 KPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRA 880
            KP  S++ LIFMAIE   ++A+ V +IY W   ++PY+K     WKNS+RHNLS+NKSF ++ +               +M               G+G+ W V+ ++R+NL+ ++ R+
Sbjct:  700 KPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEK-------------APNM---------------GKGSLWRVEPQQRQNLIQALNRS 790          
BLAST of Forkhead box protein N3 vs. Ensembl Fly
Match: CHES-1-like (gene:FBgn0029504 transcript:FBtr0333203)

HSP 1 Score: 82.0333 bits (201), Expect = 1.746e-15
Identity = 40/119 (33.61%), Postives = 65/119 (54.62%), Query Frame = 2
Query:  524 KPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRA 880
            KP  S++ LIFMAIE   ++A+ V +IY W   ++PY+K     WKNS+RHNLS+NKSF ++ +               +M               G+G+ W V+ ++R+NL+ ++ R+
Sbjct:  700 KPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEK-------------APNM---------------GKGSLWRVEPQQRQNLIQALNRS 790          
BLAST of Forkhead box protein N3 vs. Ensembl Fly
Match: CHES-1-like (gene:FBgn0029504 transcript:FBtr0071079)

HSP 1 Score: 82.0333 bits (201), Expect = 1.746e-15
Identity = 40/119 (33.61%), Postives = 65/119 (54.62%), Query Frame = 2
Query:  524 KPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRA 880
            KP  S++ LIFMAIE   ++A+ V +IY W   ++PY+K     WKNS+RHNLS+NKSF ++ +               +M               G+G+ W V+ ++R+NL+ ++ R+
Sbjct:  700 KPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEK-------------APNM---------------GKGSLWRVEPQQRQNLIQALNRS 790          
BLAST of Forkhead box protein N3 vs. Ensembl Fly
Match: CHES-1-like (gene:FBgn0029504 transcript:FBtr0310287)

HSP 1 Score: 82.0333 bits (201), Expect = 1.791e-15
Identity = 40/119 (33.61%), Postives = 65/119 (54.62%), Query Frame = 2
Query:  524 KPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRA 880
            KP  S++ LIFMAIE   ++A+ V +IY W   ++PY+K     WKNS+RHNLS+NKSF ++ +               +M               G+G+ W V+ ++R+NL+ ++ R+
Sbjct:  700 KPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEK-------------APNM---------------GKGSLWRVEPQQRQNLIQALNRS 790          
BLAST of Forkhead box protein N3 vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300783)

HSP 1 Score: 77.411 bits (189), Expect = 3.487e-14
Identity = 45/150 (30.00%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  524 KPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYY-KHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSLIVNPPKTGPM 970
            KP  SY QLI  AI    D+ +T++ IY +   +YPYY K     W+NS+RHNLS+N+ F ++ R                            Q  PG+G++W +D      L+D  Y+  +      R+ Q   PPY +    P++ P+
Sbjct:  453 KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARS---------------------------QDEPGKGSFWRIDPDSGAKLIDHSYKKRR-----QRSSQGFRPPYGM----PRSAPV 566          
BLAST of Forkhead box protein N3 vs. Ensembl Zebrafish
Match: foxj3 (forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1])

HSP 1 Score: 93.2041 bits (230), Expect = 4.649e-19
Identity = 50/140 (35.71%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   +++ L +  +         R+G+R   PYSL
Sbjct:   61 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDTLPTRPKKR------PRSGERASTPYSL 167          
BLAST of Forkhead box protein N3 vs. Ensembl Zebrafish
Match: foxj3 (forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1])

HSP 1 Score: 92.8189 bits (229), Expect = 4.961e-19
Identity = 50/140 (35.71%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   +++ L +  +         R+G+R   PYSL
Sbjct:   61 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDTLPTRPKKR------PRSGERASTPYSL 167          
BLAST of Forkhead box protein N3 vs. Ensembl Zebrafish
Match: si:ch211-145o7.3 (si:ch211-145o7.3 [Source:ZFIN;Acc:ZDB-GENE-061207-6])

HSP 1 Score: 87.4261 bits (215), Expect = 3.937e-18
Identity = 44/127 (34.65%), Postives = 66/127 (51.97%), Query Frame = 2
Query:  503 HQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAH 883
            H  S  AKP  S++ LIFMAIE   ++++ V  IY+W   N+PYYK     W+NS+RHNLS++KSF+R+ RD   ++                          G+G+ W V  + R  LL+ + + H
Sbjct:  102 HLPSSPAKPPYSFSSLIFMAIEDSPEKSLPVKGIYEWIVENFPYYKEAPGGWRNSVRHNLSLSKSFQRIHRDKSQSV--------------------------GKGSLWRVCPEYRPALLEVLRKTH 202          
BLAST of Forkhead box protein N3 vs. Ensembl Zebrafish
Match: foxj1a (forkhead box J1a [Source:NCBI gene;Acc:767737])

HSP 1 Score: 86.2705 bits (212), Expect = 3.753e-17
Identity = 42/138 (30.43%), Postives = 71/138 (51.45%), Query Frame = 2
Query:  485 CNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPL 898
            C     ++++   KP  SY  LI MA++  K   +T++ IY+W   N+ Y++H  P+W+NS+RHNLS+NK F ++PR                       Q+D     PG+G +W +D +  + LL+  Y+  +  P+
Sbjct:  129 CPDEVDYKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPR-----------------------QKDE----PGKGGFWKIDPQYAERLLNGAYKKRRLPPV 239          
BLAST of Forkhead box protein N3 vs. Ensembl Zebrafish
Match: foxj1a (forkhead box J1a [Source:NCBI gene;Acc:767737])

HSP 1 Score: 86.2705 bits (212), Expect = 3.753e-17
Identity = 42/138 (30.43%), Postives = 71/138 (51.45%), Query Frame = 2
Query:  485 CNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPL 898
            C     ++++   KP  SY  LI MA++  K   +T++ IY+W   N+ Y++H  P+W+NS+RHNLS+NK F ++PR                       Q+D     PG+G +W +D +  + LL+  Y+  +  P+
Sbjct:  129 CPDEVDYKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPR-----------------------QKDE----PGKGGFWKIDPQYAERLLNGAYKKRRLPPV 239          
BLAST of Forkhead box protein N3 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 89.3521 bits (220), Expect = 9.875e-18
Identity = 49/140 (35.00%), Postives = 69/140 (49.29%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYYK  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   +++   +  R         R+ +R   PYS+
Sbjct:   79 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDAAQARPRK------RPRSEERASTPYSI 185          
BLAST of Forkhead box protein N3 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 89.3521 bits (220), Expect = 9.955e-18
Identity = 49/140 (35.00%), Postives = 69/140 (49.29%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYYK  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   +++   +  R         R+ +R   PYS+
Sbjct:   62 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDAAQARPRK------RPRSEERASTPYSI 168          
BLAST of Forkhead box protein N3 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 89.3521 bits (220), Expect = 1.057e-17
Identity = 49/140 (35.00%), Postives = 69/140 (49.29%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYYK  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   +++   +  R         R+ +R   PYS+
Sbjct:   62 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDAAQARPRK------RPRSEERASTPYSI 168          
BLAST of Forkhead box protein N3 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 88.9669 bits (219), Expect = 1.301e-17
Identity = 49/140 (35.00%), Postives = 69/140 (49.29%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYYK  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   +++   +  R         R+ +R   PYS+
Sbjct:   79 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDAAQARPRK------RPRSEERASTPYSI 185          
BLAST of Forkhead box protein N3 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 88.9669 bits (219), Expect = 1.432e-17
Identity = 49/140 (35.00%), Postives = 69/140 (49.29%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYYK  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   +++   +  R         R+ +R   PYS+
Sbjct:   79 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDAAQARPRK------RPRSEERASTPYSI 185          
BLAST of Forkhead box protein N3 vs. Ensembl Mouse
Match: Foxj2 (forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805])

