slc35c-1

Overview
Nameslc35c-1 (AKN21645.1)
Smed IDSMED30006453
Length (bp)1237
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc35c-1 (SMED30006453) t-SNE clustered cells

Violin plots show distribution of expression levels for slc35c-1 (SMED30006453) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc35c-1 (SMED30006453) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc35c-1 (SMED30006453) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006453

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30006453SMESG000061718.1 dd_Smed_v4_9567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006453SMESG000061718.1 dd_Smed_v4_9567_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc35c-1 vs. Ensembl Human
Match: SLC35C1 (solute carrier family 35 member C1 [Source:HGNC Symbol;Acc:HGNC:20197])

HSP 1 Score: 165.622 bits (418), Expect = 7.224e-47
Identity = 112/328 (34.15%), Postives = 185/328 (56.40%), Query Frame = 3
Query:   78 SSTTNLKMTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVY-YKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
             +  N +  +  + LQI  VV  YW+TSISM F NKYL+ +    +  D  +FV + QC VT ++   +           D   P L+  +    +++ + + F  M+  NNL LK+VG++F+ + RSLT VF V+ + + L ++ S   +L C +++ GF +G+DQE   G LS  G + GV++S+ V+L  I+  +VL  ++ + + L +Y N+ + +L+LP LL   + Q +  + +L    F   + L G+ GF I   + ++I FTSP TH +S  AK+  QT+LAVL + E K   WW SN++V+ G+  YT ++ +E K T
Sbjct:   12 EAEANGEKPFLLRALQIALVVSLYWVTSISMVFLNKYLLDSP--SLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPGAVD--FPSLRLDLRVARSVLPLSVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGIIIGGFWLGVDQEGAEGTLSWLGTVFGVLASLCVSLNAIYTTKVLPAVDGSIWRLTFYNNVNACILFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEETKSFLWWTSNMMVLGGSSAYTWVRGWEMKKT 335          
BLAST of slc35c-1 vs. Ensembl Human
Match: SLC35C1 (solute carrier family 35 member C1 [Source:HGNC Symbol;Acc:HGNC:20197])

HSP 1 Score: 165.622 bits (418), Expect = 1.036e-46
Identity = 112/328 (34.15%), Postives = 185/328 (56.40%), Query Frame = 3
Query:   78 SSTTNLKMTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVY-YKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
             +  N +  +  + LQI  VV  YW+TSISM F NKYL+ +    +  D  +FV + QC VT ++   +           D   P L+  +    +++ + + F  M+  NNL LK+VG++F+ + RSLT VF V+ + + L ++ S   +L C +++ GF +G+DQE   G LS  G + GV++S+ V+L  I+  +VL  ++ + + L +Y N+ + +L+LP LL   + Q +  + +L    F   + L G+ GF I   + ++I FTSP TH +S  AK+  QT+LAVL + E K   WW SN++V+ G+  YT ++ +E K T
Sbjct:   25 EAEANGEKPFLLRALQIALVVSLYWVTSISMVFLNKYLLDSP--SLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPGAVD--FPSLRLDLRVARSVLPLSVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGIIIGGFWLGVDQEGAEGTLSWLGTVFGVLASLCVSLNAIYTTKVLPAVDGSIWRLTFYNNVNACILFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEETKSFLWWTSNMMVLGGSSAYTWVRGWEMKKT 348          
BLAST of slc35c-1 vs. Ensembl Human
Match: SLC35C1 (solute carrier family 35 member C1 [Source:HGNC Symbol;Acc:HGNC:20197])

HSP 1 Score: 64.3142 bits (155), Expect = 1.281e-11
Identity = 49/158 (31.01%), Postives = 84/158 (53.16%), Query Frame = 3
Query:   78 SSTTNLKMTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVV 551
             +  N +  +  + LQI  VV  YW+TSISM F NKYL+ +    +  D  +FV + QC VT ++   +           D   P L+  +    +++ + + F  M+  NNL LK+VG++F+ + RSLT VF V+ + + L ++ S   +L C +++
Sbjct:   12 EAEANGEKPFLLRALQIALVVSLYWVTSISMVFLNKYLLDSP--SLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPGAVD--FPSLRLDLRVARSVLPLSVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGIII 165          
BLAST of slc35c-1 vs. Ensembl Human
Match: SLC35C1 (solute carrier family 35 member C1 [Source:HGNC Symbol;Acc:HGNC:20197])

HSP 1 Score: 46.2098 bits (108), Expect = 3.494e-6
Identity = 25/62 (40.32%), Postives = 35/62 (56.45%), Query Frame = 3
Query:   78 SSTTNLKMTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVT 263
             +  N +  +  + LQI  VV  YW+TSISM F NKYL+ +    +  D  +FV + QC VT
Sbjct:   12 EAEANGEKPFLLRALQIALVVSLYWVTSISMVFLNKYLLDSP--SLRLDTPIFVTFYQCLVT 71          
BLAST of slc35c-1 vs. Ensembl Celegans
Match: nstp-10 (GDP-fucose transporter [Source:UniProtKB/Swiss-Prot;Acc:Q968A5])

HSP 1 Score: 187.578 bits (475), Expect = 1.098e-55
Identity = 118/322 (36.65%), Postives = 190/322 (59.01%), Query Frame = 3
Query:  102 TYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIV-YYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVI--KYFESKNT 1058
            T +  Y Q+   V  YW+ SI + F NKYL+      +  D  +F+ W QC VTV +   +   ++   + K  ++P + + I     ++ + + F  M+  NNL LK+VG+SF+ + RSLT VF V+ T + L +  S   I CCA+++ GF++G+DQE +TG LS  GV+ GV++S+ VAL  I+ ++VL+ + +  + L  Y N+ + VL+LP +L   +F  V Y+ KL D  F + + L GV GF++   +  +I  TSP TH IS  AK+  QT++AV+ ++ELK L WW SN +V+ G+  YT +  +  + KN+
Sbjct:    8 TKWESYKQVITAVSAYWVFSIGLVFLNKYLL----SSVQLDAPLFITWYQCLVTVFLCLFLSKTSKAYGLFKFPSMP-IDAKI--SREVLPLSVVFVAMISFNNLCLKYVGVSFYYVGRSLTTVFNVVCTYLILGQKTSGQAIGCCALIIFGFLLGVDQEGVTGTLSYTGVIFGVLASLSVALNAIYTRKVLSSVGDCLWRLTMYNNLNALVLFLPLMLFNGEFGAVFYFDKLFDTTFWILMTLGGVFGFMMGYVTGWQIQATSPLTHNISGTAKAAAQTVMAVVWYSELKTLLWWTSNFVVLFGSGMYTYVQKRVMDKKNS 322          
BLAST of slc35c-1 vs. Ensembl Celegans
Match: nstp-10 (GDP-fucose transporter [Source:UniProtKB/Swiss-Prot;Acc:Q968A5])

