EF-hand domain-containing family member B

Overview
NameEF-hand domain-containing family member B
Smed IDSMED30006438
Uniprot Best hitEF-hand domain-containing family member B OS=Homo sapiens OX=9606 GN=EFHB PE=1 SV=4 (E=2.09169e-85)
Length (bp)1833
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand domain-containing family member B (SMED30006438) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand domain-containing family member B (SMED30006438) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand domain-containing family member B (SMED30006438) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand domain-containing family member B (SMED30006438) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006438

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30006438SMESG000077905.1 SmedASXL_010993SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30006438SMESG000077905.1 dd_Smed_v4_11909_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006438SMESG000077905.1 dd_Smed_v4_11909_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30006438SMESG000077905.1 dd_Smed_v4_11909_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30006438SMESG000077905.1 dd_Smed_v4_11909_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand domain-containing family member B vs. Ensembl Human
Match: EFHB (EF-hand domain family member B [Source:HGNC Symbol;Acc:HGNC:26330])

HSP 1 Score: 288.5 bits (737), Expect = 1.318e-87
Identity = 170/556 (30.58%), Postives = 286/556 (51.44%), Query Frame = 2
Query:  110 YDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDICHEDNK--INWRLFTDSFNWQERMDFDKIEPDYSYSG------DPCESN----------------LADWNIQNRLQREVER---EIGNW--TTSNSMYNGGGVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISN 1690
            Y GK+ DR P +P+AGKV  V G   A CL     + +TP    +   +   P    R F+ +  DPQ+  A  + HG        A+ L+NP P + +QQ+  DK ESIY + R  PLG+  D     P+G D   T FG   +   +AK+++NP   Y E+  +    HD Y+ +H  +Y GE   R Y+ + +F +   +G+PTP   +G      + W  +L  ++    + KR DDF+EK+  ++G  LDP+ +TMN+ P+  FG    P+ Y V DL+  R+P  +  G +R+RA++ A+R HL+ ++Y  +  L  A +  D +  G + +++++  C Q +L +D +L++Q+FD C  DN   IN+  F +  NW+++M   + E      G      +P E+N                L +     +  R + R   ++ N+  TTS+ +    G +    +P  G  T+R+D+P P+IR+ +D+T YG+EG A  ++ P+I  + G+ E D    RSKEE+  +   I    ++  F+ +W +++
Sbjct:  120 YSGKFFDRTPCWPSAGKVIPV-GYRVATCLTEKLPRLITPPEAKKYFNFRYPPAGVERVFYGRANDPQI--APYLTHGIRSKISVLANTLINPQPITTFQQKIKDKKESIYLSNRRAPLGKSHDQAPGLPKGMDTTNTTFGTAVIKEYSAKDVVNPPKSYEEVFKEGNEGHDLYVVSHNDYYAGEAKNRKYNPS-SFHRCSVYGVPTPHFNDGRAMAKSLYWLHELQMKRGAKFVSKRADDFKEKFQHKLGRVLDPIAETMNVPPDCTFGACLRPEEYGVGDLIHNRLPDEYLRGKDRQRALIAAVRHHLKKVNYQKFDTLLAAFRHYDKKGDGMIDKDELQEACDQANLSLDDKLLDQLFDYCDVDNDGFINYLEFANFLNWKDKMLLKEYEERVIIKGRKPDCVNPTEANVEEPEQTLLIKPEDIVLKEAGSTEKTLRTLLRPSDKVSNYYKTTSSEINAIVGAIPSTCYPICGVPTIRSDIPAPRIRRISDRTNYGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKLSDEEFENVWNLAS 671          
BLAST of EF-hand domain-containing family member B vs. Ensembl Human
Match: EFHB (EF-hand domain family member B [Source:HGNC Symbol;Acc:HGNC:26330])

HSP 1 Score: 287.345 bits (734), Expect = 4.356e-86
Identity = 171/573 (29.84%), Postives = 291/573 (50.79%), Query Frame = 2
Query:  110 YDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDICHEDNK--INWRLFTDSFNWQERMDFDKIEPDYSYSG------DPCESN----------------LADWNIQNRLQREVER---EIGNW--TTSNSMYNGGGVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKAL 1741
            Y GK+ DR P +P+AGKV  V G   A CL     + +TP    +   +   P    R F+ +  DPQ+  A  + HG        A+ L+NP P + +QQ+  DK ESIY + R  PLG+  D     P+G D   T FG   +   +AK+++NP   Y E+  +    HD Y+ +H  +Y GE   R Y+ + +F +   +G+PTP   +G      + W  +L  ++    + KR DDF+EK+  ++G  LDP+ +TMN+ P+  FG    P+ Y V DL+  R+P  +  G +R+RA++ A+R HL+ ++Y  +  L  A +  D +  G + +++++  C Q +L +D +L++Q+FD C  DN   IN+  F +  NW+++M   + E      G      +P E+N                L +     +  R + R   ++ N+  TTS+ +    G +    +P  G  T+R+D+P P+IR+ +D+T YG+EG A  ++ P+I  + G+ E D    RSKEE+  +   I    ++  F+ +W +++       + ++  +  L
Sbjct:  250 YSGKFFDRTPCWPSAGKVIPV-GYRVATCLTEKLPRLITPPEAKKYFNFRYPPAGVERVFYGRANDPQI--APYLTHGIRSKISVLANTLINPQPITTFQQKIKDKKESIYLSNRRAPLGKSHDQAPGLPKGMDTTNTTFGTAVIKEYSAKDVVNPPKSYEEVFKEGNEGHDLYVVSHNDYYAGEAKNRKYNPS-SFHRCSVYGVPTPHFNDGRAMAKSLYWLHELQMKRGAKFVSKRADDFKEKFQHKLGRVLDPIAETMNVPPDCTFGACLRPEEYGVGDLIHNRLPDEYLRGKDRQRALIAAVRHHLKKVNYQKFDTLLAAFRHYDKKGDGMIDKDELQEACDQANLSLDDKLLDQLFDYCDVDNDGFINYLEFANFLNWKDKMLLKEYEERVIIKGRKPDCVNPTEANVEEPEQTLLIKPEDIVLKEAGSTEKTLRTLLRPSDKVSNYYKTTSSEINAIVGAIPSTCYPICGVPTIRSDIPAPRIRRISDRTNYGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKLSDEEFENVWNLASKKHHRGEVCVENIRNVL 818          
BLAST of EF-hand domain-containing family member B vs. Ensembl Human
Match: EFHB (EF-hand domain family member B [Source:HGNC Symbol;Acc:HGNC:26330])

HSP 1 Score: 194.126 bits (492), Expect = 2.472e-53
Identity = 116/351 (33.05%), Postives = 180/351 (51.28%), Query Frame = 2
Query:  110 YDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLD-PENTGYLTEEQVRLLCQQFDL 1159
            Y GK+ DR P +P+AGKV  V G   A CL     + +TP    +   +   P    R F+ +  DPQ+  A  + HG        A+ L+NP P + +QQ+  DK ESIY + R  PLG+  D     P+G D   T FG   +   +AK+++NP   Y E+  +    HD Y+ +H  +Y GE   R Y+ + +F +   +G+PTP   +G      + W  +L  ++    + KR DDF+EK+  ++G  LDP+ +TMN+ P+  FG    P+ Y V DL+  R+P  +  G +R+RA++ A+R HL+ ++Y  +  L  A +  D   N G L         QQF +
Sbjct:  250 YSGKFFDRTPCWPSAGKVIPV-GYRVATCLTEKLPRLITPPEAKKYFNFRYPPAGVERVFYGRANDPQI--APYLTHGIRSKISVLANTLINPQPITTFQQKIKDKKESIYLSNRRAPLGKSHDQAPGLPKGMDTTNTTFGTAVIKEYSAKDVVNPPKSYEEVFKEGNEGHDLYVVSHNDYYAGEAKNRKYNPS-SFHRCSVYGVPTPHFNDGRAMAKSLYWLHELQMKRGAKFVSKRADDFKEKFQHKLGRVLDPIAETMNVPPDCTFGACLRPEEYGVGDLIHNRLPDEYLRGKDRQRALIAAVRHHLKKVNYQKFDTLLAAFRHYDKASNGGELFGNAWAYRSQQFGV 596          
BLAST of EF-hand domain-containing family member B vs. Ensembl Human
Match: EFHB (EF-hand domain family member B [Source:HGNC Symbol;Acc:HGNC:26330])

