peptidase inhibitor 16

Overview
Namepeptidase inhibitor 16
Smed IDSMED30006444
Length (bp)469
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of peptidase inhibitor 16 (SMED30006444) t-SNE clustered cells

Violin plots show distribution of expression levels for peptidase inhibitor 16 (SMED30006444) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of peptidase inhibitor 16 (SMED30006444) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for peptidase inhibitor 16 (SMED30006444) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006444

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30006444h1SMcG0002907 dd_Smed_v4_20964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30006444h1SMcG0002907 dd_Smed_v4_20964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30006444h1SMcG0002907 dd_Smed_v6_20964_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of peptidase inhibitor 16 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 105.145 bits (261), Expect = 1.352e-26
Identity = 59/155 (38.06%), Postives = 85/155 (54.84%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCE----TKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            A++M  M+W+ E A+ A+  A +C   +    + + G   R G N+F    +     + +E  WH+E   Y+ S+ TCS    C  YTQV+WA ++ IGCG+ +CE     +   +  +VC Y P GN+ G  PY  GT CSQCPSG  C NSLC
Sbjct:   51 ASDMLHMRWDEELAAFAKAYARQCVWGH----NKERG---RRGENLFAITDEGMDVPLAMEE-WHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLC 197          
BLAST of peptidase inhibitor 16 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 105.145 bits (261), Expect = 1.352e-26
Identity = 59/155 (38.06%), Postives = 85/155 (54.84%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCE----TKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            A++M  M+W+ E A+ A+  A +C   +    + + G   R G N+F    +     + +E  WH+E   Y+ S+ TCS    C  YTQV+WA ++ IGCG+ +CE     +   +  +VC Y P GN+ G  PY  GT CSQCPSG  C NSLC
Sbjct:   51 ASDMLHMRWDEELAAFAKAYARQCVWGH----NKERG---RRGENLFAITDEGMDVPLAMEE-WHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLC 197          
BLAST of peptidase inhibitor 16 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 105.145 bits (261), Expect = 1.352e-26
Identity = 59/155 (38.06%), Postives = 85/155 (54.84%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCE----TKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            A++M  M+W+ E A+ A+  A +C   +    + + G   R G N+F    +     + +E  WH+E   Y+ S+ TCS    C  YTQV+WA ++ IGCG+ +CE     +   +  +VC Y P GN+ G  PY  GT CSQCPSG  C NSLC
Sbjct:   51 ASDMLHMRWDEELAAFAKAYARQCVWGH----NKERG---RRGENLFAITDEGMDVPLAMEE-WHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLC 197          
BLAST of peptidase inhibitor 16 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 82.4185 bits (202), Expect = 2.159e-19
Identity = 53/154 (34.42%), Postives = 74/154 (48.05%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKY---GTFERVGSNIFMFKRDNFVGIE--NYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSPKVNYV-VCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            AA+M  M W+   A  A+  AN+C   +    D  Y     FE VG NI++    +F        W+ E+  YDF S +CS    C  YTQ++WA+S  +GC    C         + VC YGP GN   + PY+ G +CS C     C+ +LC
Sbjct:   52 AADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRV--CGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLC 203          
BLAST of peptidase inhibitor 16 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 82.4185 bits (202), Expect = 2.519e-19
Identity = 53/154 (34.42%), Postives = 74/154 (48.05%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKY---GTFERVGSNIFMFKRDNFVGIE--NYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSPKVNYV-VCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            AA+M  M W+   A  A+  AN+C   +    D  Y     FE VG NI++    +F        W+ E+  YDF S +CS    C  YTQ++WA+S  +GC    C         + VC YGP GN   + PY+ G +CS C     C+ +LC
Sbjct:   52 AADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRV--CGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLC 203          
BLAST of peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18543])

HSP 1 Score: 77.7962 bits (190), Expect = 3.927e-18
Identity = 56/156 (35.90%), Postives = 79/156 (50.64%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMF-KRDNFVGIENY-------WHYESLKYDFSSKTCSG--FSPCLGY-TQVIWADSQEIGCGAFYCETKSPKVN--YVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTC 429
            A++M KMKW++  A+ AQ  ANKC   +   A +        G N++ +        I+ +       W  E   Y +SS T S   F+  +G+ TQ+ WA +  IGCG   C   +   N   VVC Y P+GN    + Y SGTTCS+CPSGT+C
Sbjct:   53 ASDMLKMKWDATVAASAQAYANKCPTGHSGAAGL--------GENLYWYWTSATITNIDQFGATGSAAWEKEFQDYGWSSNTLSMSLFNTGIGHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQYKPQGNYLNQNIYTSGTTCSKCPSGTSC 200          
BLAST of peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-14 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93444])

HSP 1 Score: 77.0258 bits (188), Expect = 7.310e-18
Identity = 56/156 (35.90%), Postives = 81/156 (51.92%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMF-------KRDNFVGIENY-WHYESLKYDFSSKTC--SGFSPCLGY-TQVIWADSQEIGCGAFYCETKSPKVN--YVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTC 429
            A++M KMKW    A+ +QI AN+C   + +M          VG N++ +         D F  + +  W  E   Y +SS T   S F+  +G+ TQ+ WA +  IGCG   C   +  +N   VVC Y P+GN    + Y SGTTCS+CP+GT+C
Sbjct:   53 ASDMLKMKWLRSLATSSQIYANRCPTGHSNMIG--------VGENLYWYWTSGTITNIDQFGAMASAAWEKEFQDYGWSSNTLTMSLFNSGVGHATQMAWAKTNLIGCGVKNCGMDTNGMNKVAVVCHYQPQGNYLNQNIYTSGTTCSKCPAGTSC 200          
BLAST of peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 72.7886 bits (177), Expect = 2.421e-16
Identity = 55/154 (35.71%), Postives = 73/154 (47.40%), Query Frame = 1
Query:    7 NM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENY--------WHYESLKYDFSSK--TCSGFSPCLGY-TQVIWADSQEIGCGAFYCETKSPKVN--YVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTC 429
            N+ KMKW+S  A+ AQ  AN C   +   A +        G N++ +     +G  N         W  E   Y + S   T   F+  +G+ TQ+ WA S  IGCG   C   S  +N   VVC Y P+GN      Y+SG TCS CPSGT+C
Sbjct:   54 NLLKMKWDSAVAASAQNYANGCPTGHSGDAGL--------GENLYWYWTSGSLGDLNQYGSAASASWEKEFQDYGWKSNLMTIDLFNTGIGHATQMAWAKSNLIGCGVKDCGRDSNGLNKVTVVCQYKPQGNFINQYIYVSGATCSGCPSGTSC 199          
BLAST of peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 72.7886 bits (177), Expect = 2.421e-16
Identity = 55/154 (35.71%), Postives = 73/154 (47.40%), Query Frame = 1
Query:    7 NM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENY--------WHYESLKYDFSSK--TCSGFSPCLGY-TQVIWADSQEIGCGAFYCETKSPKVN--YVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTC 429
            N+ KMKW+S  A+ AQ  AN C   +   A +        G N++ +     +G  N         W  E   Y + S   T   F+  +G+ TQ+ WA S  IGCG   C   S  +N   VVC Y P+GN      Y+SG TCS CPSGT+C
Sbjct:   54 NLLKMKWDSAVAASAQNYANGCPTGHSGDAGL--------GENLYWYWTSGSLGDLNQYGSAASASWEKEFQDYGWKSNLMTIDLFNTGIGHATQMAWAKSNLIGCGVKDCGRDSNGLNKVTVVCQYKPQGNFINQYIYVSGATCSGCPSGTSC 199          
BLAST of peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-3 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:G5EF50])