HSP 1 Score: 187.578 bits (475), Expect = 1.772e-55
Identity = 118/322 (36.65%), Postives = 190/322 (59.01%), Query Frame = 3
Query:  102 TYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIV-YYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVI--KYFESKNT 1058
            T +  Y Q+   V  YW+ SI + F NKYL+      +  D  +F+ W QC VTV +   +   ++   + K  ++P + + I     ++ + + F  M+  NNL LK+VG+SF+ + RSLT VF V+ T + L +  S   I CCA+++ GF++G+DQE +TG LS  GV+ GV++S+ VAL  I+ ++VL+ + +  + L  Y N+ + VL+LP +L   +F  V Y+ KL D  F + + L GV GF++   +  +I  TSP TH IS  AK+  QT++AV+ ++ELK L WW SN +V+ G+  YT +  +  + KN+
Sbjct:   22 TKWESYKQVITAVSAYWVFSIGLVFLNKYLL----SSVQLDAPLFITWYQCLVTVFLCLFLSKTSKAYGLFKFPSMP-IDAKI--SREVLPLSVVFVAMISFNNLCLKYVGVSFYYVGRSLTTVFNVVCTYLILGQKTSGQAIGCCALIIFGFLLGVDQEGVTGTLSYTGVIFGVLASLSVALNAIYTRKVLSSVGDCLWRLTMYNNLNALVLFLPLMLFNGEFGAVFYFDKLFDTTFWILMTLGGVFGFMMGYVTGWQIQATSPLTHNISGTAKAAAQTVMAVVWYSELKTLLWWTSNFVVLFGSGMYTYVQKRVMDKKNS 336          
BLAST of slc35c-1 vs. Ensembl Celegans
Match: nstp-9 (Nucleotide Sugar TransPorter family [Source:UniProtKB/TrEMBL;Acc:G5EC08])

HSP 1 Score: 138.272 bits (347), Expect = 2.483e-37
Identity = 97/300 (32.33%), Postives = 167/300 (55.67%), Query Frame = 3
Query:  153 ITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTL--KFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFE 1046
            + SI + F NK+L+     ++  DI +F+   QC VT+ I  ++    RW   K        K  I F+  + ++ LS   +  ++   L  + VG++F+ + RS+T VFTVI T +    + +  + + C V++IGF +G DQE     L+ +GVL G+ +S+ VAL  ++ K +L ++ N  + L +Y NI + +L+LP ++    F  ++        F   L ++G+ GF++N  +  +I  TSP TH IS  AKS  QT++AV +++E+K   WW SNL+++ G++ YT+ K  E
Sbjct:   13 VCSIGLVFINKHLLSGIGAEL--DIPLFITCCQCLVTIGICLVL----RWGSFKTKYLKTFSKLDINFETCIDVLPLSIVFVAMISFNNLCLRNVGVAFYYVGRSITTVFTVILTYVFFGDNSTKGVNVSCLVILIGFGIGSDQES-QDPLTTSGVLYGMFASLAVALNALYTKSILPKVGNCIWQLTWYNNILAVLLFLPLIIINGDFGKIW-NHFPTWSFWQLLFISGIFGFVMNYVTGWQIKATSPLTHNISATAKSASQTVIAVFLYSEVKSYLWWFSNLIILLGSMLYTIAKKSE 304          
BLAST of slc35c-1 vs. Ensembl Fly
Match: nac (gene:FBgn0265351 transcript:FBtr0081863)

HSP 1 Score: 167.548 bits (423), Expect = 5.307e-48
Identity = 108/323 (33.44%), Postives = 175/323 (54.18%), Query Frame = 3
Query:  111 SKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWIL----------MKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQ-IVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFE 1046
            +KYL+IFFVV  YW TSI   F NK+L+ +    ++    +F++W QC V+ VI ++    +R             +  DT    L  S+L+ + +    L           +L +V ++F+ I RSLT VF+V+ T + L +  S   +LCC  +V+GF +G+DQE LT   S  G + GV+SS+ +A+  I  K+ L  +    + L YY N+ ST+L+LP ++   + + I+ Y  L  + F  A+ L+G+ GF I   + +EI  TS  TH IS  AK+  QT++A   + +++   WW SN++V+  +  YT +K  E
Sbjct:   13 NKYLKIFFVVSLYWCTSILTVFVNKHLLSSD--TVNLGAPLFMSWFQCVVSTVICFVASRLSRKYPSVFTFPEGNPLDIDTFRKILPLSVLYTLMIGANNL-----------SLSYVTVAFYYIGRSLTTVFSVVLTYVILRQRTSFKCLLCCGAIVVGFWLGVDQESLTEVFSWRGTIFGVLSSLALAMFSIQTKKSLGYVNQEVWLLSYYNNLYSTLLFLPLIIINGELESIITYPHLWASWFWAAMTLSGLCGFAIGFVTALEIKVTSALTHNISGTAKACAQTVIATQYYHDVRSALWWTSNVVVLVASAAYTRVKQLE 322          
BLAST of slc35c-1 vs. Ensembl Zebrafish
Match: slc35c1 (solute carrier family 35 member C1 [Source:ZFIN;Acc:ZDB-GENE-041212-11])

HSP 1 Score: 194.897 bits (494), Expect = 2.895e-58
Identity = 123/319 (38.56%), Postives = 187/319 (58.62%), Query Frame = 3
Query:  105 YFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVY-YKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
            +F +  +I  VV  YW  SISM F N YL+ +K  D    IT F    QC V+V +  ++ F +   L       P LK  +     ++ + + F  M+  NNL LK+VG++F+ + RSL+ VF VI + + L ++ S+  +LCC V++ GF +G+DQE + G+LS AGV+ GV++S+ V+L  IF K+VL  ++ N + L YY N+ + VL+LP L+   + + V+ + +L D  F   + L GV GF I   + ++I FTSP TH +S  AKS  QT+LAV+ +A  K   WW SNL+V+ G+  YT +K  E K  
Sbjct:   16 FFMRATKIALVVTLYWFISISMVFLNNYLLDSKELDAPVFITFF----QCVVSVGLCLLMSFLSS--LCPGSVDFPSLKFDLRVSREILPLTIVFISMITFNNLCLKYVGVAFYTVGRSLSTVFNVILSYVVLKQTTSLYAVLCCGVILGGFWLGVDQEAVAGSLSWAGVVFGVIASLCVSLNAIFTKKVLPVVDGNIWKLSYYNNLNAIVLFLPLLIILGEVKSVFEFSRLTDLHFWGMMTLGGVFGFAIGYVTGLQIKFTSPLTHNVSGTAKSCAQTVLAVVYWASEKSTLWWTSNLMVLGGSFAYTWVKGMEMKKA 328          
BLAST of slc35c-1 vs. Ensembl Zebrafish
Match: slc35c1 (solute carrier family 35 member C1 [Source:ZFIN;Acc:ZDB-GENE-041212-11])

HSP 1 Score: 194.897 bits (494), Expect = 2.895e-58
Identity = 123/319 (38.56%), Postives = 187/319 (58.62%), Query Frame = 3
Query:  105 YFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVY-YKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
            +F +  +I  VV  YW  SISM F N YL+ +K  D    IT F    QC V+V +  ++ F +   L       P LK  +     ++ + + F  M+  NNL LK+VG++F+ + RSL+ VF VI + + L ++ S+  +LCC V++ GF +G+DQE + G+LS AGV+ GV++S+ V+L  IF K+VL  ++ N + L YY N+ + VL+LP L+   + + V+ + +L D  F   + L GV GF I   + ++I FTSP TH +S  AKS  QT+LAV+ +A  K   WW SNL+V+ G+  YT +K  E K  
Sbjct:   16 FFMRATKIALVVTLYWFISISMVFLNNYLLDSKELDAPVFITFF----QCVVSVGLCLLMSFLSS--LCPGSVDFPSLKFDLRVSREILPLTIVFISMITFNNLCLKYVGVAFYTVGRSLSTVFNVILSYVVLKQTTSLYAVLCCGVILGGFWLGVDQEAVAGSLSWAGVVFGVIASLCVSLNAIFTKKVLPVVDGNIWKLSYYNNLNAIVLFLPLLIILGEVKSVFEFSRLTDLHFWGMMTLGGVFGFAIGYVTGLQIKFTSPLTHNVSGTAKSCAQTVLAVVYWASEKSTLWWTSNLMVLGGSFAYTWVKGMEMKKA 328          
BLAST of slc35c-1 vs. Ensembl Xenopus
Match: eri1 (exoribonuclease 1 [Source:Xenbase;Acc:XB-GENE-974172])