HSP 1 Score: 84.3445 bits (207), Expect = 5.132e-18
Identity = 42/106 (39.62%), Postives = 58/106 (54.72%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVD 838
             KP  SY  LI  AI +   + MT+++IY+W   N+PYYK+ G  WKNS+RHNLS+NK FR++PR                        RD+    PG+G+YW +D
Sbjct:   65 GKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSLNKCFRKVPR-----------------------PRDD----PGKGSYWTID 143          
BLAST of Forkhead box protein N3 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 88.1965 bits (217), Expect = 1.954e-17
Identity = 48/140 (34.29%), Postives = 70/140 (50.00%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   +++ L +  +         R+ +R   PYS+
Sbjct:   77 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDTLPTRPKKRA------RSVERASTPYSI 183          
BLAST of Forkhead box protein N3 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 87.0409 bits (214), Expect = 3.824e-17
Identity = 43/114 (37.72%), Postives = 60/114 (52.63%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLL 862
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   +++ L
Sbjct:   77 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDTL 163          
BLAST of Forkhead box protein N3 vs. Ensembl Mouse
Match: Foxj2 (forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805])

HSP 1 Score: 84.3445 bits (207), Expect = 2.328e-16
Identity = 42/106 (39.62%), Postives = 58/106 (54.72%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVD 838
             KP  SY  LI  AI +   + MT+++IY+W   N+PYYK+ G  WKNS+RHNLS+NK FR++PR                        RD+    PG+G+YW +D
Sbjct:   65 GKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSLNKCFRKVPR-----------------------PRDD----PGKGSYWTID 143          
BLAST of Forkhead box protein N3 vs. Ensembl Mouse
Match: Foxj2 (forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805])

HSP 1 Score: 84.3445 bits (207), Expect = 2.328e-16
Identity = 42/106 (39.62%), Postives = 58/106 (54.72%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVD 838
             KP  SY  LI  AI +   + MT+++IY+W   N+PYYK+ G  WKNS+RHNLS+NK FR++PR                        RD+    PG+G+YW +D
Sbjct:   65 GKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSLNKCFRKVPR-----------------------PRDD----PGKGSYWTID 143          
BLAST of Forkhead box protein N3 vs. UniProt/SwissProt
Match: sp|Q9UPW0|FOXJ3_HUMAN (Forkhead box protein J3 OS=Homo sapiens OX=9606 GN=FOXJ3 PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 4.686e-17
Identity = 48/140 (34.29%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   ++++L +  +         R+ +R   PYS+
Sbjct:   77 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDVLPTRPKKR------ARSVERASTPYSI 183          
BLAST of Forkhead box protein N3 vs. UniProt/SwissProt
Match: sp|Q8BUR3|FOXJ3_MOUSE (Forkhead box protein J3 OS=Mus musculus OX=10090 GN=Foxj3 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.367e-16
Identity = 48/140 (34.29%), Postives = 70/140 (50.00%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   +++ L +  +         R+ +R   PYS+
Sbjct:   77 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDTLPTRPKKRA------RSVERASTPYSI 183          
BLAST of Forkhead box protein N3 vs. UniProt/SwissProt
Match: sp|F1QDF8|FXJ1A_DANRE (Forkhead box protein J1-A OS=Danio rerio OX=7955 GN=foxj1a PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.833e-16
Identity = 42/138 (30.43%), Postives = 71/138 (51.45%), Query Frame = 2
Query:  485 CNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPL 898
            C     ++++   KP  SY  LI MA++  K   +T++ IY+W   N+ Y++H  P+W+NS+RHNLS+NK F ++PR                       Q+D     PG+G +W +D +  + LL+  Y+  +  P+
Sbjct:  129 CPDEVDYKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPR-----------------------QKDE----PGKGGFWKIDPQYAERLLNGAYKKRRLPPV 239          
BLAST of Forkhead box protein N3 vs. UniProt/SwissProt
Match: sp|Q68EZ2|FOXJ2_XENLA (Forkhead box protein J2 OS=Xenopus laevis OX=8355 GN=foxj2 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.511e-15
Identity = 41/113 (36.28%), Postives = 62/113 (54.87%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNL 859
             KP  SY  LI  AI +   + MT+++IY+W   N+PYY+  G  WKNS+RHNLS+NK FR++PR                        RD+    PG+G+YW++D   ++++
Sbjct:   58 GKPPYSYANLIQYAINSAPAKRMTLSEIYRWICDNFPYYRSAGVGWKNSIRHNLSLNKCFRKVPRP-----------------------RDD----PGKGSYWMIDSCPKEDI 143          
BLAST of Forkhead box protein N3 vs. UniProt/SwissProt
Match: sp|Q28EM1|FOXJ2_XENTR (Forkhead box protein J2 OS=Xenopus tropicalis OX=8364 GN=foxj2 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.593e-15
Identity = 41/113 (36.28%), Postives = 63/113 (55.75%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNL 859
             KP  SY  LI  AI +   + MT+++IY+W   N+PYY++ G  WKNS+RHNLS+NK FR++PR                        RD+    PG+G+YW++D   ++++
Sbjct:   58 GKPPYSYANLIQYAINSAPAKRMTLSEIYRWICDNFPYYRNAGVGWKNSIRHNLSLNKCFRKVPRP-----------------------RDD----PGKGSYWMIDSCPKEDV 143          
BLAST of Forkhead box protein N3 vs. TrEMBL
Match: A0A0X3P2P9 (Forkhead box protein N3 (Fragment) OS=Schistocephalus solidus OX=70667 GN=FOXN3 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 7.702e-33
Identity = 63/121 (52.07%), Postives = 75/121 (61.98%), Query Frame = 2
Query:  515 GFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYR 877
            G  KP  SYT LIFMAIE+   + MTVN IY WCE N+P+YKH G  WKNSLRHNLSINKSF+R+PRDG+                           GPGRGAYW V+ +ER+NLL ++ R
Sbjct:  156 GLGKPCYSYTHLIFMAIESTPQKCMTVNQIYNWCEANFPFYKHAGAGWKNSLRHNLSINKSFKRLPRDGR---------------------------GPGRGAYWAVEPRERQNLLGAVKR 249          
BLAST of Forkhead box protein N3 vs. TrEMBL
Match: A0A5K3FSC2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.364e-32
Identity = 67/122 (54.92%), Postives = 84/122 (68.85%), Query Frame = 2
Query:  518 FAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTT-IGNYEMNSGDDMSEETI-SQRDNKQGGPGRGAYWVVDDKERKNLLDSIYR 877
             AKP  SYT LIFMAIE+   + MTVN IY WCE N+P+YKH G  WKNSLRHNLSINKSF+R+PRDG+ + + +   + G    E ++     N   GPGRGAYW V+ +ER NLLD++ R
Sbjct:  142 LAKPCYSYTHLIFMAIESTPAKCMTVNQIYNWCETNFPFYKHAGAGWKNSLRHNLSINKSFKRLPRDGRASNLESLVTSKGALFCESSVFFDETNSDEGPGRGAYWAVEPRERPNLLDAVKR 263          
BLAST of Forkhead box protein N3 vs. TrEMBL
Match: A0A183WQJ1 (Fork-head domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS14394 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.389e-32
Identity = 66/122 (54.10%), Postives = 80/122 (65.57%), Query Frame = 2
Query:  515 GFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRD-NKQGGPGRGAYWVVDDKERKNLLDSIYR 877
            G  KPN SYT LIFMAIE+   + MTVN IY WCE N+P+YKH G  WKNSLRHNLSINKSF+R+PRD +         S D +  +     D +   GPGRGA+W V+ +ER  LLD+I R
Sbjct:  136 GLDKPNYSYTHLIFMAIESTPQKCMTVNQIYNWCESNFPFYKHAGAGWKNSLRHNLSINKSFKRLPRDSRNEPNAIVKCSFDVLCSQRQEHEDLDDDEGPGRGAFWTVEPRERATLLDAIKR 257          
BLAST of Forkhead box protein N3 vs. TrEMBL
Match: A0A5J4P015 (Fork-head domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0013951 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.075e-31
Identity = 68/127 (53.54%), Postives = 86/127 (67.72%), Query Frame = 2
Query:  512 SGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMS-----EETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYR 877
            SG AKPN SYT LIFMAIE+   + MTVN IY WCE N+P+YKH G  WKNSLRHNLSINKSF+R+PRD +    +Y      ++S        + + D+ + GPGRGA+W V+ +ER  LLD+I R
Sbjct:  172 SGLAKPNYSYTHLIFMAIESTPQKCMTVNQIYNWCESNFPFYKHAGAGWKNSLRHNLSINKSFKRLPRDSRHE--DYAPLKCRNLSLLNSKAHDLEELDDDE-GPGRGAFWTVEPRERPTLLDAIKR 295          
BLAST of Forkhead box protein N3 vs. TrEMBL
Match: A0A0R3U7M8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2838 PE=4 SV=3)