HSP 1 Score: 72.0182 bits (175), Expect = 5.737e-16
Identity = 55/160 (34.38%), Postives = 77/160 (48.12%), Query Frame = 1
Query:    4 ANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIF-MFKRDNFVGIENY-------WHYESLKYDFSSKTCSGFSPCLG------YTQVIWADSQEIGCGAFYCETKSPKVNY----VVCIYGPEGNLPGLSPYISGTTCSQCPSGTTC 429
            +N+ KMKW++  A+ AQ  AN C   + + A         VG N++  +    F G++ Y       W  E  +Y +++ T   F+  L        TQ+ WA++  IGCG   C       NY    VVC Y  +GN  G   Y SGTTCS CP+GTTC
Sbjct:   55 SNLLKMKWDTTLATAAQTFANTCPRGHSNAAG--------VGENLYWRWSSLPFSGMDIYGGAASVAWEQEFQQYGWTTNT---FTQALANTGIGHATQMAWANTGLIGCGVKNCGPDPELNNYNRAVVVCQYKAQGNYLGQDIYKSGTTCSACPTGTTC 203          
BLAST of peptidase inhibitor 16 vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 50.0618 bits (118), Expect = 1.479e-7
Identity = 46/147 (31.29%), Postives = 69/147 (46.94%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMF--------KRDNFVGIENYWHYESLKYDFSSKTCSGFSPCLG-YTQVIWADSQEIGCGAFYCETK-SPKVNYV-VCIYGPEGNLPGLSPYISG-TTCS 405
            A NM ++ W+ E A++AQ  A+ C    F     +      +G N+ +            +F      W  E  KY F       +SP  G Y+Q++W ++  +GCG  Y E K + K N + VC YGP GN+ G +PY  G  +CS
Sbjct:   62 AENMREIVWDDELAARAQKWADNC---QFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGD----AWSPKTGHYSQLVWGETSLVGCG--YAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCS 199          
BLAST of peptidase inhibitor 16 vs. Ensembl Fly
Match: CG4270 (gene:FBgn0031407 transcript:FBtr0077754)

HSP 1 Score: 44.669 bits (104), Expect = 5.823e-6
Identity = 37/113 (32.74%), Postives = 53/113 (46.90%), Query Frame = 1
Query:   49 AQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVG---IENYWHYESLKYDFSSKTCSGFSPCLGY-TQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPGL 375
            AQ  AN   + N     M +    + G NIF+    +  G   +E  W+ E   YDF+    + F P  G+ TQ+IW  S E+G G      ++    +VVC Y P GN+ GL
Sbjct:   61 AQEWANHLRDQN----TMAHRPNPKYGENIFLSGGMDVTGDLPVE-MWYREINSYDFNK---AQFVPTAGHFTQLIWKSSVEMGSGVARKADRT----WVVCNYNPPGNVVGL 161          
BLAST of peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: CU914487.1 (peptidase inhibitor 16-like [Source:NCBI gene;Acc:101883528])

HSP 1 Score: 75.485 bits (184), Expect = 1.548e-17
Identity = 34/92 (36.96%), Postives = 57/92 (61.96%), Query Frame = 1
Query:  181 WHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSP----KVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            W  E+L Y++++  C+    C  YTQ++WA++ +IGC +++C+T       K   ++C Y P+GN+ G  PY SG +CS+CP    C N++C
Sbjct:   57 WFNENLDYNYNTNDCAEDKMCGHYTQLVWANTTKIGCASYFCDTLEKLHFEKATLLICDYYPQGNIEGQKPYESGESCSKCPE--ECENNIC 146          
BLAST of peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 75.0998 bits (183), Expect = 1.049e-16
Identity = 54/161 (33.54%), Postives = 72/161 (44.72%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCT---NTNFSMADMKYGTFERVGSNIFM---FKRDNFVGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYC-----ETKSPKVNYV--VCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            AANM  M W++  A  A+  A  C    N +   A   + TF  VG NI+    + R         W  E   Y++++  C+    C  YTQV+WADS ++GC    C     ET    +  V  VC Y   GN  G SPY  G +CS C     C  +LC
Sbjct:   50 AANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNFAGRSPYKQGASCSGCGGSDKCERNLC 210          
BLAST of peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 74.7146 bits (182), Expect = 2.226e-16
Identity = 51/161 (31.68%), Postives = 71/161 (44.10%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCT---NTNFSMADMKYGTFERVGSNIFM---FKRDNFVGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSPKVNY-------VVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            AANM  M W++  A  A+  A  C    N +   A   + TF  VG NI+    + R         W  E   Y++++  C+    C  YTQV+WADS ++GC    C     + ++        VC Y   GN  G SPY  G +CS C     C  +LC
Sbjct:   58 AANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNFAGRSPYKQGASCSGCGGSDKCERNLC 218          
BLAST of peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: pi15a (peptidase inhibitor 15a [Source:NCBI gene;Acc:561978])