HSP 1 Score: 172.555 bits (436), Expect = 1.834e-49
Identity = 108/322 (33.54%), Postives = 183/322 (56.83%), Query Frame = 3
Query:   96 KMTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVY-YKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
            + ++  + ++I  VV  YW  SI+M F NKYL+ +    +  D  +FV + QC VTVV+   +      ++       P L+  +     ++ + + F  M+  NNL LK++G++F+ + R L+ VF V+ + I L ++ S+  ++ C V++ GF +GIDQE   G LS AG+  GV++S+ V+L  I+ K+VL  ++ + + L +Y N+ +  L+ P L  F +   ++ + KL    F   + L G+ GF I   + ++I FTSP TH IS  AK+  QT+LAV+ + ++K   WW SNL+V+ G+  YT +K  E K +
Sbjct:   26 RESFLVRAVKIALVVTLYWFISITMVFLNKYLLDSP--SLKLDAPLFVTFYQCVVTVVLCKGLSLLTH-VVPSHILEFPSLRFDLKVLRTVLPLSIVFIGMITFNNLCLKYLGVAFYTVGRCLSTVFNVLLSYIMLKQTTSMYALMSCGVILGGFWLGIDQEGAEGTLSWAGIFFGVLASLCVSLNAIYTKKVLPAVDGSIWRLTFYNNVNACFLFTPLLFIFGEVGTLFTFDKLFAFSFWGMMTLGGIFGFAIGYVTGLQIQFTSPLTHNISGTAKACAQTVLAVMYYHQIKSFLWWTSNLMVLGGSFSYTWVKGLEMKKS 344          
BLAST of slc35c-1 vs. Ensembl Xenopus
Match: eri1 (exoribonuclease 1 [Source:Xenbase;Acc:XB-GENE-974172])

HSP 1 Score: 172.555 bits (436), Expect = 1.987e-49
Identity = 108/322 (33.54%), Postives = 183/322 (56.83%), Query Frame = 3
Query:   96 KMTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVY-YKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
            + ++  + ++I  VV  YW  SI+M F NKYL+ +    +  D  +FV + QC VTVV+   +      ++       P L+  +     ++ + + F  M+  NNL LK++G++F+ + R L+ VF V+ + I L ++ S+  ++ C V++ GF +GIDQE   G LS AG+  GV++S+ V+L  I+ K+VL  ++ + + L +Y N+ +  L+ P L  F +   ++ + KL    F   + L G+ GF I   + ++I FTSP TH IS  AK+  QT+LAV+ + ++K   WW SNL+V+ G+  YT +K  E K +
Sbjct:   28 RESFLVRAVKIALVVTLYWFISITMVFLNKYLLDSP--SLKLDAPLFVTFYQCVVTVVLCKGLSLLTH-VVPSHILEFPSLRFDLKVLRTVLPLSIVFIGMITFNNLCLKYLGVAFYTVGRCLSTVFNVLLSYIMLKQTTSMYALMSCGVILGGFWLGIDQEGAEGTLSWAGIFFGVLASLCVSLNAIYTKKVLPAVDGSIWRLTFYNNVNACFLFTPLLFIFGEVGTLFTFDKLFAFSFWGMMTLGGIFGFAIGYVTGLQIQFTSPLTHNISGTAKACAQTVLAVMYYHQIKSFLWWTSNLMVLGGSFSYTWVKGLEMKKS 346          
BLAST of slc35c-1 vs. Ensembl Mouse
Match: Slc35c1 (solute carrier family 35, member C1 [Source:MGI Symbol;Acc:MGI:2443301])

HSP 1 Score: 185.267 bits (469), Expect = 1.723e-54
Identity = 112/316 (35.44%), Postives = 184/316 (58.23%), Query Frame = 3
Query:  114 KYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQ-IVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
            + LQI  VV  YW+TSISM F NKYL+ +    +  D  +FV + QC VT ++   +           D   P L   +    +++ + + F  M+  NNL LK+VG+ F+ + RSLT VF V+ + + L ++ S   +L C V++ GF +GIDQE   G LS+ G + GV++S+ V+L  I+ K+VL  ++++ + L +Y N+ + VL+LP ++   + + ++ +  L    F + + L G+ GF I   + ++I FTSP TH +S  AK+  QT+LAVL + E+K   WW SNL+V+ G+  YT ++ +E + T
Sbjct:   23 RALQIALVVSLYWVTSISMVFLNKYLLDSP--SLQLDTPIFVTFYQCLVTSLLCKGLSTLATCCPGMVD--FPTLNLDLKVARSVLPLSVVFIGMITFNNLCLKYVGVPFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGVIIGGFWLGIDQEGAEGTLSLTGTIFGVLASLCVSLNAIYTKKVLPAVDHSIWRLTFYNNVNACVLFLPLMIVLGELRALLAFTHLSSAHFWLMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEEIKSFLWWTSNLMVLGGSSAYTWVRGWEMQKT 334          
BLAST of slc35c-1 vs. Ensembl Mouse
Match: Slc35c1 (solute carrier family 35, member C1 [Source:MGI Symbol;Acc:MGI:2443301])

HSP 1 Score: 185.267 bits (469), Expect = 2.331e-54
Identity = 115/326 (35.28%), Postives = 186/326 (57.06%), Query Frame = 3
Query:  114 KYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTL----------PPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQ-IVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
            + LQI  VV  YW+TSISM F NKYL+ +    +  D  +FV + QC VT             +L K  +TL          P L   +    +++ + + F  M+  NNL LK+VG+ F+ + RSLT VF V+ + + L ++ S   +L C V++ GF +GIDQE   G LS+ G + GV++S+ V+L  I+ K+VL  ++++ + L +Y N+ + VL+LP ++   + + ++ +  L    F + + L G+ GF I   + ++I FTSP TH +S  AK+  QT+LAVL + E+K   WW SNL+V+ G+  YT ++ +E + T
Sbjct:   36 RALQIALVVSLYWVTSISMVFLNKYLLDSP--SLQLDTPIFVTFYQCLVTS------------LLCKGLSTLATCCPGMVDFPTLNLDLKVARSVLPLSVVFIGMITFNNLCLKYVGVPFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGVIIGGFWLGIDQEGAEGTLSLTGTIFGVLASLCVSLNAIYTKKVLPAVDHSIWRLTFYNNVNACVLFLPLMIVLGELRALLAFTHLSSAHFWLMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEEIKSFLWWTSNLMVLGGSSAYTWVRGWEMQKT 347          
BLAST of slc35c-1 vs. Ensembl Mouse
Match: Slc35c1 (solute carrier family 35, member C1 [Source:MGI Symbol;Acc:MGI:2443301])