HSP 1 Score: 142.895 bits (359), Expect = 4.944e-31
Identity = 67/135 (49.63%), Postives = 84/135 (62.22%), Query Frame = 2
Query:  518 FAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTT--------------IGNYEMNSGDDMSEETI-SQRDNKQGGPGRGAYWVVDDKERKNLLDSIYR 877
             AKP  SYT LIFMAIE+   + MTVN IY WCE N+P+YKH G  WKNSLRHNLSINKSF+R+PRDG+ +              + +   + G    E ++     N   GPGRGAYW V+ +ER NLLD++ R
Sbjct:  142 LAKPCYSYTHLIFMAIESTPAKCMTVNQIYNWCETNFPFYKHAGAGWKNSLRHNLSINKSFKRLPRDGRVSFFLYLLKLLFLASNLESLVTSKGALFCESSVFFDETNSDEGPGRGAYWAVEPRERPNLLDAVKR 276          
BLAST of Forkhead box protein N3 vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 92.4337 bits (228), Expect = 7.026e-19
Identity = 50/140 (35.71%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   +++ L +  +         R+G+R   PYSL
Sbjct:   61 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDTLPTRPKKR------PRSGERASTPYSL 167          
BLAST of Forkhead box protein N3 vs. Ensembl Cavefish
Match: si:ch211-145o7.3 (si:ch211-145o7.3 [Source:ZFIN;Acc:ZDB-GENE-061207-6])

HSP 1 Score: 85.8853 bits (211), Expect = 1.035e-17
Identity = 37/77 (48.05%), Postives = 51/77 (66.23%), Query Frame = 2
Query:  506 QASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIG 736
            Q    AKP  S++ LIFMAIE   D+ + V  IY+W   N+PYY+     W+NS+RHNLS++KSFRR+ RD   ++G
Sbjct:  109 QPPSPAKPPFSFSSLIFMAIEDSPDKRLPVKGIYEWIVNNFPYYRTAPSGWRNSVRHNLSLSKSFRRIHRDKSQSVG 185          
BLAST of Forkhead box protein N3 vs. Ensembl Cavefish
Match: ENSAMXT00000049290.1 (forkhead box J1 [Source:NCBI gene;Acc:103028087])

HSP 1 Score: 87.4261 bits (215), Expect = 1.472e-17
Identity = 43/138 (31.16%), Postives = 70/138 (50.72%), Query Frame = 2
Query:  485 CNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPL 898
            C     ++ +   KP  SY  LI MA++  K   +T++ IY+W   N+ Y++H  P+W+NS+RHNLS+NK F ++PR                       Q+D     PG+G +W +D +  + LL   Y+  +T P+
Sbjct:  134 CPDEVDYKTNPHIKPPYSYATLICMAMQASKKSKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPR-----------------------QKDE----PGKGGFWKIDPQYAERLLSGAYKKRRTPPV 244          
BLAST of Forkhead box protein N3 vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 87.4261 bits (215), Expect = 2.314e-17
Identity = 46/134 (34.33%), Postives = 68/134 (50.75%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRI 922
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D   +++ L +  +         R+G+R+
Sbjct:   71 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDTNPKEDTLPTRPKKR------PRSGERV 171          
BLAST of Forkhead box protein N3 vs. Ensembl Cavefish
Match: foxj2 (forkhead box protein J2 [Source:NCBI gene;Acc:103026648])

HSP 1 Score: 86.6557 bits (213), Expect = 4.242e-17
Identity = 41/106 (38.68%), Postives = 54/106 (50.94%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVD 838
             KP  SY  LI MAI +  +R +++NDIY W    +PYY   G  WKNS+RHNLS+NK FR++PR                            Q  PG+G+YW +D
Sbjct:   57 GKPPHSYATLIAMAIGSAPERKLSLNDIYTWISDMFPYYSRAGRGWKNSIRHNLSLNKCFRKVPR---------------------------PQSDPGKGSYWTMD 135          
BLAST of Forkhead box protein N3 vs. Ensembl Sea Lamprey
Match: foxj3 (forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1])

HSP 1 Score: 83.1889 bits (204), Expect = 7.178e-17
Identity = 43/106 (40.57%), Postives = 56/106 (52.83%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVD 838
             KP  SY  LI  AI +   + MT+++IYQW   N+PYYK  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D
Sbjct:   67 GKPPYSYANLITFAINSSARKRMTLSEIYQWICDNFPYYKEAGIGWKNSIRHNLSLNKCFIKVPR------------SRDD---------------PGKGSYWAID 145          
BLAST of Forkhead box protein N3 vs. Ensembl Sea Lamprey
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 79.7221 bits (195), Expect = 6.269e-16
Identity = 40/125 (32.00%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  503 HQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYR 877
            ++ +G AKP  SY  LI MA++  K   +T+  IY+W   N+ YY+H  P W+NS+RHNLS+NK F ++PR                       Q+D     PG+G +W ++ +    + + + R
Sbjct:  126 YRTNGAAKPPYSYATLICMAMQASKKSKVTLATIYKWITDNFCYYRHADPCWRNSIRHNLSLNKCFSKVPR-----------------------QKDE----PGKGGFWSINPQYADVVANGLLR 223          
BLAST of Forkhead box protein N3 vs. Ensembl Sea Lamprey
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 74.3294 bits (181), Expect = 1.272e-15
Identity = 41/113 (36.28%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  503 HQASG-FAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVD 838
            HQA     KP  SY  LI MAI++  D+ +T+N IYQ+    +P+Y+     W+NS+RHNLS+N+ F ++PRD                        D K   PG+G+YW +D
Sbjct:   69 HQAPKDLVKPPYSYIALITMAIQSAPDKKVTLNGIYQFIMDKFPFYRENKQGWQNSIRHNLSLNECFVKVPRD------------------------DKK---PGKGSYWSLD 154          
BLAST of Forkhead box protein N3 vs. Ensembl Sea Lamprey
Match: foxn3 (forkhead box N3 [Source:ZFIN;Acc:ZDB-GENE-060512-39])

HSP 1 Score: 73.9442 bits (180), Expect = 1.570e-15
Identity = 44/149 (29.53%), Postives = 68/149 (45.64%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSLIVNPPKTGP 967
            AKP  S++ LIF++IE    + + V  IY W   ++PY+      WKNS+RHNLS+NK F+++ +D   ++                          G+G+ W VD   R NL+ ++ +A                PYS I+N P   P
Sbjct:   62 AKPPYSFSCLIFLSIEASPYKRLPVKGIYDWILDHFPYFVGAPSGWKNSVRHNLSLNKCFKKVDKDRHQSL--------------------------GKGSLWCVDPDYRPNLIQTLKKAPYH-------------PYSHILNTPPASP 171          
BLAST of Forkhead box protein N3 vs. Ensembl Sea Lamprey
Match: foxi3b (forkhead box I3b [Source:ZFIN;Acc:ZDB-GENE-031126-4])