HSP 1 Score: 138.272 bits (347), Expect = 2.128e-36
Identity = 84/278 (30.22%), Postives = 133/278 (47.84%), Query Frame = 2
Query:  110 YDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLY 943
            Y GK+ DR P +P+                       +TP    +   +   P    R F+ +  DPQ+  A  + HG        A+ L+NP P + +QQ+  DK ESIY + R  PLG+  D     P+G D   T FG   +   +AK+++NP   Y E+  +    HD Y+ +H  +Y GE   R Y+ + +F +   +G+PTP   +G      + W  +L  ++    + KR DDF+EK+  ++G  LDP+ +TMN+ P+  FG    P+ Y
Sbjct:    8 YSGKFFDRTPCWPSL----------------------ITPPEAKKYFNFRYPPAGVERVFYGRANDPQI--APYLTHGIRSKISVLANTLINPQPITTFQQKIKDKKESIYLSNRRAPLGKSHDQAPGLPKGMDTTNTTFGTAVIKEYSAKDVVNPPKSYEEVFKEGNEGHDLYVVSHNDYYAGEAKNRKYNPS-SFHRCSVYGVPTPHFNDGRAMAKSLYWLHELQMKRGAKFVSKRADDFKEKFQHKLGRVLDPIAETMNVPPDCTFGACLRPEEY 260          
BLAST of EF-hand domain-containing family member B vs. Ensembl Zebrafish
Match: efhb (EF-hand domain family, member B [Source:ZFIN;Acc:ZDB-GENE-091001-1])

HSP 1 Score: 257.299 bits (656), Expect = 2.900e-77
Identity = 154/569 (27.07%), Postives = 278/569 (48.86%), Query Frame = 2
Query:  128 DRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDIC--HEDNKINWRLFTDSFNWQERMDFDKIEPD--------YSYSGDPCESNLADWNIQNRLQREVERE--------------------IGNWTTSNSMYNG-GGVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKAL 1741
            D FP    AGK+  + G+    CL+  T + +TP    +  +    P+   R FH +  DP +  A T++HG       +A  ++NP PK+ +Q+R     E  + T +  PLG+        P   +  +T FG+  +   N  E+INP     E+  +    H  Y+R+H  ++ GE   R Y+ + ++ +   FG+PTP   +G     C+ W  D        L+ KR DDFREK  PQIG   DP+ +T+N+  +H FG    PD +   DL+    P  +  G  R+RA++ A+R HL+  +Y  +  L +A +  D +  G + +E +R  C QF++ +   L++++ D C  H+D  I++  F++  NW+++M   ++E D        ++   +   ++L + +    L +  + E                      ++ TSNS+ N   G L    +   G  ++R DLP P+I+  +D+T YGD+  AR +++P + + +G+ E +   PR+KEE+  +F+ +  N  +  F+  W++++       ++++ F+  L
Sbjct:   15 DAFPSIRAAGKLIPI-GDRTKSCLQEITPRTVTPPMVRKFVHSLRPPVGSVRVFHGRANDPDI--ATTLVHGVNTISSINAGSVINPAPKTRFQERLRQLQEISHATNQKAPLGRSQVQGPGLPSWLNPEKTTFGVTTLCFSNGGEVINPPKTADEVKREAGEGHQLYIRSHGSYFVGEHVDRKYNWS-HYARESRFGVPTPHYNDGRNISKCLHWPCDSLMHNSAKLVPKRCDDFREKPHPQIGKVHDPIAETLNVPSDHTFGVLMKPDSFGAVDLLYQTPPGEYLKGKERQRALVSAVRQHLKKSNYQKFSSLLEAFRYYDKKGLGKIDKEDLREACHQFNMIISDPLLDELMDYCDVHKDGLIDFVEFSNFLNWKDKMPISRMEQDILTGERVAWTAPANMHRTHLPESSTVKPLVKPEDLEPVEEGSTKKTPKTLSRPRTAQSDFITSNSLINAVVGGLSTSNYHTYGVPSIRADLPAPRIKSISDRTNYGDQATARDLLHPPLHSLYGVHEQEFFSPRTKEEIAQIFQKVGLNTADEMFEEAWRLASMRDPDGDVSVESFRNVL 579          
BLAST of EF-hand domain-containing family member B vs. Ensembl Xenopus
Match: npc1 (NPC intracellular cholesterol transporter 1 [Source:Xenbase;Acc:XB-GENE-984654])

HSP 1 Score: 235.728 bits (600), Expect = 5.066e-69
Identity = 163/556 (29.32%), Postives = 263/556 (47.30%), Query Frame = 2
Query:  104 TAYDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPM-EKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDICH--EDNKINWRLFTDSFNWQERMDFDKIE--------------PDYSY----------SGDPCESNLADWNIQNRLQREVEREIGNWTTSNSMYNGGGVLMGKVFPA---LGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQ 1681
            + Y G++ DR P   +AGK+ F  GE AA CL     +  TP P ++    T  P     R F+ +  D ++E   T  HG        A  L+N  PK+ +Q R ND+ E+IY + + +PLG+ PD T A P   D  E  FG K+  + +A  +INP   + EL  + +  H  Y+ TH  +  GE   R Y     ++K   FGI TP   +G      +RW  +   ++   ++ K +DDFRE++  Q+G   DP+ DTM + P+H FG  +  + Y V+D +       F  G ++ RA+  A+  H ++ +Y ++  L +A +  D    G +T+E+++  C QF L +   L E +   C   +D  IN+  F    NW+++M  +++E              PD S           S   C    A       L +     + N+ T++S  +   V+ G  F +    G  ++RTD+  P  R+ TDKT YGDE     ++ PS+ ++H I E +    RSK+E+  +   I    +   F+ +WQ
Sbjct:    6 SIYQGRFIDRSPSIRSAGKL-FPVGERAASCLVEIHPRTNTP-PVVQKFLNTRRPNPGARRLFYGKANDSRVEDYVT--HGVSTRPSLSAGALINLPPKTFFQHRLNDRKEAIYTSHQQRPLGKQPDQTKALPATIDLNEMTFGQKSKRDISASTIINPPKSFQELKEESQKGHQLYVVTHNDYDVGEPKDRKYDCT-TYRKNKRFGIETPHFNDGRHVARSLRWLYETKMKERANIVPKGVDDFRERFQHQLGKVCDPIADTMKVPPDHTFGIPTQHEKYGVKDALDFTTAKNFLCGSDKHRAIRAAVHQHFKSTNYENFGLLLEAFRYYDKNGIGKITKEELKSTCVQFGLDLHIDLFEFILQYCEVDKDGLINFADFIRFVNWKDKMAVEELEERLYRHGKKHVTWSPDSSIKRHQERTDESSETECPKEAASEQPLKILSKVANEALDNYRTTSSQIS--AVVGGPGFHSYRPCGLPSIRTDITPPHFRRLTDKTNYGDESSVFGLLCPSVFSQHMIYEDEFFKSRSKKEIAQILNNIGVFISGEDFEELWQ 554          
BLAST of EF-hand domain-containing family member B vs. Ensembl Mouse
Match: Efhb (EF hand domain family, member B [Source:MGI Symbol;Acc:MGI:3045296])