HSP 1 Score: 55.4546 bits (132), Expect = 7.313e-9
Identity = 46/135 (34.07%), Postives = 72/135 (53.33%), Query Frame = 3
Query:  114 KYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQS 518
            + LQI  VV  YW+TSISM F NKYL+ +    +  D  +FV + QC VT ++   +           D   P L   +    +++ + + F  M+  NNL LK+VG+ F+ + RSLT VF V+ + + L ++ S
Sbjct:   23 RALQIALVVSLYWVTSISMVFLNKYLLDSP--SLQLDTPIFVTFYQCLVTSLLCKGLSTLATCCPGMVD--FPTLNLDLKVARSVLPLSVVFIGMITFNNLCLKYVGVPFYNVGRSLTTVFNVLLSYLLLKQTTS 153          
BLAST of slc35c-1 vs. UniProt/SwissProt
Match: sp|A7S1L6|FUCT1_NEMVE (GDP-fucose transporter 1 OS=Nematostella vectensis OX=45351 GN=slc35c1 PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 2.160e-54
Identity = 116/326 (35.58%), Postives = 184/326 (56.44%), Query Frame = 3
Query:   93 LKMTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNR---WILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQF-QIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
            +K +  +K ++I  VV  YW  SIS+ F NKYL+ +   DI  D  +FV W QC VTV+ ++ +        WI      T P     +     ++ +   F  M+  NNL LK +G+SF+ + RSLT VF VI T + L +S S   ++CCAV++ GF+MG+DQE  +G +S +GVL GV++S+ V+L  I+ K+ +  ++NN + L  Y N  +  L+LP +    +  ++ ++  L    F + + + GV G  I   + ++I  TSP TH IS  AK+ +QTI++V  F E K   WW SN +V+ G++ YT +++ E K  
Sbjct:    1 MKESLLAKSVRIAAVVAAYWTISISLVFLNKYLLSSP--DIKLDAPLFVTWYQCVVTVICLFFLSLLGDRYPWI-----DTFPAFHIKLSVAKQVLPLSAVFVGMITFNNLCLKNLGVSFYNVGRSLTTVFNVICTYVILGQSTSYKAVICCAVIIGGFLMGVDQEGSSGKISYSGVLFGVLASLCVSLNAIYTKKFIPAVDNNIWRLQLYNNFNACFLFLPLMALLGEIGEVAHFPNLSSAYFWLMMTIGGVFGIAIGYITGLQIKVTSPLTHNISGTAKACVQTIMSVSYFHETKTALWWLSNAMVLGGSMAYTRVRHSEMKKA 319          
BLAST of slc35c-1 vs. UniProt/SwissProt
Match: sp|Q968A5|FUC10_CAEEL (GDP-fucose transporter OS=Caenorhabditis elegans OX=6239 GN=nstp-10 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 2.254e-54
Identity = 118/322 (36.65%), Postives = 190/322 (59.01%), Query Frame = 3
Query:  102 TYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIV-YYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVI--KYFESKNT 1058
            T +  Y Q+   V  YW+ SI + F NKYL+      +  D  +F+ W QC VTV +   +   ++   + K  ++P + + I     ++ + + F  M+  NNL LK+VG+SF+ + RSLT VF V+ T + L +  S   I CCA+++ GF++G+DQE +TG LS  GV+ GV++S+ VAL  I+ ++VL+ + +  + L  Y N+ + VL+LP +L   +F  V Y+ KL D  F + + L GV GF++   +  +I  TSP TH IS  AK+  QT++AV+ ++ELK L WW SN +V+ G+  YT +  +  + KN+
Sbjct:   22 TKWESYKQVITAVSAYWVFSIGLVFLNKYLL----SSVQLDAPLFITWYQCLVTVFLCLFLSKTSKAYGLFKFPSMP-IDAKI--SREVLPLSVVFVAMISFNNLCLKYVGVSFYYVGRSLTTVFNVVCTYLILGQKTSGQAIGCCALIIFGFLLGVDQEGVTGTLSYTGVIFGVLASLSVALNAIYTRKVLSSVGDCLWRLTMYNNLNALVLFLPLMLFNGEFGAVFYFDKLFDTTFWILMTLGGVFGFMMGYVTGWQIQATSPLTHNISGTAKAAAQTVMAVVWYSELKTLLWWTSNFVVLFGSGMYTYVQKRVMDKKNS 336          
BLAST of slc35c-1 vs. UniProt/SwissProt
Match: sp|Q8BLX4|FUCT1_MOUSE (GDP-fucose transporter 1 OS=Mus musculus OX=10090 GN=Slc35c1 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.630e-53
Identity = 115/326 (35.28%), Postives = 186/326 (57.06%), Query Frame = 3
Query:  114 KYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTL----------PPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQ-IVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
            + LQI  VV  YW+TSISM F NKYL+ +    +  D  +FV + QC VT             +L K  +TL          P L   +    +++ + + F  M+  NNL LK+VG+ F+ + RSLT VF V+ + + L ++ S   +L C V++ GF +GIDQE   G LS+ G + GV++S+ V+L  I+ K+VL  ++++ + L +Y N+ + VL+LP ++   + + ++ +  L    F + + L G+ GF I   + ++I FTSP TH +S  AK+  QT+LAVL + E+K   WW SNL+V+ G+  YT ++ +E + T
Sbjct:   36 RALQIALVVSLYWVTSISMVFLNKYLLDSP--SLQLDTPIFVTFYQCLVTS------------LLCKGLSTLATCCPGMVDFPTLNLDLKVARSVLPLSVVFIGMITFNNLCLKYVGVPFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGVIIGGFWLGIDQEGAEGTLSLTGTIFGVLASLCVSLNAIYTKKVLPAVDHSIWRLTFYNNVNACVLFLPLMIVLGELRALLAFTHLSSAHFWLMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEEIKSFLWWTSNLMVLGGSSAYTWVRGWEMQKT 347          
BLAST of slc35c-1 vs. UniProt/SwissProt
Match: sp|A9UUB8|FUCT1_MONBE (GDP-fucose transporter 1 OS=Monosiga brevicollis OX=81824 GN=slc35c1 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 8.456e-50
Identity = 111/327 (33.94%), Postives = 183/327 (55.96%), Query Frame = 3
Query:  102 TYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLK--SSILFDXXXXXXXXXXXXXXXXXXX----TLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQF-QIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNTL 1061
            T   + ++I FVV  YW+ SISM F NKYL+     ++S D  MFV W QC V VV          +IL +  +  P L+      FD ++ + +L  SL+           LKFVG++F+ + RSLT +F V+ +   L +  S+  +L C V+V GF +G+++E+   +L++AG++ GV++S+ VAL  I++K+V+  ++N+ + L  Y N+ +  L+LP +    +   I   + +    +   + + G+LG  I L S ++IN TSP TH IS  +K+  QTILA+ +  E +   WW  N+ V+ G++GY ++K  E K  L
Sbjct:    8 TLLERSIKIAFVVALYWVVSISMVFLNKYLL----SEVSLDAPMFVTWFQCVVAVVTC--------FILGELRSYHPALEMFPRFAFDTHVAMKVLPLSLVFVGMIAFNNLALKFVGVAFYNVGRSLTTIFNVLLSFFMLQQRTSMPALLMCGVIVAGFFVGVNKEQEQADLTMAGIMYGVLASLCVALNAIYIKKVMPFVDNDMWKLTAYNNMNAIFLFLPVITFMGEIPDIAASEDVYSGNYWFLMTVAGLLGIAIGLVSMLQINVTSPLTHNISGTSKACAQTILALQLNDESRTATWWLGNVFVLGGSLGYVLVKRAEMKRDL 322          
BLAST of slc35c-1 vs. UniProt/SwissProt
Match: sp|A6QM03|FUCT1_BOVIN (GDP-fucose transporter 1 OS=Bos taurus OX=9913 GN=SLC35C1 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.758e-47
Identity = 115/316 (36.39%), Postives = 182/316 (57.59%), Query Frame = 3
Query:  114 KYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQ-IVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
            + LQI  VV  YW+TSISM F NKYL+ +    +  D  +FV + QC VTV++   +           D   P L   +    +++ + + F  M+  NNL LK+VG++F+ + RSLT VF V+ + + L ++ S   +L C+V++ GF +G+DQE   G LS  G L GV++S+ V+L  I+ K+VL  ++ + + L +Y N  + VL+LP LL   + + ++ + +L    F   + L G+ GF I   + ++I FTSP TH +S  AK+  QT+LAVL + E K   WW SN++V+ G+  YT ++  E K T
Sbjct:   37 RALQIALVVSLYWVTSISMVFLNKYLLDSP--SLRLDTPIFVTFYQCLVTVLLCKGLSSLATCCPGTVD--FPALHLDLKVARSVLPLSVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCSVIIGGFWLGVDQEGAEGTLSWTGTLFGVLASLCVSLNAIYTKKVLPAVDGSIWRLTFYNNANACVLFLPLLLALGELRALLAFPQLGSAHFWAMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEEAKSFLWWTSNMMVLGGSSAYTWVRGREMKKT 348          
BLAST of slc35c-1 vs. TrEMBL
Match: A0A0H3YF99 (Slc35c-1 OS=Schmidtea mediterranea OX=79327 GN=slc35c-1 PE=2 SV=1)