HSP 1 Score: 77.411 bits (189), Expect = 2.841e-15
Identity = 40/120 (33.33%), Postives = 61/120 (50.83%), Query Frame = 2
Query:  518 FAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYR 877
              +P  SY+ LI MAI+   ++ +T++ IYQ+   NYP+YK     W+NS+RHNLS+N  F+++PRD             DD               PG+G YW++D    K   +  +R
Sbjct:  117 LVRPPYSYSALIAMAIQHTPEKRLTLSQIYQYVAENYPFYKKSKAGWQNSIRHNLSLNDCFKKVPRDD------------DD---------------PGKGNYWILDPNCEKMFDNGNFR 209          
BLAST of Forkhead box protein N3 vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 67.781 bits (164), Expect = 4.628e-12
Identity = 30/78 (38.46%), Postives = 47/78 (60.26%), Query Frame = 2
Query:  482 DCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPR 715
            D   + SH  +   KP  SY  +I  AI +  +  +++ DIY++   NY YY+     W+NS+RHNLS+NK+F ++PR
Sbjct:  326 DFTSDLSHDENRNVKPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPR 403          
BLAST of Forkhead box protein N3 vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 67.0106 bits (162), Expect = 6.659e-12
Identity = 28/59 (47.46%), Postives = 40/59 (67.80%), Query Frame = 2
Query:  524 KPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSF 700
            KP  SY  LI +AI   ++  +T++ IY W  V++PYYK    SW+NS+RHNLS+N +F
Sbjct:  109 KPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAF 167          
BLAST of Forkhead box protein N3 vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 65.0846 bits (157), Expect = 2.478e-11
Identity = 32/116 (27.59%), Postives = 59/116 (50.86%), Query Frame = 2
Query:  518 FAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLD 865
            + KP  SY  +I  AI +  + ++++ DIY++   NY +Y+    +W+NS+RHNLS+NK+F ++P+                           + G  G+G  W + D+ R++ L+
Sbjct:  301 YIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPK---------------------------RAGQQGKGMNWKISDEVRRDFLN 389          
BLAST of Forkhead box protein N3 vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 60.077 bits (144), Expect = 1.356e-9
Identity = 25/68 (36.76%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  524 KPNLSYTQLIFMAIET-CKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQ 724
            KP +SY+ ++   I      + M++++IY      +PYYK+    W++S+RHNLS+NKSFR++ ++G+
Sbjct:  461 KPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKEGK 528          
BLAST of Forkhead box protein N3 vs. Ensembl Nematostella
Match: EDO49084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI36])

HSP 1 Score: 76.6406 bits (187), Expect = 4.579e-17
Identity = 41/118 (34.75%), Postives = 61/118 (51.69%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRD-GQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSI 871
            +KP  S++ LIFMAIE   ++ + V DIY W   ++PY++     WKNS+RHNLS+NK F+++ +D GQ                             G+G+ W VD   R NLL ++
Sbjct:    1 SKPPYSFSSLIFMAIEESPNKRLPVKDIYNWIMDHFPYFRDARLGWKNSVRHNLSLNKCFKKVDKDKGQNV---------------------------GKGSLWTVDPDFRPNLLQAL 91          
BLAST of Forkhead box protein N3 vs. Ensembl Nematostella
Match: EDO36306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIZ2])

HSP 1 Score: 76.2554 bits (186), Expect = 2.953e-16
Identity = 33/65 (50.77%), Postives = 46/65 (70.77%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPR 715
            +KP  SY  LI  AI +  ++ MT+++IYQW   ++PYYK  G  WKNS+RHNLS+NK F ++PR
Sbjct:   72 SKPPYSYANLITFAINSSPEKKMTLSEIYQWICDHFPYYKEAGNGWKNSIRHNLSLNKCFIKVPR 136          
BLAST of Forkhead box protein N3 vs. Ensembl Nematostella
Match: EDO45105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTX1])

HSP 1 Score: 73.559 bits (179), Expect = 6.933e-16
Identity = 38/107 (35.51%), Postives = 54/107 (50.47%), Query Frame = 2
Query:  518 FAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVD 838
             +KP  SY  LI MAI     R +T++DI ++ +  +PYY+   PSW+NS+RHNLS+N  F +MPR+                            G PG+G YW +D
Sbjct:    1 LSKPPYSYIALITMAILQSPQRKLTLSDICEFIKRRFPYYREKFPSWQNSIRHNLSLNDCFVKMPRE---------------------------PGNPGKGNYWTLD 80          
BLAST of Forkhead box protein N3 vs. Ensembl Nematostella
Match: EDO44876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUL7])

HSP 1 Score: 73.1738 bits (178), Expect = 7.866e-16
Identity = 36/118 (30.51%), Postives = 59/118 (50.00%), Query Frame = 2
Query:  524 KPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYR 877
            KP  SY  LI MA+   K   +T++ IY+W + N+ +Y+   P+W+NS+RHNLS+NK F ++PR                           K+  PG+G +W +D       +D +++
Sbjct:    1 KPPYSYATLICMAMRDTKRVKITLSAIYKWIKENFMFYRVADPTWQNSIRHNLSLNKCFVKVPR---------------------------KKDEPGKGGFWRIDPAYADMFVDGVFK 91          
BLAST of Forkhead box protein N3 vs. Ensembl Nematostella
Match: EDO36951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH30])

HSP 1 Score: 72.0182 bits (175), Expect = 2.082e-15
Identity = 38/119 (31.93%), Postives = 57/119 (47.90%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYR 877
             KP  SY QLI  AI +  D+ +T++ IY     NYPYY+     W+NS+RHNLS+N+ F ++PR                            Q  PG+G++W +D    + L +  +R
Sbjct:    3 GKPPYSYAQLIVQAILSATDKQLTLSGIYAHITKNYPYYRTADKGWQNSIRHNLSLNRYFVKVPR---------------------------AQDEPGKGSFWRIDPSCEQKLAEQAFR 94          
BLAST of Forkhead box protein N3 vs. Ensembl Medaka
Match: ENSORLT00000042706.1 (forkhead box protein J3 [Source:NCBI gene;Acc:101156973])

HSP 1 Score: 92.4337 bits (228), Expect = 5.464e-19
Identity = 51/140 (36.43%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI     + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D+  +++ L S  +         R+G+R   PYSL
Sbjct:   76 GKPPYSYASLITFAINGSPRKRMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDNNPKEDTLPSRPKKR------PRSGERASAPYSL 182          
BLAST of Forkhead box protein N3 vs. Ensembl Medaka
Match: ENSORLT00000005812.2 (forkhead box protein J3 [Source:NCBI gene;Acc:101156973])

HSP 1 Score: 92.4337 bits (228), Expect = 5.464e-19
Identity = 51/140 (36.43%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI     + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D+  +++ L S  +         R+G+R   PYSL
Sbjct:   76 GKPPYSYASLITFAINGSPRKRMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDNNPKEDTLPSRPKKR------PRSGERASAPYSL 182          
BLAST of Forkhead box protein N3 vs. Ensembl Medaka
Match: FOXJ3 (forkhead box protein J3 [Source:NCBI gene;Acc:101158100])

HSP 1 Score: 89.3521 bits (220), Expect = 5.248e-18
Identity = 49/140 (35.00%), Postives = 70/140 (50.00%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSL 940
             KP  SY  LI  AI +   + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++ R            S DD               PG+G+YW +D   +++ L +  +         R+G+R   PYSL
Sbjct:   61 GKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVAR------------SKDD---------------PGKGSYWAIDTNPKEDALPTRPKK------RPRSGERASTPYSL 167          
BLAST of Forkhead box protein N3 vs. Ensembl Medaka
Match: ENSORLT00000031716.1 (forkhead box protein J3 [Source:NCBI gene;Acc:101156973])