HSP 1 Score: 269.626 bits (688), Expect = 1.686e-79
Identity = 164/575 (28.52%), Postives = 280/575 (48.70%), Query Frame = 2
Query:  110 YDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANP-NFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDICH--EDNKINWRLFTDSFNWQERMDFDKIEPDYSYSGDP--CESNLADWNIQNR-------------------------LQREVEREIGNWTTSNSMYNGG-GVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKAL 1741
            Y GK+ DR P +P+AGKV  V G   A CL     + +TP    +   +   P    R F+ +  DPQ+  A  + HG           L+NP P + +QQ+  DK ESIY + +  PLG+  D T   P+G D   T  G   +   + ++ +NP   + ++  + +  HD Y  +H  ++ GE   R Y  NP +F + + +GIPTP   +G      + W  +L  E+   ++ KR+DDF+EK+  ++G  LDP+ +TMN+ P H FG+  +P+ Y   DL+  R P  +  G + +RAV+ A R HL+  ++ ++  L+ A +  D +  G +   ++   C Q +L +D  L++ +FD C   +D  IN+  F +  NW++R+   + E      G    CE N+ D ++                            +QR  ++    + T++S  N   G +     P  G  T+R+D+  P+IR+ +D   YGDEG A  +++PSI ++ G+ E D    RSKEE+  +   I    ++  F+ +W +++       + ++  +  L
Sbjct:  270 YSGKFFDRVPCWPSAGKVKPV-GYRVATCLTEKLPRLMTPPEAKKYFNFRYPPAGAERVFYGRANDPQI--APYLTHGLRSKISIPMGSLINPQPITTFQQKIKDKKESIYFSHQRAPLGKSHDQTPGLPKGMDVINTTLGTPTIRELSVRDTVNPSKSFEDVLKEGQEGHDLYTVSHNDYFAGEAKNRKY--NPASFHRFNLYGIPTPHFNDGRTMAKALHWLHELQMERGAKIVSKRVDDFKEKFQHKLGKVLDPIAETMNVPPGHTFGSCLHPEEYGAGDLIHYRSPDEYLRGKDHQRAVVAAARHHLKKFNHQNFDTLQVAFRHYDKKGDGVIDRAELHEACVQANLHLDKMLLDHLFDYCDVDQDGLINYLEFANFLNWKDRIPLKEHEKRVVVKGKKPDCE-NVTDTSMGEAEPSLLINPEDIVPKEPGSSEETLRTIQRPGDKVSHQYKTTSSEINAVVGAVPSMCHPIFGVPTIRSDISAPRIRRVSDMNNYGDEGNAYSLLHPSIFSQKGVFERDFFKTRSKEEISDILTNIGVKLSKEEFENVWNLASKKHQRGEVCVETIRNVL 838          
BLAST of EF-hand domain-containing family member B vs. UniProt
Match: sp|Q8N7U6|EFHB_HUMAN (EF-hand domain-containing family member B OS=Homo sapiens OX=9606 GN=EFHB PE=1 SV=4)

HSP 1 Score: 287.345 bits (734), Expect = 2.092e-85
Identity = 171/573 (29.84%), Postives = 291/573 (50.79%), Query Frame = 2
Query:  110 YDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDICHEDNK--INWRLFTDSFNWQERMDFDKIEPDYSYSG------DPCESN----------------LADWNIQNRLQREVER---EIGNW--TTSNSMYNGGGVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKAL 1741
            Y GK+ DR P +P+AGKV  V G   A CL     + +TP    +   +   P    R F+ +  DPQ+  A  + HG        A+ L+NP P + +QQ+  DK ESIY + R  PLG+  D     P+G D   T FG   +   +AK+++NP   Y E+  +    HD Y+ +H  +Y GE   R Y+ + +F +   +G+PTP   +G      + W  +L  ++    + KR DDF+EK+  ++G  LDP+ +TMN+ P+  FG    P+ Y V DL+  R+P  +  G +R+RA++ A+R HL+ ++Y  +  L  A +  D +  G + +++++  C Q +L +D +L++Q+FD C  DN   IN+  F +  NW+++M   + E      G      +P E+N                L +     +  R + R   ++ N+  TTS+ +    G +    +P  G  T+R+D+P P+IR+ +D+T YG+EG A  ++ P+I  + G+ E D    RSKEE+  +   I    ++  F+ +W +++       + ++  +  L
Sbjct:  250 YSGKFFDRTPCWPSAGKVIPV-GYRVATCLTEKLPRLITPPEAKKYFNFRYPPAGVERVFYGRANDPQI--APYLTHGIRSKISVLANTLINPQPITTFQQKIKDKKESIYLSNRRAPLGKSHDQAPGLPKGMDTTNTTFGTAVIKEYSAKDVVNPPKSYEEVFKEGNEGHDLYVVSHNDYYAGEAKNRKYNPS-SFHRCSVYGVPTPHFNDGRAMAKSLYWLHELQMKRGAKFVSKRADDFKEKFQHKLGRVLDPIAETMNVPPDCTFGACLRPEEYGVGDLIHNRLPDEYLRGKDRQRALIAAVRHHLKKVNYQKFDTLLAAFRHYDKKGDGMIDKDELQEACDQANLSLDDKLLDQLFDYCDVDNDGFINYLEFANFLNWKDKMLLKEYEERVIIKGRKPDCVNPTEANVEEPEQTLLIKPEDIVLKEAGSTEKTLRTLLRPSDKVSNYYKTTSSEINAIVGAIPSTCYPICGVPTIRSDIPAPRIRRISDRTNYGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKLSDEEFENVWNLASKKHHRGEVCVENIRNVL 818          
BLAST of EF-hand domain-containing family member B vs. UniProt
Match: sp|Q8CDU5|EFHB_MOUSE (EF-hand domain-containing family member B OS=Mus musculus OX=10090 GN=Efhb PE=1 SV=2)