HSP 1 Score: 65.0846 bits (157), Expect = 5.634e-13
Identity = 47/166 (28.31%), Postives = 76/166 (45.78%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMF--KRDNFVGIENYWHYESLKYDFS-SKTCSGFSP-------CLGYTQVIWADSQEIGCGAFYCETKS------PKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPS--GTTCINSLC 444
            A+NM  M W+   A  A+  A+ C   +     +++     +G N+ +   +  + + +   WH E   Y F   + C+   P       C  YTQ++WA S ++GC    C   +       +  Y+VC Y P+GN  G +PY  G  CS CP   G +C N++C
Sbjct:   87 ASNMEYMVWDDTLAKTAEQWASTCIWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCSNNMC 247          
BLAST of peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 64.6994 bits (156), Expect = 8.059e-13
Identity = 47/158 (29.75%), Postives = 74/158 (46.84%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMF--KRDNFVGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCE------TKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPS--GTTCINSLC 444
            AANM  M W+   A  A+  A++C           +   + +G N+ +   +  + + +   W+ E   + + S+ CSG S C  YTQ++WA S +IGC    C       +   +   +VC Y  +GN  G +PY  G  CS CPS  G +C  + C
Sbjct:   84 AANMEYMVWDERLAKSAEFWASQCI-----WEHGPHHFLQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSYPSR-CSG-SVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQC 234          
BLAST of peptidase inhibitor 16 vs. Ensembl Xenopus
Match: ENSXETT00000036788.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464547.1:593:5826:1 gene:ENSXETG00000015856.1 transcript:ENSXETT00000036788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 2.778e-20
Identity = 53/159 (33.33%), Postives = 82/159 (51.57%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFK---RDNFVGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSPKVN--------YVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            A++M K+ W+S   + A+  A KC   +    D  +     +G N+F+      D  +G+++ WH E   Y+F++  C     C  YTQ++WA ++ +GCG  +C    PK+          +VC Y P GN  G SPY  G+ C++CPS   CI SLC
Sbjct:   53 ASDMIKLTWDSALEAMAKSYAEKCIWEHNK--DRGF-----IGENLFVMSGSSLDVALGLDD-WHKERGYYNFTTGMCQEGQMCGHYTQMVWAGTERVGCGQNFC----PKLEGVDDENMYLLVCNYEPPGNFEGESPYKEGSRCTECPSDHVCIGSLC 199          
BLAST of peptidase inhibitor 16 vs. Ensembl Xenopus
Match: ENSXETT00000021732.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:144837652:144848955:1 gene:ENSXETG00000011357.1 transcript:ENSXETT00000021732.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 8.244e-14
Identity = 54/153 (35.29%), Postives = 72/153 (47.06%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFK-RDNFVGIENYWHYESLKYDFSSKTCSGFSPCLG-YTQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPG--LSPYISGTTCSQCPSGTTCINSLCS 447
            A NM KM+WN E+A KA+I A  C N   + A   +      G N+FM      +      W  E   +DF  K    F   +G YTQ  W +S+ +GC  F C     +  Y VC Y P GN+ G   +PY  G TC  CP   +C N +C+
Sbjct:   38 AMNMLKMEWNDEAAKKAEIWARTC-NQFHNPASQHFS----CGQNLFMASYSTTWEAAVTAWFDEIKDFDFG-KGPKTFGALIGHYTQGAWYNSRMVGCYEFECPNAEYRY-YYVCHYCPAGNIEGKQFTPYKIGPTCGDCPK--SCENGVCT 181          
BLAST of peptidase inhibitor 16 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 67.3958 bits (163), Expect = 1.005e-13
Identity = 51/166 (30.72%), Postives = 75/166 (45.18%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMF--KRDNFVGIENYWHYESLKYDFSS-KTCSGFSP-------CLGYTQVIWADSQEIGCGAFYCETKS------PKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPS--GTTCINSLC 444
            AANM  M W+   A  A+  AN+C   +     M+Y     +G N+ +   +  + V +   W+ E   Y F   + C+   P       C  YTQ++WA S  IGC    C   +       + +Y+VC Y  +GN  G +PY  G  CS CP   G  C N++C
Sbjct:   76 AANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 236          
BLAST of peptidase inhibitor 16 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 67.3958 bits (163), Expect = 1.226e-13
Identity = 51/166 (30.72%), Postives = 75/166 (45.18%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMF--KRDNFVGIENYWHYESLKYDFSS-KTCSGFSP-------CLGYTQVIWADSQEIGCGAFYCE------TKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPS--GTTCINSLC 444
            AANM  M W+   A  A+  AN+C   +     M+Y     +G N+ +   +  + V +   W+ E   Y F   + C+   P       C  YTQ++WA S  IGC    C       +   + +Y+VC Y  +GN  G +PY  G  CS CP   G  C N++C
Sbjct:   81 AANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 241          
BLAST of peptidase inhibitor 16 vs. Ensembl Xenopus
Match: CRISPLD1 (cysteine-rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:100490431])

HSP 1 Score: 66.2402 bits (160), Expect = 7.199e-13
Identity = 50/164 (30.49%), Postives = 72/164 (43.90%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENYWHYESLKYDFS-SKTCSGFSP-------CLGYTQVIWADSQEIGCGAFYCETKS------PKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPS--GTTCINSLC 444
            A+NM  M W+ E    A+  A  C       AD+     + +G++   ++   +      W+ E   Y F   + C  + P       C  YTQ++WA S  IGC    C   +      PK  Y+VC Y P+GN  G +PY  G  CS CP   G  C ++LC
Sbjct:   80 ASNMEFMIWDVELERSAEAWAETCL-WEHGPADLLPVIGQNLGAHWGRYRPPTYH--VQAWYDEVRDYTFPYPQECDPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMNVWGQIWPKAIYLVCNYSPKGNWWGHAPYKHGHPCSACPPSYGGGCKDNLC 240          
BLAST of peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 104.375 bits (259), Expect = 6.482e-28
Identity = 59/155 (38.06%), Postives = 87/155 (56.13%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCET----KSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            A++M +M+W+ E A+ A+  A KC   +    + + G   R G N+F    +     + + N WH E   Y+FS+ TC     C  YTQV+W+ ++ IGCG+ +CET    +   ++ +VC Y P GN+ G  PY  GT CSQCP G +C NSLC
Sbjct:   53 ASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERG---RRGENLFAITDEGMDVPLAVGN-WHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 104.76 bits (260), Expect = 1.126e-27
Identity = 59/156 (37.82%), Postives = 87/156 (55.77%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCET----KSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLCS 447
            A++M +M+W+ E A+ A+  A KC   +    + + G   R G N+F    +     + + N WH E   Y+FS+ TC     C  YTQV+W+ ++ IGCG+ +CET    +   ++ +VC Y P GN+ G  PY  GT CSQCP G +C NSLC 
Sbjct:   53 ASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERG---RRGENLFAITDEGMDVPLAVGN-WHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLCE 200          
BLAST of peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 104.76 bits (260), Expect = 1.126e-27
Identity = 59/156 (37.82%), Postives = 87/156 (55.77%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCET----KSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLCS 447
            A++M +M+W+ E A+ A+  A KC   +    + + G   R G N+F    +     + + N WH E   Y+FS+ TC     C  YTQV+W+ ++ IGCG+ +CET    +   ++ +VC Y P GN+ G  PY  GT CSQCP G +C NSLC 
Sbjct:   53 ASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERG---RRGENLFAITDEGMDVPLAVGN-WHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLCE 200          
BLAST of peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 105.916 bits (263), Expect = 6.814e-27
Identity = 59/155 (38.06%), Postives = 87/155 (56.13%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCET----KSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            A++M +M+W+ E A+ A+  A KC   +    + + G   R G N+F    +     + + N WH E   Y+FS+ TC     C  YTQV+W+ ++ IGCG+ +CET    +   ++ +VC Y P GN+ G  PY  GT CSQCP G +C NSLC
Sbjct:   53 ASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERG---RRGENLFAITDEGMDVPLAVGN-WHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of peptidase inhibitor 16 vs. Ensembl Mouse
Match: Glipr1 (GLI pathogenesis-related 1 (glioma) [Source:MGI Symbol;Acc:MGI:1920940])