HSP 1 Score: 83.1889 bits (204), Expect = 8.547e-18
Identity = 44/116 (37.93%), Postives = 61/116 (52.59%), Query Frame = 2
Query:  521 AKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDS 868
             KP  SY  LI  AI     + MT+++IYQW   N+PYY+  G  WKNS+RHNLS+NK F ++PR            S DD               PG+G+YW +D+  +++ L S
Sbjct:   75 GKPPYSYASLITFAINGSPRKRMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPR------------SKDD---------------PGKGSYWAIDNNPKEDTLPS 163          
BLAST of Forkhead box protein N3 vs. Ensembl Medaka
Match: si:ch211-145o7.3 (forkhead box protein N2 [Source:NCBI gene;Acc:101170028])

HSP 1 Score: 83.1889 bits (204), Expect = 6.293e-17
Identity = 40/116 (34.48%), Postives = 60/116 (51.72%), Query Frame = 2
Query:  536 SYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAH 883
            S++ LIFMAIE    + + V DIY+W   N+PYY+     W+NS+RHNLS++KSFRR+ RD   ++                          G+G++W V  + R  LL  + + H
Sbjct:  105 SFSSLIFMAIEDSPHKKLPVKDIYEWIVKNFPYYRSASGGWRNSVRHNLSLSKSFRRIQRDRTQSV--------------------------GKGSFWCVCPEYRPALLKVLKKTH 194          
BLAST of Forkhead box protein N3 vs. Planmine SMEST
Match: SMESG000033244.1 (SMESG000033244.1)

HSP 1 Score: 1334.7 bits (3453), Expect = 0.000e+0
Identity = 751/768 (97.79%), Postives = 751/768 (97.79%), Query Frame = 2
Query:   17 MTTNSSFISTRVANYKLSSSYPSITPLYSKDLNYNGSLSFTSYTKSWSSYQNMALKATDNLRNQDLTNNSDLQPLNWLQKESXXXXXXXXXXXXXXXXSNTPGYDDLIDPHISHAKVEVESQENSNIHDFVRFQAMRNSMXXXXXXXXXXXXXFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSLIVNPPKTGPMLRIDGRFTDASTYLQSKRSDDEVANENYNIQSDYANAENLSMQKIENTEAAEYTSMMFNLATTSSPETGGGDTSVKLSASYNSNCSRMEGKWDAHSMPSNDIYSHLEADSDLCQPKLKNRRKSKHEKVRNYSEMESATKDLFPNRKNQKSDLIKTNNGMTSVNVIVAPHFDHIYARYQQFLPPAIASDMDKGVFGQEHDINPDADFLKNGYRXXXXXXXXXXXXXXXXXXXXXXSNLNSLEAIKQEKLETDTAMLPTKLNGSRRIKLCWNGKLNSAAVAFTXXXXXXXXXXXXXXXXXXXXXXXEPVEPNETAIKKEMIEPNEQTVIEDASDGYATDSTMPMSNRKSITRTNRIVANKTHPVRILPVKRKASLSKSGPPEKRYRSKRKRTRPLRIDESKEIAAIQFLASLEKRQQXXXXXXXXXXXXXXXXTTLSAGESSCNSSVVMVQE 2320
            MTTNSSFISTRVANYKLSSSYPSITPLYSKDLNYNGSLSFTSYTKSWSSYQNMALKATDNLRNQDLTNNSDLQPLNWLQKESIIDIDPLDIEDELKDDSNTPGYDDLIDPHISHAKVEVESQENSNIHDFVRFQAMRNSMNNSNRVALRNNNSFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSLIVNPPKTGPMLRIDGRFTDASTYLQSKRSDDEVANENYNIQSDYANAENLSMQKIENTEAAEYTSMMFNLATTSSPETGGGDTSVKLSASYNSNCSRME                 EADSDLCQPKLKNRRKSKHEKVRNYSEMESATKDLFPNRKNQKSDLIKTNNGMTSVNVIVAPHFDHIYARYQQFLPPAIASDMDKGVFGQEHDINPDADFLKNGYRDDDDEDNENEGEQGEIENEDEQSNLNSLEAIKQEKLETDTAMLPTKLNGSRRIKLCWNGKLNSAAVAFTRQRKVRRVLNRRARRSLRIRKPREPVEPNETAIKKEMIEPNEQTVIEDASDGYATDSTMPMSNRKSITRTNRIVANKTHPVRILPVKRKASLSKSGPPEKRYRSKRKRTRPLRIDESKEIAAIQFLASLEKRQQNIQNLENLYNFNNYLQTTLSAGESSCNSSVVMVQE
Sbjct:    1 MTTNSSFISTRVANYKLSSSYPSITPLYSKDLNYNGSLSFTSYTKSWSSYQNMALKATDNLRNQDLTNNSDLQPLNWLQKESIIDIDPLDIEDELKDDSNTPGYDDLIDPHISHAKVEVESQENSNIHDFVRFQAMRNSMNNSNRVALRNNNSFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSLIVNPPKTGPMLRIDGRFTDASTYLQSKRSDDEVANENYNIQSDYANAENLSMQKIENTEAAEYTSMMFNLATTSSPETGGGDTSVKLSASYNSNCSRME-----------------EADSDLCQPKLKNRRKSKHEKVRNYSEMESATKDLFPNRKNQKSDLIKTNNGMTSVNVIVAPHFDHIYARYQQFLPPAIASDMDKGVFGQEHDINPDADFLKNGYRDDDDEDNENEGEQGEIENEDEQSNLNSLEAIKQEKLETDTAMLPTKLNGSRRIKLCWNGKLNSAAVAFTRQRKVRRVLNRRARRSLRIRKPREPVEPNETAIKKEMIEPNEQTVIEDASDGYATDSTMPMSNRKSITRTNRIVANKTHPVRILPVKRKASLSKSGPPEKRYRSKRKRTRPLRIDESKEIAAIQFLASLEKRQQNIQNLENLYNFNNYLQTTLSAGESSCNSSVVMVQE 751          
BLAST of Forkhead box protein N3 vs. Planmine SMEST
Match: SMESG000033244.1 (SMESG000033244.1)