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 321/321 (100.00%), Postives = 321/321 (100.00%), Query Frame = 3
Query:   99 MTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNTL 1061
            MTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTVVIVYIIYFFNRWILMKKDTTLPPLKSSILFDINMIIMILSFSLMLFLNNLTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNTL
Sbjct:    1 MTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTVVIVYIIYFFNRWILMKKDTTLPPLKSSILFDINMIIMILSFSLMLFLNNLTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNTL 321          
BLAST of slc35c-1 vs. TrEMBL
Match: A0A1I8GSL0 (TPT domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 1.050e-86
Identity = 153/307 (49.84%), Postives = 213/307 (69.38%), Query Frame = 3
Query:  120 LQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRI-ENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIK 1037
            ++I  V+L YW  SISM FANKYLVG+K  +   D+++FVAW QC  TV++V  +  F R +L   D  LPPL   IL + + +++   F+ ML  NNL LK+VG++FFQ+ARS+TL+FTVIF+ I L +  S+ + LCC +V  GFV+G+DQEK+ G LS  GV+ GV +S+FV+L GIF KR+L  I +N + ++ YYMNIG ++L++P L+ F QF   Y  +  D  F++ L  +GVL FLI  ASNM+I++TSP TH ISNN K+VLQT+LAV +++E K   WW SN LVV GA  YT++K
Sbjct:   18 IKIVGVILTYWTVSISMVFANKYLVGDKLSN-KLDVSLFVAWAQCVSTVLVVVALVAFRRLVL-GHDIELPPLSREILLNRDFLLLSCMFTGMLTFNNLCLKYVGVAFFQVARSMTLIFTVIFSSILLRRVSSLPVWLCCLIVAAGFVLGVDQEKVAGTLSTVGVMYGVSTSLFVSLNGIFTKRLLDMISKNQALAVTYYMNIGGSILFMPLLICFGQFSAAYSSRGTDFSFLLLLASSGVLSFLIGWASNMQIDYTSPVTHHISNNTKAVLQTLLAVFVYSEHKSAIWWLSNCLVVAGAFSYTMVK 322          
BLAST of slc35c-1 vs. TrEMBL
Match: A0A267DYY0 (TPT domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031091g1 PE=4 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 1.261e-86
Identity = 152/307 (49.51%), Postives = 213/307 (69.38%), Query Frame = 3
Query:  120 LQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRI-ENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIK 1037
            ++I  V+L YW  SISM FANKYLVG+K  +   D+++FVAW QC  TV++V  +  F R +L   D  LPPL   IL + + +++   F+ ML  NNL LK+VG++FFQ+ARS+TL+FTVIF+ I L +  S+ + LCC +V  GFV+G+DQEK+ G LS  G++ GV +S+FV+L GIF KR+L  I +N + ++ YYMNIG ++L++P L+ F QF   Y  +  D  F++ L  +GVL FLI  ASNM+I++TSP TH ISNN K+VLQT+LAV +++E K   WW SN LVV GA  YT++K
Sbjct:   10 IKIVGVILTYWTVSISMVFANKYLVGDKLSN-KLDVSLFVAWAQCVSTVLVVVALVAFRRLVL-GHDIELPPLSREILMNRDFLLLSCMFTGMLTFNNLCLKYVGVAFFQVARSMTLIFTVIFSSILLRRVSSLPVWLCCLIVAAGFVLGVDQEKVAGTLSTVGIMYGVSTSLFVSLNGIFTKRLLDMISKNQALAVTYYMNIGGSILFMPLLICFGQFSAAYSSRGTDFSFLLLLASSGVLSFLIGWASNMQIDYTSPVTHHISNNTKAVLQTLLAVFVYSEHKSAIWWLSNCLVVAGAFSYTMVK 314          
BLAST of slc35c-1 vs. TrEMBL
Match: A0A1I8GSI6 (TPT domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 2.033e-86
Identity = 152/307 (49.51%), Postives = 213/307 (69.38%), Query Frame = 3
Query:  120 LQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRI-ENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIK 1037
            ++I  V+L YW  SISM FANKYLVG+K  +   D+++FVAW QC  TV++V  +  F R +L   D  LPPL   IL + + +++   F+ ML  NNL LK+VG++FFQ+ARS+TL+FTVIF+ I L +  S+ + LCC +V  GFV+G+DQEK+ G LS  G++ GV +S+FV+L GIF KR+L  I +N + ++ YYMNIG ++L++P L+ F QF   Y  +  D  F++ L  +GVL FLI  ASNM+I++TSP TH ISNN K+VLQT+LAV +++E K   WW SN LVV GA  YT++K
Sbjct:   18 IKIVGVILTYWTVSISMVFANKYLVGDKLSN-KLDVSLFVAWAQCVSTVLVVVALVAFRRLVL-GHDIELPPLSREILMNRDFLLLSCMFTGMLTFNNLCLKYVGVAFFQVARSMTLIFTVIFSSILLRRVSSLPVWLCCLIVAAGFVLGVDQEKVAGTLSTVGIMYGVSTSLFVSLNGIFTKRLLDMISKNQALAVTYYMNIGGSILFMPLLICFGQFSAAYSSRGTDFSFLLLLASSGVLSFLIGWASNMQIDYTSPVTHHISNNTKAVLQTLLAVFVYSEHKSAIWWLSNCLVVAGAFSYTMVK 322          
BLAST of slc35c-1 vs. TrEMBL
Match: A0A1S3IE84 (GDP-fucose transporter 1-like OS=Lingula unguis OX=7574 GN=LOC106163489 PE=4 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 3.623e-76
Identity = 144/316 (45.57%), Postives = 209/316 (66.14%), Query Frame = 3
Query:  111 SKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYY-KKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKN 1055
            + YL+IF VV+ YW  SISM FANKYLVG++F  +  D+++FVA+ QC ++VV V       +  +   D        SI    NM+++   F  ML  NNL LK VG++FFQIARS+TL+FTV+F+ I L K  S   I CC +VV GF++G+DQEK+ G LS+ GV+ GV +SVFVAL GI +K+ L  ++ +S  + +Y N  + +L+ P +L   + +  +   K  D  F +A++++G+LGFLI  AS ++I++TSP TH +SNNAKSV+QTI+AV I+ E KP  WW SN++V+TGA+ Y ++K  E KN
Sbjct:    7 ASYLKIFLVVMNYWTMSISMVFANKYLVGSRFSSL--DLSLFVAFFQCIISVVFVLFYTRAGK--MCYPDIHPISYSPSIGLSRNMVVLSGLFVGMLSFNNLCLKHVGVAFFQIARSMTLIFTVMFSAIILKKYSSWKAICCCLIVVGGFILGVDQEKVAGTLSVRGVMYGVTTSVFVALVGITIKKALDIVDKDSARVTFYNNFNAAMLFTPLVLASGELEAFWLSDKASDVYFWMAMVVSGILGFLIAWASALQIHYTSPVTHHVSNNAKSVVQTIMAVTIYQESKPWLWWVSNIMVMTGALAYALVKMKEEKN 318          
BLAST of slc35c-1 vs. Ensembl Cavefish
Match: slc35c1 (solute carrier family 35 member C1 [Source:NCBI gene;Acc:103034845])