HSP 1 Score: 83.9593 bits (206), Expect = 6.763e-20
Identity = 54/151 (35.76%), Postives = 71/151 (47.02%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCT-NTNFSMADMKYGTFERVGSNIFMFKRDNFV--GIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            A NM  M W+ + A  A+     C    N  +    +  F  +G NI++     F      + W+ E   YDFS++ C     C  YTQV+WADS ++GC    C    P     +C YGP GN P   PY  G TCS CP    C+NSLC
Sbjct:   52 ARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENIWLGSLSIFSVSSAISAWYEEIKHYDFSTRKCRHV--CGHYTQVVWADSYKLGCAVQLC----PNGANFICDYGPAGNYPTW-PYKQGATCSDCPKDDKCLNSLC 195          
BLAST of peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q9ET66|PI16_MOUSE (Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN=Pi16 PE=1 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 4.766e-26
Identity = 59/155 (38.06%), Postives = 87/155 (56.13%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCET----KSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            A++M +M+W+ E A+ A+  A KC   +    + + G   R G N+F    +     + + N WH E   Y+FS+ TC     C  YTQV+W+ ++ IGCG+ +CET    +   ++ +VC Y P GN+ G  PY  GT CSQCP G +C NSLC
Sbjct:   53 ASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERG---RRGENLFAITDEGMDVPLAVGN-WHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q6UXB8|PI16_HUMAN (Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=PI16 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 6.495e-26
Identity = 59/155 (38.06%), Postives = 85/155 (54.84%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCE----TKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            A++M  M+W+ E A+ A+  A +C   +    + + G   R G N+F    +     + +E  WH+E   Y+ S+ TCS    C  YTQV+WA ++ IGCG+ +CE     +   +  +VC Y P GN+ G  PY  GT CSQCPSG  C NSLC
Sbjct:   51 ASDMLHMRWDEELAAFAKAYARQCVWGH----NKERG---RRGENLFAITDEGMDVPLAMEE-WHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLC 197          
BLAST of peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q58D34|PI16_BOVIN (Peptidase inhibitor 16 OS=Bos taurus OX=9913 GN=PI16 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 3.265e-25
Identity = 57/155 (36.77%), Postives = 85/155 (54.84%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCE----TKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            A NM +M+W+ E A+ A+  A +C   +    + + G   R G N+F    +     + +E  WH+E   Y+ S+ +C+    C  YTQV+WA ++ IGCG+ +CE     +   ++ +VC Y P GN+ G  PY  GT CSQCP G  C NSLC
Sbjct:   51 ATNMLQMRWDEELAAFAKAYAQQCVWGH----NKERG---RRGENLFAITGEGLDVPLAMEE-WHHEREHYNLSAISCAAGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIHLLVCNYEPPGNVKGQRPYQEGTPCSQCPLGYHCKNSLC 197          
BLAST of peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q32LB5|GPRL1_BOVIN (GLIPR1-like protein 1 OS=Bos taurus OX=9913 GN=GLIPR1L1 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.335e-20
Identity = 57/154 (37.01%), Postives = 79/154 (51.30%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYG---TFERVGSNIFM--FKRDNFVGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETK-SPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            AA+M  M W+   A  A+  A KC   + S +   +    TF+  G N+++            N W+ E   YDF++++CS    C  YTQV+WA S ++GC    C    SP    +VC Y P GN P +SPY +GT CS C  G TC N+LC
Sbjct:   53 AADMKYMSWDEALAKTAEAWAKKCKFIHNSCSSKSFKCHPTFQYAGENLWLGPLTISAAKFAINMWYDERKFYDFNTRSCSQV--CGHYTQVVWAYSYKVGCAVAVCPNLGSPDSALLVCNYAPAGNYPNMSPYTNGTPCSMC-QGDTCENNLC 203          
BLAST of peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q9CWG1|GLIP1_MOUSE (Glioma pathogenesis-related protein 1 OS=Mus musculus OX=10090 GN=Glipr1 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 4.731e-19
Identity = 54/151 (35.76%), Postives = 71/151 (47.02%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCT-NTNFSMADMKYGTFERVGSNIFMFKRDNFV--GIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            A NM  M W+ + A  A+     C    N  +    +  F  +G NI++     F      + W+ E   YDFS++ C     C  YTQV+WADS ++GC    C    P     +C YGP GN P   PY  G TCS CP    C+NSLC
Sbjct:   52 ARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENIWLGSLSIFSVSSAISAWYEEIKHYDFSTRKCRHV--CGHYTQVVWADSYKLGCAVQLC----PNGANFICDYGPAGNYPTW-PYKQGATCSDCPKDDKCLNSLC 195          
BLAST of peptidase inhibitor 16 vs. TrEMBL
Match: A0A2Y9SN01 (peptidase inhibitor 16 OS=Physeter macrocephalus OX=9755 GN=PI16 PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.636e-25
Identity = 61/155 (39.35%), Postives = 87/155 (56.13%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCE----TKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            AANM +M+W+ E A+ A+  A +C   +    + + G   R G N+F    +     + +E  WH+E   Y+ S+ TC+    C  YTQV+WA ++ IGCGA +CE     +   ++ +VC Y P GN+ G  PY  GT CSQCPSG  C NSLC
Sbjct:   51 AANMLQMRWDEELAAFAKAYAQQCVWGH----NKERG---RRGENLFAITDEGLDVPLAMEE-WHHEREHYNLSAATCATGQMCGHYTQVVWAKTERIGCGAHFCEKLQGVEETNIHLLVCNYEPPGNVKGQRPYQEGTPCSQCPSGYHCENSLC 197          
BLAST of peptidase inhibitor 16 vs. TrEMBL
Match: A0A3Q0E7E5 (peptidase inhibitor 16 isoform X2 OS=Tarsius syrichta OX=1868482 GN=PI16 PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 3.835e-25
Identity = 58/156 (37.18%), Postives = 86/156 (55.13%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCE----TKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLCS 447
            A++M +M+W+ E A+ A+  A +C   +    + + G   R G N+F    +     + +E  WH+E   Y+ S+  CS    C  YTQV+WA ++ IGCG+ +CE     +   ++ +VC Y P GN+ G  PY  GT CSQCPSG  C NSLC 
Sbjct:   51 ASDMLQMRWDEELAAFAKAYAQQCVWGH----NKERG---RRGENLFAITDEGLDVPLAMEE-WHHEREHYNLSAAACSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIHLLVCNYEPPGNVKGRRPYQEGTPCSQCPSGHRCENSLCE 198          
BLAST of peptidase inhibitor 16 vs. TrEMBL
Match: A0A2Y9NX44 (peptidase inhibitor 16 isoform X2 OS=Delphinapterus leucas OX=9749 GN=PI16 PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 6.876e-25
Identity = 60/155 (38.71%), Postives = 86/155 (55.48%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCE----TKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            AANM +M+W+ E A+ A+  A +C   +    + + G   R G N+F    +     + +E  WH+E   Y+ S+ TC+    C  YTQV+WA ++ IGCGA +CE     +   ++ +VC Y P GN+ G  PY  GT CSQCP G  C NSLC
Sbjct:   51 AANMLQMRWDEELAAFAKAYAQQCVWGH----NKERG---RRGENLFAITDEGLDVPLAMEE-WHHEREHYNLSAATCATGQMCGHYTQVVWAKTERIGCGAHFCEKLQGVEETDIHLLVCNYEPPGNVKGQRPYQEGTPCSQCPLGYHCENSLC 197          
BLAST of peptidase inhibitor 16 vs. TrEMBL
Match: U6DQS2 (Peptidase inhibitor 16 (Fragment) OS=Neovison vison OX=452646 GN=PI16 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 7.841e-25
Identity = 58/155 (37.42%), Postives = 83/155 (53.55%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCE----TKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            AA+M  M+W+ E A+ A+  A +C   +    + + G   R G N+F    +     + +E  WH+E   Y+ S+ TC     C  YTQV+WA ++ IGCG+ +CE     +   +  +VC Y P GN+ G  PY  GT CS CPSG  C NSLC
Sbjct:   38 AADMLHMRWDEELAAFAKAYAQQCVWGH----NKERG---RRGENLFAITEEGMDVPLAMEE-WHHEREHYNLSAATCDQGQMCGHYTQVVWAKTERIGCGSHFCEKPQGVEEINIQLLVCNYEPPGNVKGKRPYQEGTPCSLCPSGYRCENSLC 184          
BLAST of peptidase inhibitor 16 vs. TrEMBL
Match: A0A384BE46 (peptidase inhibitor 16 isoform X2 OS=Balaenoptera acutorostrata scammoni OX=310752 GN=PI16 PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 9.938e-25
Identity = 60/155 (38.71%), Postives = 86/155 (55.48%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNF---VGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCE----TKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLC 444
            AANM +M+W+ E A+ A+  A +C   +    + + G   R G N+F    +     + +E  WH+E   Y+ S+ TC+    C  YTQV+WA ++ IGCGA +CE     +   ++ +VC Y P GN+ G  PY  GT CSQCP G  C NSLC
Sbjct:   51 AANMLQMRWDEELAAFAKAYAQQCVWGH----NKERG---RRGENLFAITDEGLDVPLAMEE-WHHEREHYNLSAATCATGQMCGHYTQVVWAKTERIGCGAHFCEKLQGVEETNIHLLVCNYEPPGNVKGQRPYQEGTPCSQCPLGYHCENSLC 197          
BLAST of peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 76.6406 bits (187), Expect = 3.149e-17
Identity = 51/157 (32.48%), Postives = 74/157 (47.13%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENY---WHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSP----KVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSG-TTCINSLCS 447
            AA+M  MKW+ E A  A+  A KC      + +    +   +G N+F+      + IE     W  E   Y + + TC+    C  YTQ++WA ++E+GCG+  CET           +VC Y P GN  G  PY  G  CS+CP     C++  C 
Sbjct:   48 AADMIHMKWSGELALIAKEYATKC------IWEHNPDSQNIMGENLFI--TTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQACD 196          
BLAST of peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 75.8702 bits (185), Expect = 3.908e-17
Identity = 51/157 (32.48%), Postives = 74/157 (47.13%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENY---WHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSP----KVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSG-TTCINSLCS 447
            AA+M  MKW+ E A  A+  A KC      + +    +   +G N+F+      + IE     W  E   Y + + TC+    C  YTQ++WA ++E+GCG+  CET           +VC Y P GN  G  PY  G  CS+CP     C++  C 
Sbjct:   48 AADMIHMKWSGELALIAKEYATKC------IWEHNPDSQNIMGENLFI--TTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQACD 196          
BLAST of peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000032496.1 (pep primary_assembly:Astyanax_mexicanus-2.0:18:32321795:32342374:-1 gene:ENSAMXG00000031919.1 transcript:ENSAMXT00000032496.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 3.974e-17
Identity = 51/153 (33.33%), Postives = 76/153 (49.67%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIF----MFKRDNFVGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLCS 447
            A NM KM W+ E+A  AQ  AN C+  +   +    GT++ +G N+F    M K   +  +   WH E   Y + + + +   P   YTQV+W  S  +GCGA  C +      + VC Y   GN  G++PY  G +C+ CP    C + LC+
Sbjct:   61 ATNMLKMNWSREAAVSAQNWANTCSMVHGDPSTRMLGTYQ-MGENLFKSTGMVK---WTSVVTAWHNEVANYVYPTGS-ANTQPIGHYTQVVWYSSYSVGCGAAKCGSNY----FYVCHYYRAGNFKGVAPYTQGQSCAACPGA--CDDKLCT 202          
BLAST of peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000030308.1 (glioma pathogenesis-related protein 1-like [Source:NCBI gene;Acc:103030109])