HSP 1 Score: 1264.98 bits (3272), Expect = 0.000e+0
Identity = 697/715 (97.48%), Postives = 698/715 (97.62%), Query Frame = 2
Query:   17 MTTNSSFISTRVANYKLSSSYPSITPLYSKDLNYNGSLSFTSYTKSWSSYQNMALKATDNLRNQDLTNNSDLQPLNWLQKESXXXXXXXXXXXXXXXXSNTPGYDDLIDPHISHAKVEVESQENSNIHDFVRFQAMRNSMXXXXXXXXXXXXXFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSLIVNPPKTGPMLRIDGRFTDASTYLQSKRSDDEVANENYNIQSDYANAENLSMQKIENTEAAEYTSMMFNLATTSSPETGGGDTSVKLSASYNSNCSRMEGKWDAHSMPSNDIYSHLEADSDLCQPKLKNRRKSKHEKVRNYSEMESATKDLFPNRKNQKSDLIKTNNGMTSVNVIVAPHFDHIYARYQQFLPPAIASDMDKGVFGQEHDINPDADFLKNGYRXXXXXXXXXXXXXXXXXXXXXXSNLNSLEAIKQEKLETDTAMLPTKLNGSRRIKLCWNGKLNSAAVAFTXXXXXXXXXXXXXXXXXXXXXXXEPVEPNETAIKKEMIEPNEQTVIEDASDGYATDSTMPMSNRKSITRTNRIVANKTHPVRILPVKRKASLSKSGPPEKRYRSKRKRTRPLRIDE 2161
            MTTNSSFISTRVANYKLSSSYPSITPLYSKDLNYNGSLSFTSYTKSWSSYQNMALKATDNLRNQDLTNNSDLQPLNWLQKESIIDIDPLDIEDELKDDSNTPGYDDLIDPHISHAKVEVESQENSNIHDFVRFQAMRNSMNNSNRVALRNNNSFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSLIVNPPKTGPMLRIDGRFTDASTYLQSKRSDDEVANENYNIQSDYANAENLSMQKIENTEAAEYTSMMFNLATTSSPETGGGDTSVKLSASYNSNCSRME                 EADSDLCQPKLKNRRKSKHEKVRNYSEMESATKDLFPNRKNQKSDLIKTNNGMTSVNVIVAPHFDHIYARYQQFLPPAIASDMDKGVFGQEHDINPDADFLKNGYRDDDDEDNENEGEQGEIENEDEQSNLNSLEAIKQEKLETDTAMLPTKLNGSRRIKLCWNGKLNSAAVAFTRQRKVRRVLNRRARRSLRIRKPREPVEPNETAIKKEMIEPNEQTVIEDASDGYATDSTMPMSNRKSITRTNRIVANKTHPVRILPVKRKASLSKSGPPEKRYRSKRKRTRPLRID+
Sbjct:    1 MTTNSSFISTRVANYKLSSSYPSITPLYSKDLNYNGSLSFTSYTKSWSSYQNMALKATDNLRNQDLTNNSDLQPLNWLQKESIIDIDPLDIEDELKDDSNTPGYDDLIDPHISHAKVEVESQENSNIHDFVRFQAMRNSMNNSNRVALRNNNSFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSLIVNPPKTGPMLRIDGRFTDASTYLQSKRSDDEVANENYNIQSDYANAENLSMQKIENTEAAEYTSMMFNLATTSSPETGGGDTSVKLSASYNSNCSRME-----------------EADSDLCQPKLKNRRKSKHEKVRNYSEMESATKDLFPNRKNQKSDLIKTNNGMTSVNVIVAPHFDHIYARYQQFLPPAIASDMDKGVFGQEHDINPDADFLKNGYRDDDDEDNENEGEQGEIENEDEQSNLNSLEAIKQEKLETDTAMLPTKLNGSRRIKLCWNGKLNSAAVAFTRQRKVRRVLNRRARRSLRIRKPREPVEPNETAIKKEMIEPNEQTVIEDASDGYATDSTMPMSNRKSITRTNRIVANKTHPVRILPVKRKASLSKSGPPEKRYRSKRKRTRPLRIDD 698          
BLAST of Forkhead box protein N3 vs. Planmine SMEST
Match: SMESG000033244.1 (SMESG000033244.1)

HSP 1 Score: 1199.88 bits (3103), Expect = 0.000e+0
Identity = 672/716 (93.85%), Postives = 674/716 (94.13%), Query Frame = 2
Query:   17 MTTNSSFISTRVANYKLSSSYPSITPLYSKDLNYNGSLSFTSYTKSWSSYQNMALKATDNLRNQDLTNNSDLQPLNWLQKESXXXXXXXXXXXXXXXXSNTPGYDDLIDPHISHAKVEVESQENSNIHDFVRFQAMRNSMXXXXXXXXXXXXXFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSLIVNPPKTGPMLRIDGRFTDASTYLQSKRSDDEVANENYNIQSDYANAENLSMQKIENTEAAEYTSMMFNLATTSSPETGGGDTSVKLSASYNSNCSRMEGKWDAHSMPSNDIYSHLEADSDLCQPKLKNRRKSKHEKVRNYSEMESATKDLFPNRKNQKSDLIKTNNGMTSVNVIVAPHFDHIYARYQQFLPPAIASDMDKGVFGQEHDINPDADFLKNGYRXXXXXXXXXXXXXXXXXXXXXXSNLNSLEAIKQEKLETDTAMLPTKLNGSRRIKLCWNGKLNSAAVAFTXXXXXXXXXXXXXXXXXXXXXXXEPVEPNETAIKKEMIEPNEQTVIEDASDGYATDSTMPMSNRKSITRTNRIVANKTHPVRILPVKRKASLSKSGPPEKRYRSKRKRTRPLRIDES 2164
            MTTNSSFISTRVANYKLSSSYPSITPLYSKDLNYNGSLSFTSYTKSWSSYQNMALKATDNLRNQDLTNNSDLQPLNWLQKESIIDIDPLDIEDELKDDSNTPGYDDLIDPHISHAKVEVESQENSNIHDFVRFQAMRNSMNNSNRVALRNNNSFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQ                         QGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSLIVNPPKTGPMLRIDGRFTDASTYLQSKRSDDEVANENYNIQSDYANAENLSMQKIENTEAAEYTSMMFNLATTSSPETGGGDTSVKLSASYNSNCSRME                 EADSDLCQPKLKNRRKSKHEKVRNYSEMESATKDLFPNRKNQKSDLIKTNNGMTSVNVIVAPHFDHIYARYQQFLPPAIASDMDKGVFGQEHDINPDADFLKNGYRDDDDEDNENEGEQGEIENEDEQSNLNSLEAIKQEKLETDTAMLPTKLNGSRRIKLCWNGKLNSAAVAFTRQRKVRRVLNRRARRSLRIRKPREPVEPNETAIKKEMIEPNEQTVIEDASDGYATDSTMPMSNRKSITRTNRIVANKTHPVRILPVKRKASLSKSGPPEKRYRSKRKRTRPLRID++
Sbjct:    1 MTTNSSFISTRVANYKLSSSYPSITPLYSKDLNYNGSLSFTSYTKSWSSYQNMALKATDNLRNQDLTNNSDLQPLNWLQKESIIDIDPLDIEDELKDDSNTPGYDDLIDPHISHAKVEVESQENSNIHDFVRFQAMRNSMNNSNRVALRNNNSFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQ-------------------------QGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQRIDPPYSLIVNPPKTGPMLRIDGRFTDASTYLQSKRSDDEVANENYNIQSDYANAENLSMQKIENTEAAEYTSMMFNLATTSSPETGGGDTSVKLSASYNSNCSRME-----------------EADSDLCQPKLKNRRKSKHEKVRNYSEMESATKDLFPNRKNQKSDLIKTNNGMTSVNVIVAPHFDHIYARYQQFLPPAIASDMDKGVFGQEHDINPDADFLKNGYRDDDDEDNENEGEQGEIENEDEQSNLNSLEAIKQEKLETDTAMLPTKLNGSRRIKLCWNGKLNSAAVAFTRQRKVRRVLNRRARRSLRIRKPREPVEPNETAIKKEMIEPNEQTVIEDASDGYATDSTMPMSNRKSITRTNRIVANKTHPVRILPVKRKASLSKSGPPEKRYRSKRKRTRPLRIDDT 674          
BLAST of Forkhead box protein N3 vs. Planmine SMEST
Match: SMESG000048193.1 (SMESG000048193.1)

HSP 1 Score: 140.584 bits (353), Expect = 5.940e-34
Identity = 113/322 (35.09%), Postives = 156/322 (48.45%), Query Frame = 2
Query:  227 DLQPLNWLQKESXXXXXXXXXXXXXXXXSNTPGYDDLIDPHISHAKVEVESQ--------ENSNIHDFVRFQAMRNSMX---------------XXXXXXXXXXXXFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRA--------------------------HQTIPLSDRNGQRIDPPYSLIVNPPKT---------GPMLRIDGRFTDASTYLQS 1018
            DLQPL WLQ+++I+ I PLD E+E       PG DD+I    S  KV+V S+        +NS I D+ R+QAMR +M                + +  +     + +    N  H  + + KP  SYT +IFMAIET  ++AMTVNDIY WCE ++PYY   G  WKNSLRHNLSINKSF+++ RDG+                            PGRGAYWVV+ +ER NL+D+I R+                           Q+    + N   +    S++ N   +         GP+LRI G+ TDAS  ++S
Sbjct:   64 DLQPLQWLQQDTILSITPLDNEEEY-----VPGKDDIISITTSPVKVDVISELKSEESLYQNSTIADYYRYQAMRAAMTNGHQNGGYRQQHGYLSYSNSSTGIRPNNSGSQHNLCHSVNEYQKPPFSYTHIIFMAIETSPNKAMTVNDIYVWCETHFPYYTQAGVGWKNSLRHNLSINKSFKKISRDGRGG--------------------------PGRGAYWVVEPRERNNLIDAIRRSPCSLGSFPFLNNTYPWGTGNCYSNNIFQSANTLNNNLASLTATRSVVNNKLNSSIDLQSSSRGPLLRIGGQLTDASNLIRS 354          
BLAST of Forkhead box protein N3 vs. Planmine SMEST
Match: SMESG000048193.1 (SMESG000048193.1)