HSP 1 Score: 269.626 bits (688), Expect = 1.179e-78
Identity = 164/575 (28.52%), Postives = 280/575 (48.70%), Query Frame = 2
Query:  110 YDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANP-NFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDICH--EDNKINWRLFTDSFNWQERMDFDKIEPDYSYSGDP--CESNLADWNIQNR-------------------------LQREVEREIGNWTTSNSMYNGG-GVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKAL 1741
            Y GK+ DR P +P+AGKV  V G   A CL     + +TP    +   +   P    R F+ +  DPQ+  A  + HG           L+NP P + +QQ+  DK ESIY + +  PLG+  D T   P+G D   T  G   +   + ++ +NP   + ++  + +  HD Y  +H  ++ GE   R Y  NP +F + + +GIPTP   +G      + W  +L  E+   ++ KR+DDF+EK+  ++G  LDP+ +TMN+ P H FG+  +P+ Y   DL+  R P  +  G + +RAV+ A R HL+  ++ ++  L+ A +  D +  G +   ++   C Q +L +D  L++ +FD C   +D  IN+  F +  NW++R+   + E      G    CE N+ D ++                            +QR  ++    + T++S  N   G +     P  G  T+R+D+  P+IR+ +D   YGDEG A  +++PSI ++ G+ E D    RSKEE+  +   I    ++  F+ +W +++       + ++  +  L
Sbjct:  270 YSGKFFDRVPCWPSAGKVKPV-GYRVATCLTEKLPRLMTPPEAKKYFNFRYPPAGAERVFYGRANDPQI--APYLTHGLRSKISIPMGSLINPQPITTFQQKIKDKKESIYFSHQRAPLGKSHDQTPGLPKGMDVINTTLGTPTIRELSVRDTVNPSKSFEDVLKEGQEGHDLYTVSHNDYFAGEAKNRKY--NPASFHRFNLYGIPTPHFNDGRTMAKALHWLHELQMERGAKIVSKRVDDFKEKFQHKLGKVLDPIAETMNVPPGHTFGSCLHPEEYGAGDLIHYRSPDEYLRGKDHQRAVVAAARHHLKKFNHQNFDTLQVAFRHYDKKGDGVIDRAELHEACVQANLHLDKMLLDHLFDYCDVDQDGLINYLEFANFLNWKDRIPLKEHEKRVVVKGKKPDCE-NVTDTSMGEAEPSLLINPEDIVPKEPGSSEETLRTIQRPGDKVSHQYKTTSSEINAVVGAVPSMCHPIFGVPTIRSDISAPRIRRVSDMNNYGDEGNAYSLLHPSIFSQKGVFERDFFKTRSKEEISDILTNIGVKLSKEEFENVWNLASKKHQRGEVCVETIRNVL 838          
BLAST of EF-hand domain-containing family member B vs. TrEMBL
Match: gnl|BL_ORD_ID|18294931 (tr|A0A267G1E9|A0A267G1E9_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009714g4 PE=4 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 7.499e-110
Identity = 201/549 (36.61%), Postives = 298/549 (54.28%), Query Frame = 2
Query:  110 YDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRL-RYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPD--PTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSAN-PNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDIC--HEDNKINWRLFTDSFNWQERMDFDKIEPDYSYSGDPCESNLADWNIQNRLQREVEREIGNWTTSNSMYNGG-GVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKK 1735
            Y GKY DR PD  TAG V+ V G+TAA   K   ++  +P+P  +  R + + P E+   F+ +  DPQL  A  M HG   PK   A  ++NP P + YQQR+ D+LE+     + +PLG+ PD       P+  D   T FGI     G+A EL+NP     EL  +   D +TYL +HK    GEQA RGY+    +      +G PTP +  G  T+ CM W  D A  +   L+DKRLDDFRE+  PQ+G  LDP+KDTM + P+H FG    PD Y V DL+ GR P +F  G +R+RA++ A+R  L+ ++Y  +KDL+DA +  D   +G L+ + +R  C++  +P+D  L+EQ+ D C  + D  I+++ F +  NW++      +     Y     +S       + RL R+++  I    T+NSMY+   G      F   G +T+R+DLP P +R  +D+  YG+EG A   +NPSI T HG+ E DL  PRS EE+  +F     + +++   R +    D++    + ID F+K
Sbjct:   26 YAGKYKDRNPDLKTAGIVSDVGGDTAATATK-EMERAESPEPTKKFHRTFRSEPGERI-VFYGKASDPQLRWAERMTHGIKYPKGEGAGGVLNPTPLTFYQQRFMDRLEAAQVNAKKRPLGRCPDGREMGLLPQNLDKDNTTFGITVEKIGSAGELLNPSATPIELATEAASDANTYLVSHKALLAGEQASRGYNWRLKDAGGAKRWGKPTPHDNTGGGTRKCMSWIGDEAAARREALVDKRLDDFRERTQPQLGKNLDPIKDTMKVPPDHTFGVLHKPDPYGVGDLLHGRAPKHFLRGEDRRRALVAALRTQLKTMNYERFKDLEDAFRFYDKSGSGKLSADDIRAACREMSVPLDDSLLEQLIDFCDVNGDGLIDYQEFANFLNWRDI----SVRSQSDYGKRTLDS-------EARLARQIDESISAHKTTNSMYSAAVGRYDPTRFRTYGCATIRSDLPAPAVRSVSDRRAYGNEGDAASCLNPSIFTSHGVFEHDLKAPRSAEEISGIFSAAGISLDDSLVRRAF----DLAGADRLGIDEFRK 557          
BLAST of EF-hand domain-containing family member B vs. TrEMBL
Match: gnl|BL_ORD_ID|18235727 (tr|A0A267G9Q9|A0A267G9Q9_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009714g2 PE=4 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 1.783e-108
Identity = 200/549 (36.43%), Postives = 297/549 (54.10%), Query Frame = 2
Query:  110 YDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRL-RYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPD--PTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSAN-PNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDIC--HEDNKINWRLFTDSFNWQERMDFDKIEPDYSYSGDPCESNLADWNIQNRLQREVEREIGNWTTSNSMYNGG-GVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKK 1735
            Y GKY DR PD  TAG V+ V G+TAA   K   ++  +P+P  +  R + + P E+   F+ +  DPQL  A  M HG   PK   A  ++NP P + YQQR+ D+LE+     + +PLG+ PD       P+  D   T FGI     G+A EL+NP     EL  +   D +TYL +HK    GEQA RGY+    +      +G PTP +  G  T+ CM W  D A  +   L+DKRLDDFRE+   Q+G  LDP+KDTM + P+H FG    PD Y V DL+ GR P +F  G +R+RA++ A+R  L+ ++Y  +KDL+DA +  D   +G L+ + +R  C++  +P+D  L+EQ+ D C  + D  I+++ F +  NW++      +     Y     +S       + RL R+++  I    T+NSMY+   G      F   G +T+R+DLP P +R  +D+  YG+EG A   +NPSI T HG+ E DL  PRS EE+  +F     + +++   R +    D++    + ID F+K
Sbjct:   26 YAGKYKDRNPDLKTAGIVSDVGGDTAATATK-EMERAESPEPTKKFHRTFRSEPGERI-VFYGKASDPQLRWAERMTHGIKYPKGEGAGGVLNPTPLTFYQQRFMDRLEAAQVNAKKRPLGRCPDGREMGLLPQNLDKDNTTFGITVEKIGSAGELLNPSATPIELATEAASDANTYLVSHKALLAGEQASRGYNWRLKDAGGAKRWGKPTPHDNTGGGTRKCMSWIGDEAAARREALVDKRLDDFRERTQHQLGKNLDPIKDTMKVPPDHTFGVLHKPDPYGVGDLLHGRAPKHFLRGEDRRRALVAALRTQLKTMNYERFKDLEDAFRFYDKSGSGKLSADDIRAACREMSVPLDDSLLEQLIDFCDVNGDGLIDYQEFANFLNWRDI----SVRSQSDYGKRTLDS-------EARLARQIDESISAHKTTNSMYSAAVGRYDPTRFRTYGCATIRSDLPAPAVRSVSDRRAYGNEGDAASCLNPSIFTSHGVFEHDLKAPRSAEEISGIFSAAGISLDDSLVRRAF----DLAGADRLGIDEFRK 557          
BLAST of EF-hand domain-containing family member B vs. TrEMBL
Match: gnl|BL_ORD_ID|20308029 (tr|A0A1S3J6W5|A0A1S3J6W5_LINUN EF-hand domain-containing family member B OS=Lingula unguis OX=7574 GN=LOC106170721 PE=4 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 1.136e-105
Identity = 190/565 (33.63%), Postives = 309/565 (54.69%), Query Frame = 2
Query:   86 NVVQPKTAYDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDIC--HEDNKINWRLFTDSFNWQERM--DFDKIEPDYSYSGDPC--------ESNLADWNIQNRLQREVEREIGNWTTSNSMYNG-GGVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKAL 1741
            N+V  ++ Y GKY DR PD   AGK+   +G++A  CL  P  +PL+P+   R R        K   F+ + YDP L  A  M HG V      A  L+NP P ++++ + N K E +Y + R  PLG+  D    FPEG D     FGI    +  A  LINP     ++  + +   D Y ++H+ +  GE   R Y A PN+ K+  +G+PTP +  G LTK  ++W  +L +EK   ++ KR+DDFRE+  PQ+G   DP+KDT+ + P+H FG    PD Y   DL+ GR+P  +  G +R+R V+ AIR HL+  +Y  +++L  A +  D + TG +    +  +C QF+LPV+P+L+ Q+ D C  ++D  I++  F +  NW++++   F   + + +++ +          +S  +  +   RLQ++++  I    TS+S+ +   G L  K + + G  T+R+D+P+P+IR+  D   YGDE  A  ++NPSI +  G+ E D L+PR KEE+K +F  I       TFD +W++++       ++++ F+  L
Sbjct:   22 NIVT-QSIYAGKYRDRNPDISAAGKLT-ATGDSAYQCLTPPA-RPLSPESVRRFRATLRPDAGKPSVFYGKAYDPHLRWAADMTHGLVAQPSIAAGKLLNPQPLTLFKYKLNQKKEQLYASHRRGPLGKSHDQKPGFPEGLDVDNVTFGILTERDIGAGILINPNKSPLQVEEESEVGRDLYRKSHRDYLVGESKDRKY-APPNYGKMKLYGVPTPHDNTGGLTKKSLKWLHELQSEKAAKIVSKRVDDFRERTEPQLGQVHDPIKDTLRVPPDHTFGILVKPDTYGAGDLMHGRVPGEYLRGKDRQRGVLAAIRQHLKKANYHSFENLLHAFKFYDKDGTGKIDINNLHEVCAQFNLPVEPELLVQLMDCCDANKDGFIDYVEFANFLNWKDKLPSGFPDKKDETAHTSNAVVEDKDLVPKSPQSRASTPRRLQKQIDDAITQQKTSSSVISAVVGGLSTKDYRSYGVPTIRSDIPVPRIRRIDDTKNYGDESDAYGLLNPSIYSVQGVHEKDFLLPRPKEEIKEIFTNIGVKMTLDTFDDLWKMASQRHPKGHVSVESFRGVL 582          
BLAST of EF-hand domain-containing family member B vs. TrEMBL
Match: gnl|BL_ORD_ID|20310633 (tr|A0A1S3J6Y1|A0A1S3J6Y1_LINUN EF-hand domain-containing family member B-like OS=Lingula unguis OX=7574 GN=LOC106170730 PE=4 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 1.443e-104
Identity = 189/565 (33.45%), Postives = 308/565 (54.51%), Query Frame = 2
Query:   86 NVVQPKTAYDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDIC--HEDNKINWRLFTDSFNWQERM--DFDKIEPDYSYSGDPC--------ESNLADWNIQNRLQREVEREIGNWTTSNSMYNG-GGVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKAL 1741
            N+V  ++ Y GKY DR PD   AGK+   +G++A  CL  P  +PL+P+   R R        K   F+ + YDP L  A  M HG V      A  L+NP P ++++ + N K E +Y + R  PLG+  D    FPEG D     FGI    +  A  LINP     ++  + +   D Y ++H+ +  GE   R Y A PN+ K+  +G+PTP +  G LTK  ++W  +L +EK   ++ KR+DDFRE+  PQ+G   DP+KDT+ +  +H FG    PD Y   DL+ GR+P  +  G +R+R V+ AIR HL+  +Y  +++L  A +  D + TG +    +  +C QF+LPV+P+L+ Q+ D C  ++D  I++  F +  NW++++   F   + + +++ +          +S  +  +   RLQ++++  I    TS+S+ +   G L  K + + G  T+R+D+P+P+IR+  D   YGDE  A  ++NPSI +  G+ E D L+PR KEE+K +F  I       TFD +W++++       ++++ F+  L
Sbjct:   22 NIVT-QSIYAGKYRDRNPDISAAGKLT-ATGDSAYQCLTPPA-RPLSPESVRRFRATLRPDAGKPSVFYGKAYDPHLRWAADMTHGLVAQPSIAAGKLLNPQPLTLFKYKLNQKKEQLYASHRRGPLGKSHDQKPGFPEGLDVDNVTFGILTERDIGAGILINPNKSPLQVEEESEVGRDLYRKSHRDYLVGESKDRKY-APPNYGKMKLYGVPTPHDNTGGLTKKSLKWLHELQSEKAAKIVSKRVDDFRERTEPQLGQVHDPIKDTLRVPSDHTFGILVKPDTYGAGDLMHGRVPGEYLRGKDRQRGVLAAIRQHLKKANYHSFENLLHAFKFYDKDGTGKIDINNLHEVCAQFNLPVEPELLVQLMDCCDANKDGFIDYVEFANFLNWKDKLPSGFPDKKDETAHTSNAVVEDKDLVPKSPQSRASTPRRLQKQIDDAITQQKTSSSVISAVVGGLSTKDYRSYGVPTIRSDIPVPRIRRIDDTKNYGDESDAYGLLNPSIYSVQGVHEKDFLLPRPKEEIKEIFTNIGVKMTLDTFDDLWKMASQRHPKGHVSVESFRGVL 582          
BLAST of EF-hand domain-containing family member B vs. TrEMBL
Match: gnl|BL_ORD_ID|15736077 (tr|R7UHQ5|R7UHQ5_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_212959 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 1.227e-103
Identity = 199/561 (35.47%), Postives = 307/561 (54.72%), Query Frame = 2
Query:  110 YDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDICHE--DNKINWRLFTDSFNWQERMDFDKIEPDYSYSGDPCESNLADWNIQNRLQREVEREIGNWTTSNSMYNG--GGVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKALFFHESL---RIKY 1771
            Y GK+ DR PD  TAGK+   +G+    CL   +++P +P    R R        + R F+ +  DP L+ A+ + HG        A  LVNP PKS+YQQR  +K ES+Y T +  PLG   D    FPE Y      FGI+   NG A EL+NP+     +  + +   D Y  +HK +  GEQ  R Y +  ++ K + FG PTP +  G   K  + W TD   EK TP++ K+LDDFRE+  PQ+G   DP+KDTM++ P+H FG    PD Y V DL+  R P  +  G +R+  V+ A+R HL+ ++Y ++ +L  A +  D   TG ++ E ++ +C QFDLPVDP+L+  + D C E  D KI++  F++  NW+++M    +    + S  P   N ++  +   LQ++++  +G   TS SM N   GG+   + +   G  T+R+DL  P+I++ +D+T YGDE     + NPSI +  G+ E D LIPRSKEE++++F  I     + TFDR+   + +      ++++  +  L   ++L   +IKY
Sbjct:   24 YSGKFKDRAPDTRTAGKLT-TTGDNIHHCL-ITSERPESPAVIRRFRDSNRPDAGRIRIFYGRATDPHLQWAKEIRHGLNTQPSYMAGGLVNPEPKSLYQQRMLEKKESLYATHKRAPLGSSHDQRAGFPENYPIALRTFGIRTEKNGFAGELVNPDKSRVVVAQESEIGRDLYRESHKDYKVGEQTVRNYKS-ASYNKENTFGGPTPHDNTGKQVKTALHWLTDSRAEKATPIVSKKLDDFRERTQPQLGKVHDPIKDTMHVPPDHTFGILIKPDEYGVGDLMHSRSPGSYLRGQDRQLGVIAAMRQHLKKVNYQNFNNLLHAFRHYDKTGTGKISLEDLQQVCLQFDLPVDPELLVLLVDYCDEDKDGKISYVEFSNFLNWKDKMPTG-LPKKKAESASPRLENNSEETLPC-LQKQIDANLGGHKTSASMINAVIGGIDT-QDYRKYGVPTIRSDLAAPRIKRVSDRTNYGDECDIYGLTNPSIFSLRGLGERDFLIPRSKEELRAIFMNIGVRMEDETFDRLHDNAVNRHPKGHVSVEAMRNVLDEAQALHMEKIKY 578          
BLAST of EF-hand domain-containing family member B vs. Ensembl Cavefish
Match: efhb (EF-hand domain family, member B [Source:ZFIN;Acc:ZDB-GENE-091001-1])