HSP 1 Score: 75.485 bits (184), Expect = 4.962e-17
Identity = 51/161 (31.68%), Postives = 72/161 (44.72%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCT---NTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENY---WHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCE------TKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLCS 447
            AANM  M W+   A  A+  A  C    N         +  F RVG NI++    +   +E+    W+ E   Y   +++C+    C  YTQ++WA S ++GC    C       +  P+    VC YG  GN+ G  PYI G  CS C     C + LCS
Sbjct:   53 AANMRLMTWDDALAKGARSWARHCKASHNPILQHMGQAHPDFRRVGENIWLGSPYSAFTVESAIQTWNQEGADYTHRNRSCARV--CGHYTQLMWATSYKLGCAVHVCSGGIDNFSTHPQSTIFVCDYGDAGNMFGFPPYIVGLACSSC-GKEKCQDKLCS 210          
BLAST of peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 76.2554 bits (186), Expect = 5.813e-17
Identity = 51/157 (32.48%), Postives = 74/157 (47.13%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENY---WHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSP----KVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSG-TTCINSLCS 447
            AA+M  MKW+ E A  A+  A KC      + +    +   +G N+F+      + IE     W  E   Y + + TC+    C  YTQ++WA ++E+GCG+  CET           +VC Y P GN  G  PY  G  CS+CP     C++  C 
Sbjct:   48 AADMIHMKWSGELALIAKEYATKC------IWEHNPDSQNIMGENLFITT--GPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQACD 196          
BLAST of peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 2.462e-15
Identity = 51/166 (30.72%), Postives = 76/166 (45.78%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMF---KRDNFVGIENYWHYESLKYDFSSKTCSGFSP-------CLGYTQVIWADSQEIGCGAFYCETKS------PKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPS--GTTCINSLC 444
            AA+M  M W+ E A  A+  A +C       +D      + +G N+ ++   +R     ++ ++  E        K CS   P       C  YTQ++WA+S+ +GC    C   S      P   Y+VC Y P+GN  G +PY  GT CS+CP   G +C   LC
Sbjct:   24 AADMEHMSWDWELAGMAEAWAKQC-KWGHGPSDQ----LDAIGQNLAVYVGSERPLAYHVQAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYALYLVCNYSPKGNWIGEAPYRQGTPCSRCPPRYGGSCRGGLC 184          
BLAST of peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 3.330e-15
Identity = 48/164 (29.27%), Postives = 76/164 (46.34%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENYWHYESLKYDFS-SKTCSGFSP-------CLGYTQVIWADSQEIGCGAFYCETKS------PKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPS--GTTCINSLC 444
            ++NM  M W  +   +A     +C      MA + +     +G   ++  R     ++  W+ E+  Y +   + C+ + P       C  YTQ++WA +  +GC    C   +       K  Y+VC Y P+GN  GLSPY SG  CS+CP   G +C N+LC
Sbjct:   14 SSNMEYMAWVKKLIKEAARYPGRCLRLMQPMAMIHF-----LGQPHWLSHRPPSFHVQA-WYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTCYNMNVWGQIWEKAVYLVCNYSPKGNWIGLSPYKSGRACSECPPSYGGSCRNNLC 171          
BLAST of peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 61.6178 bits (148), Expect = 1.717e-12
Identity = 52/155 (33.55%), Postives = 72/155 (46.45%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRD---NFVGIENYWHYESLKYDFSSKTCSGFSPCLG-YTQVIWADSQEIGCGAFYCETKSPKVNYV-VCIYGPEGNLPGL--SPYISGTTCSQCPSGTTCINSLC 444
            A NM +M W  E+   A   AN CT  +   A  K   +   G NIFM       N+   +  W+ E +   F     S  +  +G YTQ++W +S ++GC   YC        Y+ VC Y P GNL      PY  GT+C+ CP    C+N+LC
Sbjct:   62 AGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRKTTQWT-CGENIFMSSAPFTWNYAIRD--WYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAKYLYVCHYCPMGNLNTRINRPYDLGTSCASCPKN--CVNNLC 211          
BLAST of peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: CLEC18A (C-type lectin domain family 18 member A [Source:HGNC Symbol;Acc:HGNC:30388])