HSP 1 Score: 174.866 bits (442), Expect = 1.087e-50
Identity = 108/320 (33.75%), Postives = 187/320 (58.44%), Query Frame = 3
Query:   96 KMTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQF-QIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESK 1052
            +  +  + ++I  VV  YW  SI+M F N YL+ +K  D+  D  +FV + QC V+V +  ++   +  I+       P +K  +     ++ + + F  M+  NNL LK VG++F+ + RSL+ VF V+ + + L ++ S+  +LCC V++ GF +G+DQE   G+LS +GV  GV++S  V+L  I+ K+V+  ++ + + L YY N+ +  L+LP ++ F +F ++  + +L +  F   +++ GV GF I   + ++I +TSP TH +S  AK+  QT+LAV+ +   K   WW SNL+V+ G+  YT +K  E K
Sbjct:   14 REPFLVRAVKIALVVALYWFVSITMVFLNNYLLDSK--DL--DAPLFVTFFQCMVSVCLCGVMNVLS--IMYPSCVDFPSIKVDLKVSREIMPLSVVFISMITFNNLCLKNVGVAFYTVGRSLSTVFNVLLSYVILKQTTSMYAMLCCGVILGGFWLGVDQEGEAGSLSWSGVFFGVLASACVSLNAIYTKKVMPVVDGSIWKLSYYNNLNACALFLPLMIVFGEFGRLASFSQLLNMNFWGMMVVGGVFGFAIGYVTGLQIKYTSPLTHNVSGTAKACAQTVLAVMYYHTSKSGLWWTSNLMVLGGSSAYTWVKGLEMK 327          
BLAST of slc35c-1 vs. Ensembl Sea Lamprey
Match: slc35c1 (solute carrier family 35 member C1 [Source:ZFIN;Acc:ZDB-GENE-041212-11])

HSP 1 Score: 153.68 bits (387), Expect = 2.585e-44
Identity = 87/214 (40.65%), Postives = 139/214 (64.95%), Query Frame = 3
Query:  420 LKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQF-QIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
            LKFVGISF+ + RSLT VF V+ + + L +  S+  +LCC +++ GF +G+DQE ++G LS+AGV+ GVV+S+ V+L  I+ K+VL  +  + + L YY NI + +L++P +L   +  +++ ++ +    F + + L GVLGF I   + ++I  TSP TH +S  AK+ +QT++AV  F E K + WW SN+LV+TG+  YT +K  E K  
Sbjct:   29 LKFVGISFYNVGRSLTTVFNVLMSYMILGQGTSLPALLCCGMIIGGFWLGVDQEDMSGTLSVAGVVFGVVASLCVSLNAIYTKKVLPLVGGSLWRLAYYNNINACLLFMPIILLVGEAPKLLAFEHVFSPHFWMIMTLGGVLGFGIGYVTGLQIQVTSPLTHNVSGTAKACVQTVVAVSYFGEFKTVLWWASNVLVLTGSFFYTWVKGHEMKKA 242          
BLAST of slc35c-1 vs. Ensembl Nematostella
Match: SLC35C1 (GDP-fucose transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:A7S1L6])

HSP 1 Score: 186.808 bits (473), Expect = 8.855e-56
Identity = 116/326 (35.58%), Postives = 184/326 (56.44%), Query Frame = 3
Query:   93 LKMTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNR---WILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQF-QIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
            +K +  +K ++I  VV  YW  SIS+ F NKYL+ +   DI  D  +FV W QC VTV+ ++ +        WI      T P     +     ++ +   F  M+  NNL LK +G+SF+ + RSLT VF VI T + L +S S   ++CCAV++ GF+MG+DQE  +G +S +GVL GV++S+ V+L  I+ K+ +  ++NN + L  Y N  +  L+LP +    +  ++ ++  L    F + + + GV G  I   + ++I  TSP TH IS  AK+ +QTI++V  F E K   WW SN +V+ G++ YT +++ E K  
Sbjct:    1 MKESLLAKSVRIAAVVAAYWTISISLVFLNKYLLSSP--DIKLDAPLFVTWYQCVVTVICLFFLSLLGDRYPWI-----DTFPAFHIKLSVAKQVLPLSAVFVGMITFNNLCLKNLGVSFYNVGRSLTTVFNVICTYVILGQSTSYKAVICCAVIIGGFLMGVDQEGSSGKISYSGVLFGVLASLCVSLNAIYTKKFIPAVDNNIWRLQLYNNFNACFLFLPLMALLGEIGEVAHFPNLSSAYFWLMMTIGGVFGIAIGYITGLQIKVTSPLTHNISGTAKACVQTIMSVSYFHETKTALWWLSNAMVLGGSMAYTRVRHSEMKKA 319          
BLAST of slc35c-1 vs. Ensembl Nematostella
Match: EDO27508 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T925])

HSP 1 Score: 70.4774 bits (171), Expect = 5.138e-15
Identity = 33/90 (36.67%), Postives = 51/90 (56.67%), Query Frame = 3
Query:  786 YKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKN 1055
            +  L    F + + + GV G  I   + ++I  TSP TH IS  AK+ +QTI++V  F E K   WW SN +V+ G++ YT +++ E K 
Sbjct:    1 FPNLSSAYFWLMMTIGGVFGIAIGYITGLQIKVTSPLTHNISGTAKACVQTIMSVSYFHETKTALWWLSNAMVLGGSMAYTRVRHSEMKK 90          
BLAST of slc35c-1 vs. Ensembl Nematostella
Match: EDO37817 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEN2])

HSP 1 Score: 56.6102 bits (135), Expect = 7.157e-9
Identity = 53/218 (24.31%), Postives = 103/218 (47.25%), Query Frame = 3
Query:  417 TLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYS---LVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLE--DNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKN 1055
            +LK+V +SF +  +S   +FT +F+ I + +  S+ + L    V+ G  +    E    + ++ G    +++++   +  +F K++L+  E +SYS   L +Y +  S V+  PF   F   Q+    KL+  D L +  L+  G L ++ +L +   ++  SP T  +SN  K  +   ++VL+F            ++V  G   Y   K  E++ 
Sbjct:  126 SLKYVAVSFTETVKSSAPIFTALFSWIMIGERSSLPVYLSLIPVMGGLALCTANEL---SFNVIGFTSALMNNLMDCVQNVFSKKLLSN-EQSSYSAPELQFYTSAASLVVQFPFWFFFMDIQV----KLQSMDYLMMFMLVFNGFLFYMQSLTAYALMSLISPVTFSVSNTVKRAVLIWISVLMFGNEVSALSALGTMIVTCGVFLYQRAKRQEAEQ 335          
BLAST of slc35c-1 vs. Ensembl Nematostella
Match: EDO45158 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTW7])