HSP 1 Score: 254.988 bits (650), Expect = 1.281e-76
Identity = 156/550 (28.36%), Postives = 268/550 (48.73%), Query Frame = 2
Query:  128 DRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDIC--HEDNKINWRLFTDSFNWQERMDFDK----------IEPDYSYSGDPCESNLADWNIQNRLQREVEREIGNWTTSNSMYNGGGVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKAL 1741
            D FP    AGK+  + G+    CL+  T +P+TP    +            R F  +  DP +  A +++HG        A  LVNP+PK+ YQ++  +  E  Y ++R  PL +        PE  D   TAFG+K   NG   E+INP     ++  + +  H  Y+R+H  ++ GE+  RGY     + +   FG+ TP   +G      ++W +D        L+ KR DDFRE+  PQIG  LDP+ DT+ +  +H FG    PD +   DL+    P     G +R+RA++ A+R HL+  ++ ++  L  A +  D +  G + ++ ++ +C+QF+L +   ++E + D C   +D  IN+  F +  NW+++M              +EP  S +        A       L R    +    T+S+ +    G L    +   G  TVR DLP P+I++ +D+T YGDE  A  ++ P++ +++G+ E     PR+K ++  +F+ +  N +E TF+  W++++  S    + ++ F+  L
Sbjct:   15 DTFPTIRAAGKLIPL-GDRVQTCLQELTPRPVTPPMVKKFLSSNRPEPGAIRVFVGRANDPDI--ASSLVHGTSTRSSITAGSLVNPLPKTRYQEKLRELQEVTYNSKRKAPLERACVNGPGLPEWVDPERTAFGVKTTSNGG--EIINPPKTAEQVEKEAQEGHKQYIRSHSSYFVGERKDRGYDLG-TYLRDSRFGVSTPHRNDGHNVSRSLQWFSDTQMNHSAKLVSKRCDDFRERTQPQIGKVLDPIADTLTVPADHTFGILLRPDAFGAGDLIHSTPPSEHLRGQDRRRALVNAVRQHLKKANFHNFTSLLQAFRHYDKKGQGKIDKQDLQDVCRQFNLDLSGDVLEGLVDYCDVDKDGLINFLEFANFLNWKDKMPIRPAEQRILTRAWLEPPKSIAMALKSMVRAPLKTPRTLSRSRAEQEHFITSSSVISAVVGGLTTTDYRTYGVPTVRLDLPAPQIKRVSDRTNYGDESTAYNLLFPTVHSRYGVHEKHFFSPRTKNQMVQIFQNVGLNVSEQTFEEAWKLASIRSPTGDVCVESFRNIL 558          
BLAST of EF-hand domain-containing family member B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005076.1 (pep scaffold:Pmarinus_7.0:GL486990:2066:7900:-1 gene:ENSPMAG00000004615.1 transcript:ENSPMAT00000005076.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.479 bits (306), Expect = 3.196e-31
Identity = 74/287 (25.78%), Postives = 139/287 (48.43%), Query Frame = 2
Query:  953 DLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDICH--EDNKINWRLFTDSFNWQERMDFDKIEPDYSYSGDPC-------ESNLADWNIQN--------------RLQREVEREIGNWTTSNSMYNGG-GVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKAL 1741
            DLV  R  + +  G  R+RA++ A+R  L+  +Y+ +  L DA +  D    G +  E++++ C + +LPV+  L++ +   C    D  IN+  F +  NW++ +     E + + +G  C       +S++     Q                L ++V+R  G + TS+S+ N   G      +   G  +VRTDLP P++R   D+T YG+E     ++NPS+   HG+ E D L PRS  +++ + +      ++  F+  W  +      + ++++ F++AL
Sbjct:    4 DLVHRRPRHEWLRGSERQRALLAAVRHCLKVANYNSFPSLLDAFRHYDRNGDGKIDSEELQVACSELNLPVEAALLQDLVRYCDVDRDGFINYLEFANFLNWKQALPLSPQE-ERAVNGGACPQLDKRGKSSMGLIEPQGLVPRAPNVPSFTPFNLTKQVDRMHGRYCTSSSLVNSAIGRASSAGWHTFGVPSVRTDLPAPRVRHFGDRTNYGEESDVSGLLNPSVYALHGVYEADFLTPRSPSQIQQILRNAGVELSDGAFEDAWTTAAVQDPRREVSVESFRRAL 289          
BLAST of EF-hand domain-containing family member B vs. Ensembl Nematostella
Match: EDO30325 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T148])