HSP 1 Score: 49.2914 bits (116), Expect = 7.347e-8
Identity = 19/66 (28.79%), Postives = 31/66 (46.97%), Query Frame = 1
Query:  157 NFVGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGP 354
            +F  +   W  E   YD++   C+    C  YTQ++WA +  +GC   +C     +V    C+Y P
Sbjct:  139 SFASVLASWFSEGQNYDYARPGCAHNRTCRHYTQMVWASASRVGCAKRWCRDPGSRVEAFACVYLP 204          
BLAST of peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000359.1 (pep scaffold:Pmarinus_7.0:GL487788:450:5784:1 gene:ENSPMAG00000000319.1 transcript:ENSPMAT00000000359.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 2.085e-7
Identity = 27/68 (39.71%), Postives = 36/68 (52.94%), Query Frame = 1
Query:  256 QVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPG--LSPYISGTTCSQCPSGTTCINSLCS*F 453
            Q++W  S +IGC   +C T   K  + VC Y P GNL      PY  G+ C+ CP   +C+N LC  F
Sbjct:   49 QLVWYSSFQIGCSVNFCATA--KKYFYVCHYCPAGNLNTRVFRPYDKGSACTSCPK--SCVNKLCGEF 112          
BLAST of peptidase inhibitor 16 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 52.7582 bits (125), Expect = 3.240e-9
Identity = 34/83 (40.96%), Postives = 45/83 (54.22%), Query Frame = 1
Query:  127 GSNIFMFKRDNFVGIENYWHYESLKYDFSSKTCSGFSPCLG-YTQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPG 372
            G N+ +   D   G  + W+ E  KY++S+    GFS   G +TQV+W  + EIGCG  YC T     NY+VC Y P GN  G
Sbjct:   77 GENLALGYTD--TGAVDAWYGEISKYNYSNP---GFSESTGHFTQVVWKSTAEIGCGYKYCGTT--WNNYIVCSYNPPGNYLG 152          
BLAST of peptidase inhibitor 16 vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 42.743 bits (99), Expect = 5.932e-6
Identity = 26/67 (38.81%), Postives = 36/67 (53.73%), Query Frame = 1
Query:  175 NYWHYESLKYDFSSKTCSGFSPCLGY-TQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPG 372
            + W+ E   YDFS+    GFS   G+ TQV+W  + ++GCG   C       +YV+C Y P GN  G
Sbjct:  228 DAWYNEISNYDFSNP---GFSSNTGHFTQVVWKSTTQVGCGIKTC--GGAWGDYVICSYDPAGNYEG 289          
BLAST of peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 50.8322 bits (120), Expect = 8.259e-9
Identity = 40/124 (32.26%), Postives = 58/124 (46.77%), Query Frame = 1
Query:   19 MKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIE--NYWHYESLKYDFSSKTCSGFSPCLGY-TQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPGLSP 381
            +KWN+  AS+AQ  A      N     +++ +    G +I         G +  + W+ E  KY F +    GFS   G+ TQV+WA S E+G G     T S   ++VV  Y P GN+ G  P
Sbjct:   22 LKWNARLASEAQSWAENLAQRN----AIQHSSSREYGESIAYMSGAVLTGRKATDMWYGEVDKYRFEN---PGFSTSSGHFTQVVWAGSTEMGAGK---ATSSSGAHFVVARYTPPGNVMGQFP 135          
BLAST of peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO35287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLZ5])

HSP 1 Score: 52.373 bits (124), Expect = 1.224e-8
Identity = 37/126 (29.37%), Postives = 55/126 (43.65%), Query Frame = 1
Query:   19 MKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENY---WHYESLKYDFSSKTCSGFSPCLG-----YTQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPG 372
            +KW+ + A KAQ +A      +    D  Y   E  G NI +FK D  +  E     W+ E   Y F        SP LG     ++Q++W  ++ +G G       +    YVV +Y P GN+ G
Sbjct:  721 LKWSDKLAKKAQKLAQSMAADSNHTDDEAYSQNELPGENIAVFKHDYDIAAERATRKWYEEVEGYRFG-------SPVLGEATKHFSQLVWKGTKSVGIGV---ARGARDRTYVVALYDPPGNVEG 836          
BLAST of peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO49309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH91])

HSP 1 Score: 49.2914 bits (116), Expect = 5.550e-8
Identity = 39/122 (31.97%), Postives = 60/122 (49.18%), Query Frame = 1
Query:   19 MKWNSESASKAQIIANKCTNTNFSMADMKYGTFER--VGSNIFMFK-RDNFVGIE--NYWHYESLKYDFSSKTCSGFSPCLGY-TQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNL 366
            +KW+ + A  AQ  A K          +K+ T ER   G N+ MF  +    G E  N W+ ES  Y+F+     G+    G+ TQV+W  ++E+G G    +T   ++ +VV  Y P GN+
Sbjct:   61 LKWSHDLARGAQAWAEKLARER----TLKHSTRERGEDGENLAMFTGKYESAGEEATNMWYEESAYYNFNR---PGYQSNTGHFTQVVWKGTKELGLGR--AKTPDGRLTFVVGRYRPSGNM 173          
BLAST of peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO37114 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGM4])

HSP 1 Score: 47.3654 bits (111), Expect = 1.923e-7
Identity = 36/125 (28.80%), Postives = 63/125 (50.40%), Query Frame = 1
Query:   16 KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMF---KRDNFVGIENY--WHYESLKYDFSSKTCSGFSPCLGY-TQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPG 372
            +M W++  A+ AQ  A+K + T+    D      +  G N+  F   K +N   ++ +  W+ ES KYD+++   + FS   G+ TQ++W  +Q++G G    +       YVV  + P GN+ G
Sbjct:   20 EMTWSASLAADAQKWADKLSQTDAFKHDYASINSKSQGENLAYFTPQKPNNTAIMDAFDAWYDESSKYDYAN---AKFSKETGHFTQLVWKATQKMGIGT--AKNAKGDKEYVVARFSPAGNIKG 139          
BLAST of peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO48663 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI98])