HSP 1 Score: 50.8322 bits (120), Expect = 5.197e-7
Identity = 43/213 (20.19%), Postives = 108/213 (50.70%), Query Frame = 3
Query:  429 VGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKL-EDNL--FIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKP--LFWWCSNLLVVTGAVGYTVIKYFESK 1052
            V +S+    ++   +FTV+ +++ L + Q+  +    A +V+G ++    E    +  I G++  +++++  A+  IF K+++  +  +   L+  +   +TV+ LP    +   +I+ Y  L E+N+   +V + + G L F+ N+ +   ++  +P ++ ++  +K +L  +++V +F    P  ++ +   L+ + G   Y   KY  ++
Sbjct:  100 VPVSYAHTVKATMPIFTVVLSRLILGQKQTPLVYFSLAPIVLGVMVSTATEL---SFDIVGLMSALLATLTFAVQNIFTKKMMRELHISHLRLLSILARIATVILLPIWALYDLRKILTYSDLSEENILWLLVVITINGFLNFVQNMVAFTVLSLITPLSYSVATASKRIL--VISVSLFMLRNPVTIYNFLGMLMAIFGVFIYNKAKYDANR 307          
BLAST of slc35c-1 vs. Ensembl Medaka
Match: slc35c1 (solute carrier family 35 member C1 [Source:NCBI gene;Acc:101159977])

HSP 1 Score: 177.948 bits (450), Expect = 1.892e-51
Identity = 111/317 (35.02%), Postives = 188/317 (59.31%), Query Frame = 3
Query:  114 KYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKD-TTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQF-QIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNT 1058
            +  +I  VV  YW  SI+M F N YL+ NK  D+  +  +FV + QC V+V +  ++   +   ++K D   +P +   +     ++ + + F  M+  NNL LK+VG++F+ I RSL+ VF V+ + I L +S S+  ++CC +++ GF +G+DQE L G+LS +GV  GV++S  V+L  I+ K+V+  ++ + + L YY NI + +L++P +L F +  Q+  + +L D  F   + + GV GF I   + ++I FTSP TH +S  AK+  QT++AV+  +  K   WW SN++V+ G+  YT +K  E + T
Sbjct:   55 RATKIAAVVALYWFISITMVFLNSYLLDNK--DL--NAPLFVTFYQCLVSVGLCGLMQLLS---MIKPDFVNVPAVNFQLKTSREVLPLSIVFIGMITFNNLCLKYVGVAFYTIGRSLSTVFNVLLSFIILKQSTSLQALVCCGIILGGFWLGVDQEGLAGSLSWSGVFFGVLASACVSLNAIYTKKVMPAVDGSIWKLSYYNNINACLLFIPLILVFGELGQLSRFNRLTDLKFWGMMTVGGVFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVIAVVYNSSSKSFLWWTSNMMVLGGSSAYTWVKSREMQKT 364          
BLAST of slc35c-1 vs. Planmine SMEST
Match: SMESG000061718.1 (SMESG000061718.1)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 318/321 (99.07%), Postives = 318/321 (99.07%), Query Frame = 3
Query:   99 MTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNRWILMKKDTTLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNTL 1061
            MT FSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTVVIVYIIYFFNRWILMKKDTTLPPLKSSILFDINMIIMILSFSLMLFLNNLTLKFVGISFFQIARSLTLVFTVIFTKI LHKSQSVNIILCC VVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNTL
Sbjct:    1 MTDFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTVVIVYIIYFFNRWILMKKDTTLPPLKSSILFDINMIIMILSFSLMLFLNNLTLKFVGISFFQIARSLTLVFTVIFTKIFLHKSQSVNIILCCVVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKNTL 321          
BLAST of slc35c-1 vs. Planmine SMEST
Match: SMESG000055012.1 (SMESG000055012.1)

HSP 1 Score: 181.8 bits (460), Expect = 9.790e-54
Identity = 111/330 (33.64%), Postives = 192/330 (58.18%), Query Frame = 3
Query:  102 TYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTXXXXXXXXXXNR---WILMKKDT-----TLPPLKSSILFDXXXXXXXXXXXXXXXXXXXTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQ----IVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVIKYFESKN 1055
            T+ S ++Q+   V  YW  SIS+ F NKYL+ +  +++  +  +F+ W QC+ +V++  ++   ++   W    + T     T+  L  S++             +M+  NN  LK V +SF+ I RSLT VF VIFT + L  S S+ +++CCAV++ GF +G+DQE+  G+LS  GVL GV SS FVAL  I+ K+ ++ + ++ + L +Y NI + +++ P +    +F       Y+ +++   F + ++++GV GF I   + ++I  TSP +H +S  AK+  QTI+A  IF+E+K   WWCSN++V+ G++ Y +++  E K 
Sbjct:    5 TFNSYHIQVISAVSLYWFISISLVFLNKYLLSS--NELKLNAPLFITWFQCSTSVILCLLLSSLSQKYQWFYFPRITFEFRKTIKILPLSVM-----------MLMMITCNNYALKLVNVSFYFIGRSLTTVFNVIFTYLLLKTSTSLKVMVCCAVIIFGFWLGVDQEEKLGSLSWKGVLFGVASSAFVALNAIYTKKKISVVNDDVWKLCFYNNINAAIIFFPLIFFTGEFDELKVFPYFFRIQ---FWLIMIISGVFGFAIGYVTGLQIQVTSPLSHTVSGTAKACAQTIIAYFIFSEIKSSLWWCSNIIVMGGSLVYALVRNKELKE 318          
BLAST of slc35c-1 vs. Planmine SMEST
Match: SMESG000066579.1 (SMESG000066579.1)