HSP 1 Score: 316.62 bits (810), Expect = 8.983e-101
Identity = 176/546 (32.23%), Postives = 295/546 (54.03%), Query Frame = 2
Query:  116 GKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDIC--HEDNKINWRLFTDSFNWQERMDFDKIEPDYSYSGDPCESNLADWNIQNRLQREVEREIGNWTTSNSMYNGG--GVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKAL 1741
            G+Y DR P+   AGK+  ++G TA DCL+   +K + P+   + R  T   +   R FH +  DP +  A  ++HG        A DLVNP  KS++ QR  +K E +Y + +  PLG+  +     PEG D  +  +G+K + +G A E++NP     ++  +     + Y  +H+ +  GE   R Y  +    K   FG+ TP +  G+  K  ++W  D   EK T ++ KR+DDFRE+  PQIG   DP+KDT+ +GP+H FG    PD Y   DL+  R+   +  G  R+RAV+ AIR HL+  +Y +++DL+ A +  D + +G +  +++   C QF+LPV+P+L+E +   C   +D +IN+  F +  NW+++M   ++  +   +GD  E + +      RLQ+++++ +G W  S+ + N    GV     + A G  T+R+DLP P+IR+  D+  YGDE  A  ++NPSI + HG+ E D   PR   E++ +   I        F+ IW+++   S +  ++++ F+  +
Sbjct:    6 GRYIDRNPETIPAGKLFDITGHTARDCLQI-KEKDVHPENVRKFRATTQPFVGSERVFHGRANDPNI--AAQIVHGVNTRPSLWAEDLVNPTRKSLFAQRMLEKKEGLYASHKNAPLGECHNQVPNLPEGTDIYKACYGVKTIKDGTAGEMVNPGKTATQVEQESMEGKELYKVSHQDYEVGESYDRKYDWS-RIPKDSKFGVETPHDNNGIHVKKTLKWLHDTQQEKCTKVVSKRVDDFRERTQPQIGKVHDPIKDTLKVGPDHTFGVMVKPDEYGSGDLIHMRVRGEYLRGKERERAVVAAIRQHLKKANYHNFRDLRAAFEHYDKDKSGKICLDELTTTCTQFNLPVEPELLESLLHYCDADKDGQINYTEFANFLNWKDQMP-SRVSSETEATGDKDERSTS----PKRLQKQIDKAVG-WQKSSGLINATVDGVRTNN-WRAYGVPTIRSDLPAPRIRRVGDRMNYGDESDAYGLINPSIYSTHGVYEKDFFQPRDPFEMRRIIDGIGVEMTAEVFNNIWELAQTNSPNGMVSVESFRNIM 540          
BLAST of EF-hand domain-containing family member B vs. Ensembl Nematostella
Match: EDO30324 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T147])

HSP 1 Score: 82.0333 bits (201), Expect = 2.767e-18
Identity = 42/134 (31.34%), Postives = 74/134 (55.22%), Query Frame = 2
Query: 1346 RLQREVEREIGNWTTSNSMYNGG--GVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKAL 1741
            RLQ+++++ +G W  S+ + N    GV     + A G  T+R+DLP P+IR+  D+  YGDE  A  ++NPSI + HG+ E D   PR   E++ +   I        F+ IW+++   S +  ++++ F+  +
Sbjct:   24 RLQKQIDKAVG-WQKSSGLINATVDGVRTNN-WRAYGVPTIRSDLPAPRIRRVGDRMNYGDESDAYGLINPSIYSTHGVYEKDFFQPRDPFEMRRIIDGIGVEMTAEVFNNIWELAQTNSPNGMVSVESFRNVM 155          
BLAST of EF-hand domain-containing family member B vs. Ensembl Nematostella
Match: EDO32661 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUE4])

HSP 1 Score: 50.447 bits (119), Expect = 2.083e-6
Identity = 21/86 (24.42%), Postives = 48/86 (55.81%), Query Frame = 2
Query: 1007 RAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDICHEDNK--INWRLFTDSFNWQE 1258
            + V+ A++  LR  ++  +  +K+ACQ  D   TG+L  + +  LC++F++P   +L++++      + +  +N+  F    NW++
Sbjct:  607 QMVIAAVQEQLRKANFEDFIAMKEACQYEDMHGTGFLEAKDIHNLCRRFNIPAKSELLDEILARAERNAEGLVNYEQFLRLLNWRD 692          
BLAST of EF-hand domain-containing family member B vs. Ensembl Medaka
Match: ENSORLT00000027794.1 (EF-hand domain family member B [Source:NCBI gene;Acc:101167396])

HSP 1 Score: 169.474 bits (428), Expect = 4.080e-45
Identity = 139/556 (25.00%), Postives = 255/556 (45.86%), Query Frame = 2
Query:  140 DYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHG-KVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDIC--HEDNKINWRLFTDSFNWQERMDF------DKIEPDYSYSGDPCESNLADWNIQNRLQREV-----EREIGNWTTSNS---MYNGGGVLMGKV-----FPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKAL 1741
            + P AGK+    G+  A CL+  +  P TP    R+R      +   R    +  DP +  A ++IHG    P  +D S L+NP  K+++Q++  +  ES+Y +RR  PLG+  D     P  +D   T FG K V   + +E+INP     E+        +T +R+HK ++ G +  R Y +   F     FGIPTP   +G +    ++W  +   +   P    +    +EK   + G   +   +   L  +H+FG    PD     +++    P  +  G +     + A+R HLR L++ ++  L  A Q  D +    + ++ ++ + ++F L V   +++Q+   C   +D  +++  F +  NW++ M         + +   S   +P +  L   +I+      V     E+ I   T +++    +     L G V         G  +VR+DLP P++++  D T YGD   A  +++PS+    G+ E   L PRSKEE+  +F+ +  + +E TF+  W +++    ++ + ++ F+  L
Sbjct:   20 NMPRAGKLK-PKGDHVASCLQENSRSP-TPPAVRRVRSSIHPGLGAVRVHRGKAGDPDV--ASSLIHGVSTKPSPSDQS-LLNPPQKTLFQEKMLEVKESVYASRRKAPLGRSRDQPAQLPSWFDG-TTIFGTKTVKGLDVREIINPSKTAEEM--------ETDVRSHKDYFVGGRLNRKYDSR-CFSDDCRFGIPTPHFNDGRIVGKTLKWLGE-TQKFYNPNPVWQRSGTKEKLALEFGKVENIKLNAPPLPTDHIFGIVVPPDYTGAGEIIHCAEPGQYTRGRDSWSGQVQALRHHLRNLNFQNFPSLMKAFQHYDKKGKEMIDKDDLKAVFREFQLDVKEAVVDQLLAYCDADKDGLLSFTEFANFLNWKDLMPLHSQKLRGQRKEHQSCPSEPAQQLLFQASIKPEDPEPVRPGSTEKPIKTLTRTSAAPDQFMTSSSLTGAVSHTSNSRTSGVPSVRSDLPAPRLKRMGDTTNYGDSSTAADLLHPSVHALRGVHEEHFLCPRSKEEISEIFRNVGVDISEKTFEEAWTLASMKRPNREVCVETFRNTL 559          
BLAST of EF-hand domain-containing family member B vs. Ensembl Medaka
Match: ENSORLT00000043955.1 (EF-hand domain family member B [Source:NCBI gene;Acc:101167396])