HSP 1 Score: 46.595 bits (109), Expect = 3.397e-7
Identity = 39/122 (31.97%), Postives = 56/122 (45.90%), Query Frame = 1
Query:   19 MKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFK-RDNFVGIE--NYWHYESLKYDF---SSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNL 366
            +KW+ E A +AQ  A K      SM      +    G N+ MF  R +  G      W+ ES KY F    S+  +G      +TQ++W  S+E+G G    +T   +  YVV  Y P GN+
Sbjct:   23 LKWSDELAREAQYYAEKLAQQR-SMQHSSKCSRNDAGENLAMFSGRYDTAGDMACEMWYEESKKYSFVRGGSQMGTGH-----FTQMVWKGSKELGMGR--AKTSDGRCTYVVARYQPAGNI 136          
BLAST of peptidase inhibitor 16 vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 77.7962 bits (190), Expect = 3.158e-17
Identity = 51/155 (32.90%), Postives = 70/155 (45.16%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIF--MFKRDNFVGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKS----PKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSG-TTCINSLC 444
            AA M  +KW+      A+  A KC   + +         E  G N+F    K D    +E  W  E L Y + + +C     C  YTQ++WAD+  +GC   +C T        V+Y+VC Y P GN     PY+ G  CS+CP     C N LC
Sbjct:   80 AAAMLPLKWDGNLKLVAEGYAAKCIWEHNT-------ELEDTGENLFAGTGKLDLSEAVEK-WFLERLDYSYENNSCDEDKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWNNVSYLVCNYFPAGNYDDERPYVEGDWCSRCPEDLDVCQNHLC 226          
BLAST of peptidase inhibitor 16 vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 65.855 bits (159), Expect = 5.252e-13
Identity = 50/167 (29.94%), Postives = 72/167 (43.11%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENYWHYESLKYDFSSKTCSGFSP-------CLGYTQVIWADSQEIGCGAFYCETKSPKVN----------YVVCIYGPEGNLPGLSPYISGTTCSQCPS--GTTCINSLC 444
            AANM  M W+ E    A   A +C        D+     + +  +   ++   F     Y   +   Y + S+ C+ + P       C  YTQ++WA +  +GC    C    PK+N          Y+VC Y P+GN  G +PY  G  CSQCP   G  C N+LC
Sbjct:   94 AANMEHMVWDDELERSATQWAEEC-RWEHGPQDLLMSIGQNLAVHWGRYRSPAFHVQAWYDEVKDYTYPYPSE-CNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVC----PKMNVWGEIWETAVYLVCNYSPKGNWIGEAPYRHGRPCSQCPPSFGGGCRNNLC 254          
BLAST of peptidase inhibitor 16 vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 64.6994 bits (156), Expect = 1.473e-12
Identity = 50/164 (30.49%), Postives = 72/164 (43.90%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENYWHYESLKYDFS-SKTCSGFSP-------CLGYTQVIWADSQEIGCGAFYCETKS------PKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPS--GTTCINSLC 444
            A+NM  M W++E    A+  A  C       A +     + +G++   ++   F      W+ E   Y F   + C+ + P       C  YTQ++WA S  IGC    C           K  Y+VC Y P+GN  G +PY  GT CS CP   G  C ++LC
Sbjct:   79 ASNMEYMMWDTELERSAEEWAETCL-WEHGPASLLPQIGQNLGAHWGRYQPPTF--HVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLC 239          
BLAST of peptidase inhibitor 16 vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 64.6994 bits (156), Expect = 1.673e-12
Identity = 50/164 (30.49%), Postives = 72/164 (43.90%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENYWHYESLKYDFS-SKTCSGFSP-------CLGYTQVIWADSQEIGCGAFYCETKS------PKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPS--GTTCINSLC 444
            A+NM  M W++E    A+  A  C       A +     + +G++   ++   F      W+ E   Y F   + C+ + P       C  YTQ++WA S  IGC    C           K  Y+VC Y P+GN  G +PY  GT CS CP   G  C ++LC
Sbjct:  107 ASNMEYMMWDTELERSAEEWAETCL-WEHGPASLLPQIGQNLGAHWGRYQPPTF--HVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLC 267          
BLAST of peptidase inhibitor 16 vs. Ensembl Medaka
Match: pi15a (peptidase inhibitor 15 [Source:NCBI gene;Acc:101173911])

HSP 1 Score: 62.7734 bits (151), Expect = 4.088e-12
Identity = 46/166 (27.71%), Postives = 76/166 (45.78%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMF--KRDNFVGIENYWHYESLKYDFS-SKTCSGFSP-------CLGYTQVIWADSQEIGCGAFYCETKS------PKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPS--GTTCINSLC 444
            A+NM  M W+   A  A+  A+ C   +     +++     +G N+ +   +  + + +   W+ E   Y F   + C+   P       C  YTQ++WA S ++GC    C   +       +  Y+VC Y P+GN  G +PY  G  CS CP   G +C N++C
Sbjct:   84 ASNMEYMVWDETLAKTAEDWAHACLWEHGPSHLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLRCYGPMCTHYTQMVWATSNKVGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSACPPSYGGSCSNNMC 244          
BLAST of peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000067479.1 (SMESG000067479.1)

HSP 1 Score: 306.22 bits (783), Expect = 5.425e-108
Identity = 146/149 (97.99%), Postives = 147/149 (98.66%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLCS 447
            AANM KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIF FKRDNFVGIENYWHYESLKYDFSSKTCSGFSPCLGYTQV+WADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLCS
Sbjct:   52 AANMLKMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFKFKRDNFVGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVVWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLCS 200          
BLAST of peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000001227.1 (SMESG000001227.1)

HSP 1 Score: 150.984 bits (380), Expect = 1.065e-46
Identity = 81/149 (54.36%), Postives = 97/149 (65.10%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLCS 447
            AANM KMKWNSESA+KAQ  AN C  ++ ++ D KYG FE VG NI +F   N V     W+ E+  Y FS+ +CS    C  +TQV+WADSQE+GCGA  C+     V  +VC YGP GN    SPYISG  CS+CPSGT C NSLCS
Sbjct:   52 AANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCS-LKTCGHFTQVLWADSQELGCGASNCKYLKRNVILLVCNYGPGGNFNKQSPYISGPACSKCPSGTKCANSLCS 199          
BLAST of peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072936.1 (SMESG000072936.1)

HSP 1 Score: 146.362 bits (368), Expect = 3.569e-45
Identity = 74/153 (48.37%), Postives = 102/153 (66.67%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENYWHYESLK----YDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLCS 447
            AANM KMKW++ESASKAQ +A++C   N +M D+ YGT++ VG+N  +   D ++    Y  YE L     YD S+ TC   + C  + Q++WADSQE+GCG   C+T   K +Y++CIYGP G++    PYISG  CSQCP GT+C++SLCS
Sbjct:   25 AANMLKMKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPAYKFYELLDDFFYYDMSTNTCKSPT-CEHHAQMMWADSQELGCGMSNCDTSQIKQSYLICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 176          
BLAST of peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072936.1 (SMESG000072936.1)

HSP 1 Score: 146.747 bits (369), Expect = 5.048e-45
Identity = 76/154 (49.35%), Postives = 103/154 (66.88%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENYWHYESLK----YDFSSKTCSGFSP-CLGYTQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLCS 447
            AANM KMKW++ESASKAQ +A++C   N +M D+ YGT++ VG+N  +   D ++    Y  YE L     YD S+ TC   SP C  + Q++WADSQE+GCG   C+T   K +Y++CIYGP G++    PYISG  CSQCP GT+C++SLCS
Sbjct:   52 AANMLKMKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPAYKFYELLDDFFYYDMSTNTCK--SPTCEHHAQMMWADSQELGCGMSNCDTSQIKQSYLICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 203          
BLAST of peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072936.1 (SMESG000072936.1)