HSP 1 Score: 140.198 bits (352), Expect = 8.363e-34
Identity = 113/322 (35.09%), Postives = 156/322 (48.45%), Query Frame = 2
Query:  227 DLQPLNWLQKESXXXXXXXXXXXXXXXXSNTPGYDDLIDPHISHAKVEVESQ--------ENSNIHDFVRFQAMRNSMX---------------XXXXXXXXXXXXFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWCEVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDMSEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRA--------------------------HQTIPLSDRNGQRIDPPYSLIVNPPKT---------GPMLRIDGRFTDASTYLQS 1018
            DLQPL WLQ+++I+ I PLD E+E       PG DD+I    S  KV+V S+        +NS I D+ R+QAMR +M                + +  +     + +    N  H  + + KP  SYT +IFMAIET  ++AMTVNDIY WCE ++PYY   G  WKNSLRHNLSINKSF+++ RDG+                            PGRGAYWVV+ +ER NL+D+I R+                           Q+    + N   +    S++ N   +         GP+LRI G+ TDAS  ++S
Sbjct:   64 DLQPLQWLQQDTILSITPLDNEEEY-----VPGKDDIISITTSPVKVDVISELKSEESLYQNSTIADYYRYQAMRAAMTNGHQNGGYRQQHGYLSYSNSSTGIRPNNSGSQHNLCHSVNEYQKPPFSYTHIIFMAIETSPNKAMTVNDIYVWCETHFPYYTQAGVGWKNSLRHNLSINKSFKKISRDGRGG--------------------------PGRGAYWVVEPRERNNLIDAIRRSPCSLGSFPFLNNTYPWGTGNCYSNNIFQSANTLNNNLASLTATRSVVNNKLNSSIDLQSSSRGPLLRIGGQLTDASNLIRS 354          
The following BLAST results are available for this feature:
BLAST of Forkhead box protein N3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXJ33.118e-1837.72forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ39.757e-1834.29forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ39.757e-1834.29forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ39.757e-1834.29forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ39.757e-1834.29forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkh-61.339e-1337.50ForKHead transcription factor family [Source:UniP... [more]
fkh-21.636e-1335.24ForKHead transcription factor family [Source:UniP... [more]
unc-1302.169e-1131.25pep chromosome:WBcel235:II:11281986:11283953:1 gen... [more]
fkh-103.046e-1137.97ForKHead transcription factor family [Source:UniP... [more]
fkh-103.046e-1137.97ForKHead transcription factor family [Source:UniP... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHES-1-like1.746e-1533.61gene:FBgn0029504 transcript:FBtr0112946[more]
CHES-1-like1.746e-1533.61gene:FBgn0029504 transcript:FBtr0333203[more]
CHES-1-like1.746e-1533.61gene:FBgn0029504 transcript:FBtr0071079[more]
CHES-1-like1.791e-1533.61gene:FBgn0029504 transcript:FBtr0310287[more]
FoxK3.487e-1430.00gene:FBgn0036134 transcript:FBtr0300783[more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj34.649e-1935.71forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1... [more]
foxj34.961e-1935.71forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1... [more]
si:ch211-145o7.33.937e-1834.65si:ch211-145o7.3 [Source:ZFIN;Acc:ZDB-GENE-061207-... [more]
foxj1a3.753e-1730.43forkhead box J1a [Source:NCBI gene;Acc:767737][more]
foxj1a3.753e-1730.43forkhead box J1a [Source:NCBI gene;Acc:767737][more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndel19.875e-1835.00nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel19.955e-1835.00nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel11.057e-1735.00nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel11.301e-1735.00nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel11.432e-1735.00nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxj25.132e-1839.62forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805... [more]
Foxj31.954e-1734.29forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxj33.824e-1737.72forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxj22.328e-1639.62forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805... [more]
Foxj22.328e-1639.62forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805... [more]
back to top
BLAST of Forkhead box protein N3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UPW0|FOXJ3_HUMAN4.686e-1734.29Forkhead box protein J3 OS=Homo sapiens OX=9606 GN... [more]
sp|Q8BUR3|FOXJ3_MOUSE1.367e-1634.29Forkhead box protein J3 OS=Mus musculus OX=10090 G... [more]
sp|F1QDF8|FXJ1A_DANRE2.833e-1630.43Forkhead box protein J1-A OS=Danio rerio OX=7955 G... [more]
sp|Q68EZ2|FOXJ2_XENLA1.511e-1536.28Forkhead box protein J2 OS=Xenopus laevis OX=8355 ... [more]
sp|Q28EM1|FOXJ2_XENTR1.593e-1536.28Forkhead box protein J2 OS=Xenopus tropicalis OX=8... [more]
back to top
BLAST of Forkhead box protein N3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P2P97.702e-3352.07Forkhead box protein N3 (Fragment) OS=Schistocepha... [more]
A0A5K3FSC21.364e-3254.92Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183WQJ12.389e-3254.10Fork-head domain-containing protein OS=Trichobilha... [more]
A0A5J4P0151.075e-3153.54Fork-head domain-containing protein OS=Paragonimus... [more]
A0A0R3U7M84.944e-3149.63Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj37.026e-1935.71forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
si:ch211-145o7.31.035e-1748.05si:ch211-145o7.3 [Source:ZFIN;Acc:ZDB-GENE-061207-... [more]
ENSAMXT00000049290.11.472e-1731.16forkhead box J1 [Source:NCBI gene;Acc:103028087][more]
foxj32.314e-1734.33forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
foxj24.242e-1738.68forkhead box protein J2 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj37.178e-1740.57forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1... [more]
foxj1b6.269e-1632.00forkhead box J1b [Source:NCBI gene;Acc:494105][more]
FOXC21.272e-1536.28forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
foxn31.570e-1529.53forkhead box N3 [Source:ZFIN;Acc:ZDB-GENE-060512-3... [more]
foxi3b2.841e-1533.33forkhead box I3b [Source:ZFIN;Acc:ZDB-GENE-031126-... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
FKH24.628e-1238.46Forkhead family transcription factor; rate-limitin... [more]
HCM16.659e-1247.46Forkhead transcription factor; drives S-phase acti... [more]
FKH12.478e-1127.59Forkhead family transcription factor; rate-limitin... [more]
FHL11.356e-936.76Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO490844.579e-1734.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363062.953e-1650.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451056.933e-1635.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448767.866e-1630.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369512.082e-1531.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Forkhead box protein N3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000042706.15.464e-1936.43forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000005812.25.464e-1936.43forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
FOXJ35.248e-1835.00forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000031716.18.547e-1837.93forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
si:ch211-145o7.36.293e-1734.48forkhead box protein N2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Forkhead box protein N3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033244.10.000e+097.79SMESG000033244.1[more]
SMESG000033244.10.000e+097.48SMESG000033244.1[more]
SMESG000033244.10.000e+093.85SMESG000033244.1[more]
SMESG000048193.15.940e-3435.09SMESG000048193.1[more]
SMESG000048193.18.363e-3435.09SMESG000048193.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006455 ID=SMED30006455|Name=Forkhead box protein N3|organism=Schmidtea mediterranea sexual|type=transcript|length=2595bp
GTAACCTCGTAGTACTATGACTACAAACAGCTCTTTCATATCAACAAGAG
TTGCAAATTACAAACTTTCATCTAGCTATCCTAGTATTACACCATTATAT
TCGAAAGATTTAAATTATAATGGTTCTTTATCATTTACTTCATATACTAA
ATCATGGAGTAGTTATCAGAATATGGCACTAAAAGCAACAGATAATTTGC
GCAATCAGGATTTAACCAATAATTCTGATCTACAACCTTTAAACTGGCTT
CAAAAAGAAAGTATTATTGACATTGATCCTCTTGATATCGAAGACGAATT
AAAAGATGATTCTAATACTCCTGGATATGATGATTTAATTGATCCCCATA
TTTCACATGCCAAAGTTGAAGTTGAATCACAAGAAAATTCTAACATACAT
GATTTTGTAAGATTCCAAGCAATGCGAAATAGCATGAACAACAGTAATCG
TGTTGCGTTGAGAAACAACAACTCATTTACAGACTGCAATCAAAATTACA
GTCACCAGGCTAGTGGATTCGCGAAGCCTAATTTAAGTTACACACAATTA
ATATTTATGGCTATCGAAACCTGCAAAGACAGAGCTATGACAGTTAATGA
TATTTACCAGTGGTGTGAAGTCAATTATCCTTATTACAAGCATATTGGAC
CTTCATGGAAGAATTCACTCCGGCACAATCTTTCTATCAATAAATCATTT
CGCAGGATGCCTCGTGATGGACAAACAACTATCGGCAATTATGAGATGAA
CAGTGGCGACGACATGAGTGAAGAAACGATATCCCAACGAGATAATAAGC
AAGGAGGTCCTGGCAGAGGTGCATATTGGGTGGTAGATGACAAGGAACGA
AAGAATCTGCTGGATTCAATTTATCGGGCACATCAAACTATACCCCTGAG
TGATCGAAACGGTCAGCGGATTGATCCACCGTATTCTCTTATTGTCAATC
CACCGAAAACTGGGCCTATGTTGCGCATTGATGGCCGTTTTACAGACGCG
TCAACGTATCTGCAGTCGAAACGCAGCGATGATGAAGTAGCGAATGAGAA
CTACAACATCCAATCAGATTATGCAAATGCCGAGAACCTGTCAATGCAGA
AAATCGAGAACACAGAAGCAGCCGAGTACACATCAATGATGTTTAATCTT
GCCACTACCAGCAGTCCAGAAACTGGTGGAGGAGACACATCGGTTAAATT
ATCAGCGAGCTACAACAGTAACTGCTCGAGAATGGAAGGTAAATGGGATG
CTCATTCAATGCCTAGCAACGATATTTATTCTCATTTAGAGGCAGACTCA
GACTTGTGTCAACCGAAATTAAAAAATCGACGTAAATCAAAGCATGAAAA
GGTTCGCAATTACAGTGAAATGGAATCAGCTACAAAAGATCTTTTTCCAA
ATCGCAAAAATCAGAAATCCGATCTCATTAAAACAAATAATGGCATGACA
AGTGTAAATGTAATTGTTGCTCCTCATTTCGATCACATCTATGCTCGTTA
TCAACAATTCCTACCGCCGGCAATTGCCAGTGACATGGATAAAGGGGTAT
TCGGGCAAGAGCATGATATAAACCCAGATGCCGATTTCCTCAAGAACGGA
TATCGTGATGATGACGATGAAGACAATGAAAATGAAGGAGAGCAAGGAGA
GATTGAGAATGAAGATGAACAATCGAATTTGAACTCGCTGGAAGCCATCA
AACAAGAGAAACTCGAAACCGATACCGCAATGTTGCCAACAAAACTGAAC
GGCTCCCGAAGGATCAAGCTATGCTGGAATGGGAAATTGAATTCTGCAGC
TGTAGCATTCACTCGACAGAGAAAGGTTCGCAGGGTTTTAAATCGGCGAG
CTCGGCGTAGTCTAAGAATTAGGAAACCGAGGGAGCCGGTGGAACCGAAT
GAGACGGCAATCAAGAAAGAGATGATTGAACCGAACGAGCAGACAGTGAT
AGAAGATGCCAGTGATGGCTACGCCACAGATTCCACTATGCCCATGAGCA
ACAGAAAATCGATCACAAGAACCAATCGGATAGTTGCCAACAAAACCCAC
CCGGTCCGAATCCTTCCAGTGAAGCGTAAAGCAAGTCTCAGTAAATCAGG
TCCTCCCGAAAAGCGATACCGTTCAAAACGGAAGCGAACGCGTCCATTGA
GAATCGACGAATCGAAAGAGATTGCTGCCATTCAGTTTCTCGCTAGCTTA
GAAAAGCGACAGCAAAATATTCAAAACTTAGAAAATTTGTATAATTTTAA
TAATTATCTCCAAACAACCTTGAGTGCTGGTGAGTCATCTTGCAATTCGT
CAGTAGTGATGGTTCAAGAGTGATGCTCCGTGTTCTCTGATTGGCCACCG
GCCCAACTTGATCAGCTCAGTGTATATAGCCTGTGACAATTTGTCAGTCT
TCCCACATATTGTTTGTGCAATAGAATTTGCTATTTGATGATTATGAAAA
CGATGATGATAATAATGTATAAATTGTAATGATCTTTTGAACCCTCAACA
GTGATCAACTGCAGAAATCAATAATCAGCTCACTAAACTACTTGGTGCTC
TTTCCAATTTGTGCTATATATATATATATATTATATTGTGATGTA
back to top