HSP 1 Score: 167.548 bits (423), Expect = 1.657e-44
Identity = 139/559 (24.87%), Postives = 258/559 (46.15%), Query Frame = 2
Query:  140 DYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHG-KVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDIC--HEDNKINWRLFTDSFNWQERMDF------DKIEPDYSYSGDPCESNLADWNIQNRLQREV-----EREIGNWTTSNS---MYNGGGVLMGKV-----FPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKALFFH 1750
            + P AGK+    G+  A CL+  +  P TP    R+R      +   R    +  DP +  A ++IHG    P  +D S L+NP  K+++Q++  +  ES+Y +RR  PLG+  D     P  +D   T FG K V   + +E+INP     E+        +T +R+HK ++ G +  R Y +   F     FGIPTP   +G +    ++W  +   +   P    +    +EK   + G   +   +   L  +H+FG    PD     +++    P  +  G +     + A+R HLR L++ ++  L  A Q  D +    + ++ ++ + ++F L V   +++Q+   C   +D  +++  F +  NW++ M         + +   S   +P +  L   +I+      V     E+ I   T +++    +     L G V         G  +VR+DLP P++++  D T YGD   A  +++PS+    G+ E   L PRSKEE+  +F+ +  + +E TF+  W +++    ++ +++   +++LF +
Sbjct:   20 NMPRAGKLK-PKGDHVASCLQENSRSP-TPPAVRRVRSSIHPGLGAVRVHRGKAGDPDV--ASSLIHGVSTKPSPSDQS-LLNPPQKTLFQEKMLEVKESVYASRRKAPLGRSRDQPAQLPSWFDG-TTIFGTKTVKGLDVREIINPSKTAEEM--------ETDVRSHKDYFVGGRLNRKYDSR-CFSDDCRFGIPTPHFNDGRIVGKTLKWLGE-TQKFYNPNPVWQRSGTKEKLALEFGKVENIKLNAPPLPTDHIFGIVVPPDYTGAGEIIHCAEPGQYTRGRDSWSGQVQALRHHLRNLNFQNFPSLMKAFQHYDKKGKEMIDKDDLKAVFREFQLDVKEAVVDQLLAYCDADKDGLLSFTEFANFLNWKDLMPLHSQKLRGQRKEHQSCPSEPAQQLLFQASIKPEDPEPVRPGSTEKPIKTLTRTSAAPDQFMTSSSLTGAVSHTSNSRTSGVPSVRSDLPAPRLKRMGDTTNYGDSSTAADLLHPSVHALRGVHEEHFLCPRSKEEISEIFRNVGVDISEKTFEEAWTLASMKRPNREMDLYGERRSLFLN 562          
BLAST of EF-hand domain-containing family member B vs. Ensembl Medaka
Match: ENSORLT00000038247.1 (EF-hand domain family member B [Source:NCBI gene;Acc:101167396])

HSP 1 Score: 161.77 bits (408), Expect = 1.335e-42
Identity = 130/528 (24.62%), Postives = 241/528 (45.64%), Query Frame = 2
Query:  224 TPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHG-KVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDIC--HEDNKINWRLFTDSFNWQERMDF------DKIEPDYSYSGDPCESNLADWNIQNRLQREV-----EREIGNWTTSNS---MYNGGGVLMGKV-----FPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKAL 1741
            TP    R+R      +   R    +  DP +  A ++IHG    P  +D S L+NP  K+++Q++  +  ES+Y +RR  PLG+  D     P  +D   T FG K V   + +E+INP     E+        +T +R+HK ++ G +  R Y +   F     FGIPTP   +G +    ++W  +   +   P    +    +EK   + G   +   +   L  +H+FG    PD     +++    P  +  G +     + A+R HLR L++ ++  L  A Q  D +    + ++ ++ + ++F L V   +++Q+   C   +D  +++  F +  NW++ M         + +   S   +P +  L   +I+      V     E+ I   T +++    +     L G V         G  +VR+DLP P++++  D T YGD   A  +++PS+    G+ E   L PRSKEE+  +F+ +  + +E TF+  W +++    ++ + ++ F+  L
Sbjct:   21 TPPAVRRVRSSIHPGLGAVRVHRGKAGDPDV--ASSLIHGVSTKPSPSDQS-LLNPPQKTLFQEKMLEVKESVYASRRKAPLGRSRDQPAQLPSWFDG-TTIFGTKTVKGLDVREIINPSKTAEEM--------ETDVRSHKDYFVGGRLNRKYDSR-CFSDDCRFGIPTPHFNDGRIVGKTLKWLGE-TQKFYNPNPVWQRSGTKEKLALEFGKVENIKLNAPPLPTDHIFGIVVPPDYTGAGEIIHCAEPGQYTRGRDSWSGQVQALRHHLRNLNFQNFPSLMKAFQHYDKKGKEMIDKDDLKAVFREFQLDVKEAVVDQLLAYCDADKDGLLSFTEFANFLNWKDLMPLHSQKLRGQRKEHQSCPSEPAQQLLFQASIKPEDPEPVRPGSTEKPIKTLTRTSAAPDQFMTSSSLTGAVSHTSNSRTSGVPSVRSDLPAPRLKRMGDTTNYGDSSTAADLLHPSVHALRGVHEEHFLCPRSKEEISEIFRNVGVDISEKTFEEAWTLASMKRPNREVCVETFRNTL 534          
BLAST of EF-hand domain-containing family member B vs. Planmine SMEST
Match: SMESG000077905.1 (SMESG000077905.1)