HSP 1 Score: 146.747 bits (369), Expect = 6.741e-45
Identity = 76/154 (49.35%), Postives = 103/154 (66.88%), Query Frame = 1
Query:    1 AANM*KMKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVGIENYWHYESLK----YDFSSKTCSGFSP-CLGYTQVIWADSQEIGCGAFYCETKSPKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLCS 447
            AANM KMKW++ESASKAQ +A++C   N +M D+ YGT++ VG+N  +   D ++    Y  YE L     YD S+ TC   SP C  + Q++WADSQE+GCG   C+T   K +Y++CIYGP G++    PYISG  CSQCP GT+C++SLCS
Sbjct:   56 AANMLKMKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPAYKFYELLDDFFYYDMSTNTCK--SPTCEHHAQMMWADSQELGCGMSNCDTSQIKQSYLICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 207          
The following BLAST results are available for this feature:
BLAST of peptidase inhibitor 16 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PI161.352e-2638.06peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI161.352e-2638.06peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI161.352e-2638.06peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
GLIPR1L12.159e-1934.42GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
GLIPR1L12.519e-1934.42GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-53.927e-1835.90SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-147.310e-1835.90SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-22.421e-1635.71SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-22.421e-1635.71SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-35.737e-1634.38SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG84831.479e-731.29gene:FBgn0038126 transcript:FBtr0082782[more]
CG42705.823e-632.74gene:FBgn0031407 transcript:FBtr0077754[more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CU914487.11.548e-1736.96peptidase inhibitor 16-like [Source:NCBI gene;Acc:... [more]
glipr1a1.049e-1633.54GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
glipr1a2.226e-1631.68GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
pi15a5.634e-1328.31peptidase inhibitor 15a [Source:NCBI gene;Acc:5619... [more]
r3hdml8.059e-1329.75R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000036788.12.778e-2033.33pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
ENSXETT00000021732.18.244e-1435.29pep primary_assembly:Xenopus_tropicalis_v9.1:5:144... [more]
R3HDML1.005e-1330.72R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
R3HDML1.226e-1330.72R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
CRISPLD17.199e-1330.49cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi166.482e-2838.06peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi161.126e-2737.82peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi161.126e-2737.82peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi166.814e-2738.06peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Glipr16.763e-2035.76GLI pathogenesis-related 1 (glioma) [Source:MGI Sy... [more]
back to top
BLAST of peptidase inhibitor 16 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ET66|PI16_MOUSE4.766e-2638.06Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN... [more]
sp|Q6UXB8|PI16_HUMAN6.495e-2638.06Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q58D34|PI16_BOVIN3.265e-2536.77Peptidase inhibitor 16 OS=Bos taurus OX=9913 GN=PI... [more]
sp|Q32LB5|GPRL1_BOVIN1.335e-2037.01GLIPR1-like protein 1 OS=Bos taurus OX=9913 GN=GLI... [more]
sp|Q9CWG1|GLIP1_MOUSE4.731e-1935.76Glioma pathogenesis-related protein 1 OS=Mus muscu... [more]
back to top
BLAST of peptidase inhibitor 16 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Y9SN011.636e-2539.35peptidase inhibitor 16 OS=Physeter macrocephalus O... [more]
A0A3Q0E7E53.835e-2537.18peptidase inhibitor 16 isoform X2 OS=Tarsius syric... [more]
A0A2Y9NX446.876e-2538.71peptidase inhibitor 16 isoform X2 OS=Delphinapteru... [more]
U6DQS27.841e-2537.42Peptidase inhibitor 16 (Fragment) OS=Neovison viso... [more]
A0A384BE469.938e-2538.71peptidase inhibitor 16 isoform X2 OS=Balaenoptera ... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000031557.13.149e-1732.48peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000036030.13.908e-1732.48peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000032496.13.974e-1733.33pep primary_assembly:Astyanax_mexicanus-2.0:18:323... [more]
ENSAMXT00000030308.14.962e-1731.68glioma pathogenesis-related protein 1-like [Source... [more]
ENSAMXT00000029824.15.813e-1732.48peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.12.462e-1530.72pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
ENSPMAT00000002250.13.330e-1529.27pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
CRISP31.717e-1233.55cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
CLEC18A7.347e-828.79C-type lectin domain family 18 member A [Source:HG... [more]
ENSPMAT00000000359.12.085e-739.71pep scaffold:Pmarinus_7.0:GL487788:450:5784:1 gene... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PRY33.240e-940.96Cell wall-associated protein involved in export of... [more]
PRY15.932e-638.81Sterol binding protein involved in the export of a... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO488818.259e-932.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352871.224e-829.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493095.550e-831.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371141.923e-728.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486633.397e-731.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000023160.23.158e-1732.90peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
crispld25.252e-1329.94cysteine rich secretory protein LCCL domain contai... [more]
crispld1a1.473e-1230.49cysteine rich secretory protein LCCL domain contai... [more]
crispld1a1.673e-1230.49cysteine rich secretory protein LCCL domain contai... [more]
pi15a4.088e-1227.71peptidase inhibitor 15 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of peptidase inhibitor 16 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067479.15.425e-10897.99SMESG000067479.1[more]
SMESG000001227.11.065e-4654.36SMESG000001227.1[more]
SMESG000072936.13.569e-4548.37SMESG000072936.1[more]
SMESG000072936.15.048e-4549.35SMESG000072936.1[more]
SMESG000072936.16.741e-4549.35SMESG000072936.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006444 ID=SMED30006444|Name=peptidase inhibitor 16|organism=Schmidtea mediterranea sexual|type=transcript|length=469bp
GCAGCAAATATGTGAAAAATGAAATGGAACTCTGAATCCGCATCGAAGGC
ACAAATAATAGCGAACAAATGCACCAATACAAACTTCAGTATGGCGGATA
TGAAATATGGAACTTTCGAACGGGTTGGAAGTAATATTTTTATGTTTAAA
CGTGATAATTTTGTTGGTATAGAAAATTATTGGCATTACGAAAGTCTTAA
ATACGATTTTTCAAGCAAAACGTGCAGTGGTTTTTCTCCATGTCTTGGTT
ATACTCAAGTTATATGGGCTGATTCTCAAGAAATTGGATGTGGTGCTTTT
TACTGCGAAACTAAAAGTCCGAAGGTAAATTATGTTGTCTGCATTTACGG
GCCAGAAGGAAATTTGCCAGGCCTATCTCCATATATAAGCGGAACAACTT
GCTCGCAATGTCCAAGCGGAACAACATGTATTAATTCGCTGTGCAGTTGA
TTTTGATTTTAAGTTTTTG
back to top

protein sequence of SMED30006444-orf-1

>SMED30006444-orf-1 ID=SMED30006444-orf-1|Name=SMED30006444-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
MKWNSESASKAQIIANKCTNTNFSMADMKYGTFERVGSNIFMFKRDNFVG
IENYWHYESLKYDFSSKTCSGFSPCLGYTQVIWADSQEIGCGAFYCETKS
PKVNYVVCIYGPEGNLPGLSPYISGTTCSQCPSGTTCINSLCS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0061052negative regulation of cell growth involved in cardiac muscle cell development
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002413V5_allergen-like
IPR001283CRISP-related
IPR014044CAP_domain