HSP 1 Score: 109.768 bits (273), Expect = 7.085e-27
Identity = 66/206 (32.04%), Postives = 115/206 (55.83%), Query Frame = 3
Query:  420 LKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVN-IILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVI 1034
            LKF GI+FF ++RS T++F +I +K+        N II+   ++ +  ++ + +E   G LSI  V+CG +SS+  A+  +   R   +I  +     Y MN G+ +   P +L     + +    L++  +I  LLL+GV+GF++ +A N E+ + +P +HQIS + KSV+QT+   +++ E K   WW  NL +    V YT++
Sbjct:  103 LKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAI-NVMSIRNEQKIHRDCLRTAYLMNFGAFIFLFPVVL--YNLKSIKVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 305          
The following BLAST results are available for this feature:
BLAST of slc35c-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SLC35C17.224e-4734.15solute carrier family 35 member C1 [Source:HGNC Sy... [more]
SLC35C11.036e-4634.15solute carrier family 35 member C1 [Source:HGNC Sy... [more]
SLC35C11.281e-1131.01solute carrier family 35 member C1 [Source:HGNC Sy... [more]
SLC35C13.494e-640.32solute carrier family 35 member C1 [Source:HGNC Sy... [more]
back to top
BLAST of slc35c-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nstp-101.098e-5536.65GDP-fucose transporter [Source:UniProtKB/Swiss-Pr... [more]
nstp-101.772e-5536.65GDP-fucose transporter [Source:UniProtKB/Swiss-Pr... [more]
nstp-92.483e-3732.33Nucleotide Sugar TransPorter family [Source:UniPr... [more]
back to top
BLAST of slc35c-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nac5.307e-4833.44gene:FBgn0265351 transcript:FBtr0081863[more]
back to top
BLAST of slc35c-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc35c12.895e-5838.56solute carrier family 35 member C1 [Source:ZFIN;Ac... [more]
slc35c12.895e-5838.56solute carrier family 35 member C1 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc35c-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eri11.834e-4933.54exoribonuclease 1 [Source:Xenbase;Acc:XB-GENE-9741... [more]
eri11.987e-4933.54exoribonuclease 1 [Source:Xenbase;Acc:XB-GENE-9741... [more]
back to top
BLAST of slc35c-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Slc35c11.723e-5435.44solute carrier family 35, member C1 [Source:MGI Sy... [more]
Slc35c12.331e-5435.28solute carrier family 35, member C1 [Source:MGI Sy... [more]
Slc35c17.313e-934.07solute carrier family 35, member C1 [Source:MGI Sy... [more]
back to top
BLAST of slc35c-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7S1L6|FUCT1_NEMVE2.160e-5435.58GDP-fucose transporter 1 OS=Nematostella vectensis... [more]
sp|Q968A5|FUC10_CAEEL2.254e-5436.65GDP-fucose transporter OS=Caenorhabditis elegans O... [more]
sp|Q8BLX4|FUCT1_MOUSE1.630e-5335.28GDP-fucose transporter 1 OS=Mus musculus OX=10090 ... [more]
sp|A9UUB8|FUCT1_MONBE8.456e-5033.94GDP-fucose transporter 1 OS=Monosiga brevicollis O... [more]
sp|A6QM03|FUCT1_BOVIN2.758e-4736.39GDP-fucose transporter 1 OS=Bos taurus OX=9913 GN=... [more]
back to top
BLAST of slc35c-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF990.000e+0100.00Slc35c-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1I8GSL01.050e-8649.84TPT domain-containing protein OS=Macrostomum ligna... [more]
A0A267DYY01.261e-8649.51TPT domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8GSI62.033e-8649.51TPT domain-containing protein OS=Macrostomum ligna... [more]
A0A1S3IE843.623e-7645.57GDP-fucose transporter 1-like OS=Lingula unguis OX... [more]
back to top
BLAST of slc35c-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc35c11.087e-5033.75solute carrier family 35 member C1 [Source:NCBI ge... [more]
back to top
BLAST of slc35c-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc35c12.585e-4440.65solute carrier family 35 member C1 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc35c-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc35c-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
SLC35C18.855e-5635.58GDP-fucose transporter 1 [Source:UniProtKB/Swiss-... [more]
EDO275085.138e-1536.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378177.157e-924.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451585.197e-720.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc35c-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc35c11.892e-5135.02solute carrier family 35 member C1 [Source:NCBI ge... [more]
back to top
BLAST of slc35c-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000061718.10.000e+099.07SMESG000061718.1[more]
SMESG000055012.19.790e-5433.64SMESG000055012.1[more]
SMESG000066579.17.085e-2732.04SMESG000066579.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006453
GenBankAKN21645.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006453 ID=SMED30006453|Name=slc35c-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1237bp
GAAAATTATTATTTAAATACGAACATTTGTAATTTAAAGTAACCTTTCCT
GTCGCTGAAAATTTCATATAAATTCTATCTTCAACAACTAATTTAAAAAT
GACATATTTTTCAAAGTATTTACAAATATTTTTTGTCGTTCTATTTTATT
GGATAACGTCCATATCAATGACTTTTGCAAATAAATATCTAGTTGGCAAT
AAATTCCACGATATTTCTGAAGATATTACAATGTTTGTTGCATGGACTCA
ATGTGCAGTAACTGTTGTTATTGTTTATATTATTTATTTCTTTAATCGTT
GGATTTTGATGAAGAAAGATACTACATTACCACCTCTGAAATCTTCTATT
TTGTTTGATATTAACATGATTATAATGATTTTGAGTTTTTCTTTAATGTT
ATTTCTCAACAATTTAACGTTAAAATTTGTCGGAATATCATTTTTTCAAA
TTGCTAGATCACTGACACTAGTTTTTACAGTTATTTTTACAAAAATTTGT
TTGCATAAAAGTCAGTCTGTAAATATCATTTTATGTTGTGCTGTAGTTGT
AATTGGTTTTGTAATGGGAATCGATCAGGAAAAATTAACTGGAAATTTAT
CAATAGCTGGAGTTTTGTGTGGCGTTGTAAGTAGCGTTTTTGTTGCTTTG
ACTGGAATATTTATGAAGCGTGTTTTGACTCGTATTGAAAACAATAGTTA
TTCATTGGTTTATTACATGAATATTGGTAGCACTGTTTTGTATTTACCTT
TTTTATTGGGGTTTTCTCAATTCCAAATCGTTTATTACAAAAAACTTGAA
GATAATTTATTTATCGTTGCTCTTCTTTTGACTGGAGTTTTAGGGTTTCT
TATCAATTTAGCAAGTAACATGGAAATTAATTTTACCTCTCCAACTACTC
ACCAGATTAGTAATAATGCTAAATCAGTTTTACAAACGATATTGGCTGTG
TTGATATTTGCTGAACTCAAACCATTGTTCTGGTGGTGCTCAAATTTGTT
GGTTGTTACAGGCGCTGTCGGTTATACGGTTATCAAATACTTTGAATCGA
AGAATACGTTGTAGATATTTACTTATCTTTGAGTTTTAATAAAATCACTA
ATTGCTATTTTTTTTATAAAAGTATAATTGAAAAATAAATTTGATTGTAA
TATTCAATGGCATTAATTTTGATTAATTGTGAGAAATTATAATTATATTT
ATAAAAGACATTGTATTTTCTACAAAATTTGACTATG
back to top

protein sequence of SMED30006453-orf-1

>SMED30006453-orf-1 ID=SMED30006453-orf-1|Name=SMED30006453-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=322bp
MTYFSKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWT
QCAVTVVIVYIIYFFNRWILMKKDTTLPPLKSSILFDINMIIMILSFSLM
LFLNNLTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVNIILCCAVV
VIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNS
YSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLEDNLFIVALLLTGVLGF
LINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNL
LVVTGAVGYTVIKYFESKNTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005457GDP-fucose transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0036085GDP-fucose import into Golgi lumen
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR029666GDP-fucose_transp
IPR004853Sugar_P_trans_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004853Sugar phosphate transporter domainPFAMPF03151TPTcoord: 9..289
e-value: 2.7E-19
score: 69.6
IPR029666GDP-fucose transporterPANTHERPTHR11132:SF255GDP-FUCOSE TRANSPORTER 1coord: 5..319
NoneNo IPR availablePANTHERPTHR11132SOLUTE CARRIER FAMILY 35coord: 5..319
NoneNo IPR availableTMHMMTMhelixcoord: 47..69
NoneNo IPR availableTMHMMTMhelixcoord: 7..27
NoneNo IPR availableTMHMMTMhelixcoord: 238..257
NoneNo IPR availableTMHMMTMhelixcoord: 140..157
NoneNo IPR availableTMHMMTMhelixcoord: 201..223
NoneNo IPR availableTMHMMTMhelixcoord: 82..103
NoneNo IPR availableTMHMMTMhelixcoord: 167..189
NoneNo IPR availableTMHMMTMhelixcoord: 113..135
NoneNo IPR availableTMHMMTMhelixcoord: 293..312