protein sequence of SMED30006455-orf-1

>SMED30006455-orf-1 ID=SMED30006455-orf-1|Name=SMED30006455-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=769bp
MTTNSSFISTRVANYKLSSSYPSITPLYSKDLNYNGSLSFTSYTKSWSSY
QNMALKATDNLRNQDLTNNSDLQPLNWLQKESIIDIDPLDIEDELKDDSN
TPGYDDLIDPHISHAKVEVESQENSNIHDFVRFQAMRNSMNNSNRVALRN
NNSFTDCNQNYSHQASGFAKPNLSYTQLIFMAIETCKDRAMTVNDIYQWC
EVNYPYYKHIGPSWKNSLRHNLSINKSFRRMPRDGQTTIGNYEMNSGDDM
SEETISQRDNKQGGPGRGAYWVVDDKERKNLLDSIYRAHQTIPLSDRNGQ
RIDPPYSLIVNPPKTGPMLRIDGRFTDASTYLQSKRSDDEVANENYNIQS
DYANAENLSMQKIENTEAAEYTSMMFNLATTSSPETGGGDTSVKLSASYN
SNCSRMEGKWDAHSMPSNDIYSHLEADSDLCQPKLKNRRKSKHEKVRNYS
EMESATKDLFPNRKNQKSDLIKTNNGMTSVNVIVAPHFDHIYARYQQFLP
PAIASDMDKGVFGQEHDINPDADFLKNGYRDDDDEDNENEGEQGEIENED
EQSNLNSLEAIKQEKLETDTAMLPTKLNGSRRIKLCWNGKLNSAAVAFTR
QRKVRRVLNRRARRSLRIRKPREPVEPNETAIKKEMIEPNEQTVIEDASD
GYATDSTMPMSNRKSITRTNRIVANKTHPVRILPVKRKASLSKSGPPEKR
YRSKRKRTRPLRIDESKEIAAIQFLASLEKRQQNIQNLENLYNFNNYLQT
TLSAGESSCNSSVVMVQE*
back to top
Aliases
The feature 'Forkhead box protein N3' has the following synonyms
Synonym
foxJ*
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR030456TF_fork_head_CS_2
IPR030457ELO_CS
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 548..568
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 243..267
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 687..710
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 243..261
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 533..549
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 533..554
NoneNo IPR availablePANTHERPTHR46078FAMILY NOT NAMEDcoord: 141..473
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 170..183
score: 58.62
coord: 214..231
score: 56.75
coord: 191..208
score: 36.73
IPR001766Fork head domainSMARTSM00339forkneu4coord: 168..286
e-value: 2.5E-30
score: 116.7
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 170..240
e-value: 4.2E-24
score: 84.6
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 170..284
score: 25.212
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 155..291
e-value: 4.6E-26
score: 92.7
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 214..220
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 170..287