HSP 1 Score: 1222.22 bits (3161), Expect = 0.000e+0
Identity = 583/586 (99.49%), Postives = 583/586 (99.49%), Query Frame = 2
Query:   56 SDFKMAVKSFNVVQPKTAYDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDICHEDNKINWRLFTDSFNWQERMDFDKIEPDYSYSGDPCESNLADWNIQNRLQREVEREIGNWTTSNSMYNGGGVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKALFFHESLRIKYEVEKEIPILEGCIS 1813
             DFKMAVKS NVVQPKTAYDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKP TPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDICHEDNKINWRLFTDSFNWQERMDFDKIEPDYSYSGDPCESNLADWNIQNRLQREVEREIGNWTTSNSMYNGGGVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKALFFHESLRIKYEVEKEIPILEGCIS
Sbjct:   24 GDFKMAVKSSNVVQPKTAYDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDKPPTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEADASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWRETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQAKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLIDKRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQGRIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYLTEEQVRLLCQQFDLPVDPQLMEQVFDICHEDNKINWRLFTDSFNWQERMDFDKIEPDYSYSGDPCESNLADWNIQNRLQREVEREIGNWTTSNSMYNGGGVLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTKHGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPINIDIFKKALFFHESLRIKYEVEKEIPILEGCIS 609          
The following BLAST results are available for this feature:
BLAST of EF-hand domain-containing family member B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
EFHB1.318e-8730.58EF-hand domain family member B [Source:HGNC Symbol... [more]
EFHB4.356e-8629.84EF-hand domain family member B [Source:HGNC Symbol... [more]
EFHB2.472e-5333.05EF-hand domain family member B [Source:HGNC Symbol... [more]
EFHB2.128e-3630.22EF-hand domain family member B [Source:HGNC Symbol... [more]
back to top
BLAST of EF-hand domain-containing family member B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing family member B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing family member B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
efhb2.900e-7727.07EF-hand domain family, member B [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of EF-hand domain-containing family member B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
npc15.066e-6929.32NPC intracellular cholesterol transporter 1 [Sourc... [more]
back to top
BLAST of EF-hand domain-containing family member B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Efhb1.686e-7928.52EF hand domain family, member B [Source:MGI Symbol... [more]
back to top
BLAST of EF-hand domain-containing family member B vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8N7U6|EFHB_HUMAN2.092e-8529.84EF-hand domain-containing family member B OS=Homo ... [more]
sp|Q8CDU5|EFHB_MOUSE1.179e-7828.52EF-hand domain-containing family member B OS=Mus m... [more]
back to top
BLAST of EF-hand domain-containing family member B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182949317.499e-11036.61tr|A0A267G1E9|A0A267G1E9_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182357271.783e-10836.43tr|A0A267G9Q9|A0A267G9Q9_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|203080291.136e-10533.63tr|A0A1S3J6W5|A0A1S3J6W5_LINUN EF-hand domain-cont... [more]
gnl|BL_ORD_ID|203106331.443e-10433.45tr|A0A1S3J6Y1|A0A1S3J6Y1_LINUN EF-hand domain-cont... [more]
gnl|BL_ORD_ID|157360771.227e-10335.47tr|R7UHQ5|R7UHQ5_CAPTE Uncharacterized protein OS=... [more]
back to top
BLAST of EF-hand domain-containing family member B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
efhb1.281e-7628.36EF-hand domain family, member B [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of EF-hand domain-containing family member B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005076.13.196e-3125.78pep scaffold:Pmarinus_7.0:GL486990:2066:7900:-1 ge... [more]
back to top
BLAST of EF-hand domain-containing family member B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing family member B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO303258.983e-10132.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303242.767e-1831.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326612.083e-624.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EF-hand domain-containing family member B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000027794.14.080e-4525.00EF-hand domain family member B [Source:NCBI gene;A... [more]
ENSORLT00000043955.11.657e-4424.87EF-hand domain family member B [Source:NCBI gene;A... [more]
ENSORLT00000038247.11.335e-4224.62EF-hand domain family member B [Source:NCBI gene;A... [more]
back to top
BLAST of EF-hand domain-containing family member B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000077905.10.000e+099.49SMESG000077905.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006438 ID=SMED30006438|Name=EF-hand domain-containing family member B|organism=Schmidtea mediterranea sexual|type=transcript|length=1833bp
GTTACAGATTTTGAATCAAATATTTTAGAATTTGATTGTTAATTAAATTA
ACTGTAGCGATTTCAAAATGGCTGTAAAAAGTTTCAATGTTGTTCAACCG
AAAACAGCTTATGATGGGAAATATACTGATCGATTTCCAGATTATCCAAC
AGCTGGTAAAGTGGCATTTGTCAGCGGAGAAACTGCAGCGGATTGTTTAA
AATTTCCAACTGACAAACCTCTAACACCTGATCCATGTATGAGGCTTCGT
TATTGGACTACTACTCCAATGGAAAAACATAGAACATTTCACGCTCAATT
TTATGATCCTCAACTTGAAAGAGCTCGCACTATGATTCATGGGAAGGTGT
TGCCGAAAGAGGCTGATGCGTCAGATCTTGTAAATCCGATTCCAAAATCT
GTATATCAACAAAGATACAATGACAAACTAGAATCAATTTACGAAACAAG
ACGTATGAAACCCCTTGGTCAAGTACCTGACCCGACTAATGCATTTCCTG
AAGGGTATGATTGGCGAGAAACTGCATTTGGAATTAAAAATGTCTACAAT
GGTAATGCGAAGGAACTTATTAATCCAGAGATAGAATACGCAGAATTGCA
CGCGAAAGACAAATTTGATCATGACACCTATCTCAGAACACATAAAAGAT
TTTATCCTGGCGAGCAAGCCAAACGAGGATATTCAGCCAATCCAAACTTC
CAGAAGCTAGATTATTTTGGAATACCAACGCCTTGTAATCGTGAAGGTTT
ATTAACAAAAGCTTGCATGCGATGGCATACTGATTTAGCAAACGAAAAGA
TAACACCATTAATTGATAAACGACTCGATGATTTTAGGGAAAAGTATACT
CCACAAATTGGGTTGCCTCTAGATCCGATGAAAGACACTATGAATCTTGG
GCCTAATCATGTGTTTGGAACAAGGTCTAATCCCGATTTGTATAAAGTAG
AAGATTTAGTGCAAGGGCGTATACCTTATTATTTCAACACGGGGCCAAAC
AGAAAACGAGCGGTTATGGGAGCCATTAGATGTCATCTTAGAGCTTTGCA
CTATAGTCATTATAAAGATTTAAAAGATGCTTGTCAATTACTTGATCCAG
AAAATACGGGTTATTTAACGGAGGAGCAAGTCCGATTACTTTGTCAACAA
TTCGATTTGCCAGTTGATCCTCAATTGATGGAGCAAGTATTTGATATTTG
TCACGAAGACAACAAAATAAACTGGAGATTATTTACTGACAGCTTTAACT
GGCAAGAACGAATGGATTTTGATAAGATTGAGCCTGATTATTCTTATTCT
GGGGATCCATGTGAAAGCAACTTAGCTGATTGGAATATTCAGAATCGTCT
TCAGAGAGAAGTTGAAAGAGAAATCGGAAATTGGACAACTAGTAATTCAA
TGTATAATGGCGGTGGAGTATTAATGGGAAAGGTTTTCCCTGCTTTGGGA
GCATCTACTGTTCGTACTGACCTTCCAATTCCCAAGATTAGAAAAGCAAC
AGACAAAACTTGTTATGGTGATGAAGGGGGTGCTCGATGTGTCGTTAATC
CAAGTATCATGACAAAACACGGAATAACTGAAATGGATCTATTAATTCCT
CGATCAAAAGAAGAGGTAAAGAGTTTATTCAAAACAATTTGTCCAAATGA
CAATGAAGCGACCTTTGACAGGATATGGCAAATCAGCAACGACATTTCTG
ACCATAAACCAATAAACATTGATATTTTCAAAAAAGCCTTATTTTTTCAT
GAAAGCCTAAGAATAAAATATGAAGTTGAAAAAGAAATACCGATATTGGA
AGGATGTATTTCTTGATCTATTATAGATTAATT
back to top

protein sequence of SMED30006438-orf-1

>SMED30006438-orf-1 ID=SMED30006438-orf-1|Name=SMED30006438-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=583bp
MAVKSFNVVQPKTAYDGKYTDRFPDYPTAGKVAFVSGETAADCLKFPTDK
PLTPDPCMRLRYWTTTPMEKHRTFHAQFYDPQLERARTMIHGKVLPKEAD
ASDLVNPIPKSVYQQRYNDKLESIYETRRMKPLGQVPDPTNAFPEGYDWR
ETAFGIKNVYNGNAKELINPEIEYAELHAKDKFDHDTYLRTHKRFYPGEQ
AKRGYSANPNFQKLDYFGIPTPCNREGLLTKACMRWHTDLANEKITPLID
KRLDDFREKYTPQIGLPLDPMKDTMNLGPNHVFGTRSNPDLYKVEDLVQG
RIPYYFNTGPNRKRAVMGAIRCHLRALHYSHYKDLKDACQLLDPENTGYL
TEEQVRLLCQQFDLPVDPQLMEQVFDICHEDNKINWRLFTDSFNWQERMD
FDKIEPDYSYSGDPCESNLADWNIQNRLQREVEREIGNWTTSNSMYNGGG
VLMGKVFPALGASTVRTDLPIPKIRKATDKTCYGDEGGARCVVNPSIMTK
HGITEMDLLIPRSKEEVKSLFKTICPNDNEATFDRIWQISNDISDHKPIN
IDIFKKALFFHESLRIKYEVEKEIPILEGCIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR040193EFHC1/EFHC2/EFHB
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 319..393
e-value: 1.9E-6
score: 29.6
NoneNo IPR availablePANTHERPTHR12086:SF12EF-HAND DOMAIN-CONTAINING FAMILY MEMBER Bcoord: 10..539
IPR040193EF-hand domain-containing protein EFHC1/EFHC2/EFHBPANTHERPTHR12086EF-HAND DOMAIN C-TERMINAL CONTAINING PROTEINcoord: 10..539
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 330..365
score: 8.321
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 322..392